[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF65947.1

[Show Plain Result]


## Summary of Sequence Search
    1::353
    2::279     6e-44  40%  282 aa  HOXQ_RALEH RecName: Full=Hydrogenase expression/formation protein
    7::281     7e-34  32%  285 aa  HYAF_ECOLI RecName: Full=Hydrogenase-1 operon protein hyaF;
   13::275     3e-30  31%  275 aa  HUPH_RHOCA RecName: Full=Hydrogenase expression/formation protein
   13::271     1e-29  33%  283 aa  HOXQ_AZOVI RecName: Full=Hydrogenase expression/formation protein
   13::272     1e-29  34%  284 aa  HUPQ_AZOCH RecName: Full=Hydrogenase expression/formation protein
  108::278     9e-26  34%  282 aa  HUPH_RHILV RecName: Full=Hydrogenase expression/formation protein
  110::283     9e-24  36%  287 aa  HUPH_BRAJA RecName: Full=Hydrogenase expression/formation protein
   22::71      6e-17  60%   72 aa  RUBR_AZOVI RecName: Full=Rubredoxin;         Short=Rd;
   17::69      8e-17  60%   70 aa  RUBL_RHILV RecName: Full=Probable rubredoxin hupI;
   25::74      2e-16  58%   78 aa  RUBR_RALEH RecName: Full=Rubredoxin;         Short=Rd;
   16::68      3e-16  60%   69 aa  RUBL_BRAJA RecName: Full=Probable rubredoxin hupI;
   22::72      5e-16  55%   72 aa  RUBR_AZOCH RecName: Full=Rubredoxin in uptake hydrogenase operon;
   26::73      2e-13  54%  278 aa  HUPJ_RHOCA RecName: Full=Probable rubredoxin hupJ;
   21::74      5e-13  54%   80 aa  RUBR1_METJA RecName: Full=Probable rubredoxin 1;         Short=RD
  425::474     4e-12  46%  479 aa  NORV_SALPA RecName: Full=Anaerobic nitric oxide reductase
  425::474     8e-12  46%  479 aa  NORV_SALTI RecName: Full=Anaerobic nitric oxide reductase
  425::474     8e-12  46%  479 aa  NORV_SALPB RecName: Full=Anaerobic nitric oxide reductase
  425::474     8e-12  46%  479 aa  NORV_SALAR RecName: Full=Anaerobic nitric oxide reductase
  429::477     1e-11  49%  482 aa  NORV_ENT38 RecName: Full=Anaerobic nitric oxide reductase
  407::471     1e-11  38%  479 aa  NORV_SHISS RecName: Full=Anaerobic nitric oxide reductase
  407::471     1e-11  38%  479 aa  NORV_ECOHS RecName: Full=Anaerobic nitric oxide reductase
  425::474     2e-11  44%  479 aa  NORV_SALTY RecName: Full=Anaerobic nitric oxide reductase
  425::471     2e-11  47%  479 aa  NORV_SHIFL RecName: Full=Anaerobic nitric oxide reductase
  425::471     2e-11  47%  479 aa  NORV_SHIF8 RecName: Full=Anaerobic nitric oxide reductase
  425::471     2e-11  47%  479 aa  NORV_SHIDS RecName: Full=Anaerobic nitric oxide reductase
  425::471     2e-11  47%  479 aa  NORV_SHIBS RecName: Full=Anaerobic nitric oxide reductase
  425::471     2e-11  47%  479 aa  NORV_ECOUT RecName: Full=Anaerobic nitric oxide reductase
  425::471     2e-11  47%  479 aa  NORV_ECOSM RecName: Full=Anaerobic nitric oxide reductase
  425::471     2e-11  47%  479 aa  NORV_ECOLI RecName: Full=Anaerobic nitric oxide reductase
  425::471     2e-11  47%  479 aa  NORV_ECOLC RecName: Full=Anaerobic nitric oxide reductase
  425::471     2e-11  47%  479 aa  NORV_ECOL6 RecName: Full=Anaerobic nitric oxide reductase
  425::471     2e-11  47%  479 aa  NORV_ECOL5 RecName: Full=Anaerobic nitric oxide reductase
  425::471     2e-11  47%  479 aa  NORV_ECOK1 RecName: Full=Anaerobic nitric oxide reductase
  425::471     2e-11  47%  479 aa  NORV_ECODH RecName: Full=Anaerobic nitric oxide reductase
  357::403     2e-11  47%  411 aa  NORV_ECO57 RecName: Full=Anaerobic nitric oxide reductase
  425::471     2e-11  47%  479 aa  NORV_ECO24 RecName: Full=Anaerobic nitric oxide reductase
  425::474     4e-11  44%  479 aa  NORV_SALCH RecName: Full=Anaerobic nitric oxide reductase
  429::477     6e-11  45%  482 aa  NORV_CITK8 RecName: Full=Anaerobic nitric oxide reductase
  429::477     8e-11  47%  482 aa  NORV_KLEP7 RecName: Full=Anaerobic nitric oxide reductase
    3::49      1e-10  47%   52 aa  RUBR_CLOTS RecName: Full=Rubredoxin;         Short=Rd;
    7::59      1e-10  45%  111 aa  RUBR_ANASP RecName: Full=Rubredoxin;         Short=Rd;
    6::63      2e-10  40%   63 aa  RUBR_METTH RecName: Full=Probable rubredoxin;         Short=RD;
    7::59      2e-10  45%  111 aa  RUBR_ANAVT RecName: Full=Rubredoxin;         Short=Rd;
  445::505     2e-10  43%  509 aa  NORV_ERWCT RecName: Full=Anaerobic nitric oxide reductase
  431::477     3e-10  45%  485 aa  NORV_SERP5 RecName: Full=Anaerobic nitric oxide reductase
  180::226     3e-10  45%  229 aa  HRB_MOOTA RecName: Full=High molecular weight rubredoxin;AltName:
  454::499     5e-10  46%  503 aa  NORV_PECCP RecName: Full=Anaerobic nitric oxide reductase
    6::49      7e-10  55%   52 aa  RUBR_DESGI RecName: Full=Rubredoxin;         Short=Rd;
    6::49      1e-09  48%   53 aa  RUBR2_CLOPE RecName: Full=Rubredoxin 2;         Short=Rd 2;
    3::62      2e-09  47%   69 aa  RUBR1_CHLTE RecName: Full=Rubredoxin 1;         Short=Rd 1;
    5::52      2e-09  44%   52 aa  RUBR2_CHLTE RecName: Full=Rubredoxin 2;         Short=Rd 2;
    6::53      2e-09  40%   53 aa  RUBR1_CLOPE RecName: Full=Rubredoxin 1;         Short=Rd 1;
    6::52      3e-09  43%   52 aa  RUBR_TREPA RecName: Full=Rubredoxin;         Short=Rd;
    6::54      3e-09  43%   54 aa  RUBR_PYRFU RecName: Full=Rubredoxin;         Short=Rd;
  124::172     3e-09  41%  173 aa  RUBR2_PSEOL RecName: Full=Rubredoxin 2;AltName: Full=Two-iron
  467::512     3e-09  46%  521 aa  NORV_AERS4 RecName: Full=Anaerobic nitric oxide reductase
    6::49      4e-09  48%   53 aa  RUBR_BUTME RecName: Full=Rubredoxin;         Short=Rd;
  441::486     4e-09  48%  495 aa  NORV_AERHH RecName: Full=Anaerobic nitric oxide reductase
    6::49      6e-09  52%   52 aa  RUBR_HELMO RecName: Full=Rubredoxin;         Short=Rd;
    6::42      6e-09  65%   45 aa  RUBR1_DESDA RecName: Full=Rubredoxin 1;         Short=Rd-1;
    1::53      1e-08  42%   53 aa  RUBR_PYRAB RecName: Full=Rubredoxin;         Short=Rd;
   19::68      1e-08  42%  115 aa  RUBR_SYNY3 RecName: Full=Rubredoxin;         Short=Rd;
    6::54      1e-08  43%   54 aa  RUBR_CLOAB RecName: Full=Rubredoxin;         Short=Rd;
    6::49      2e-08  45%   53 aa  RUBR_CLOST RecName: Full=Rubredoxin;         Short=Rd;
  423::490     2e-08  42%  494 aa  NORV_VIBVY RecName: Full=Anaerobic nitric oxide reductase
  423::490     2e-08  42%  494 aa  NORV_VIBVU RecName: Full=Anaerobic nitric oxide reductase
    6::49      2e-08  50%   53 aa  RUBR_CHLLT RecName: Full=Rubredoxin;         Short=Rd;
    4::55      2e-08  44%   55 aa  RUBR2_METJA RecName: Full=Probable rubredoxin 2;         Short=RD
    6::49      4e-08  50%   52 aa  RUBR_DESVH RecName: Full=Rubredoxin;         Short=Rd;
    3::52      5e-08  40%   52 aa  RUBR_MEGEL RecName: Full=Rubredoxin;         Short=Rd;
    6::54      5e-08  39%   54 aa  RUBR_CLOPA RecName: Full=Rubredoxin;         Short=Rd;
  447::495     5e-08  41%  496 aa  NORV_VIBF1 RecName: Full=Anaerobic nitric oxide reductase
    3::53      7e-08  41%   54 aa  RUBR_ACIAD RecName: Full=Rubredoxin;         Short=Rd;
    6::49      7e-08  50%   53 aa  RUBR3_CHLTE RecName: Full=Rubredoxin 3;         Short=Rd 3;
  450::498     7e-08  39%  499 aa  NORV_ALISL RecName: Full=Anaerobic nitric oxide reductase
    3::55      9e-08  43%   62 aa  RUBR2_DESDA RecName: Full=Rubredoxin 2;         Short=Rd-2;
    6::49      1e-07  45%   52 aa  RUBR_DESVM RecName: Full=Rubredoxin;         Short=Rd;
    6::42      2e-06  46%   61 aa  RUBR3_RHOSQ RecName: Full=Rubredoxin 3;
    6::42      2e-06  46%   61 aa  RUBR3_RHOER RecName: Full=Rubredoxin 3;
    8::56      6e-06  35%   60 aa  RUBR4_RHOSQ RecName: Full=Rubredoxin 4;
    8::56      6e-06  35%   60 aa  RUBR4_RHOER RecName: Full=Rubredoxin 4;
    3::53      3e-05  39%   53 aa  RUBR_PEPAS RecName: Full=Rubredoxin;         Short=Rd;
   13::60      7e-05  33%   63 aa  RUBR2_RHOER RecName: Full=Rubredoxin 2;
  209::277     0.001  40%  313 aa  RN126_MOUSE RecName: Full=RING finger protein 126;
    1::353

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxHSRTIPVVNIAGPGSQPEEEDFNFLPIPAGINLPLTPVLPEQALPAELRVARHILTTLIRDMDNPVAT
HOXQ_RALEH      --NSFPIPVV-LLGPGSQAEDETLDYIHMPQGMSVYTPPVLPEPEQIACLTQAQSVLRAILDALDRADPK
HYAF_ECOLI      ----------HLLGPGTQPNDDSFSMNP------LPITCQVNDEPSMAALEQCAHSVIALLNELQHQLSE
HUPH_RHOCA      -------------GPGSQPEDEELGYMQLPSGMRT-YSAHLPEVEDSSAVTPALKLLDEIAAGAE--ACA
HOXQ_AZOVI      -------------GPGSHGEEERPDCPSMPRAMRRFERPALPE---PGQLS-GHPIXXXXXXXXXXXXXX
HUPQ_AZOCH      -------------GPGSHGEEDRLDYLPMPREMHTFERPSLPE---PEQLD-SHPIXXXXXXXXXXXXXX
HUPH_RHILV      ----------------------------------------------------------------------
HUPH_BRAJA      ----------------------------------------------------------------------
RUBR_AZOVI      ----------------------------------------------------------------------
RUBL_RHILV      ----------------------------------------------------------------------
RUBR_RALEH      ----------------------------------------------------------------------
RUBL_BRAJA      ----------------------------------------------------------------------
RUBR_AZOCH      ----------------------------------------------------------------------
HUPJ_RHOCA      ----------------------------------------------------------------------
RUBR1_METJA     ----------------------------------------------------------------------
NORV_SALPA      ----------------------------------------------------------------------
NORV_SALTI      ----------------------------------------------------------------------
NORV_SALPB      ----------------------------------------------------------------------
NORV_SALAR      ----------------------------------------------------------------------
NORV_ENT38      ----------------------------------------------------------------------
NORV_SHISS      ----------------------------------------------------------------------
NORV_ECOHS      ----------------------------------------------------------------------
NORV_SALTY      ----------------------------------------------------------------------
NORV_SHIFL      ----------------------------------------------------------------------
NORV_SHIF8      ----------------------------------------------------------------------
NORV_SHIDS      ----------------------------------------------------------------------
NORV_SHIBS      ----------------------------------------------------------------------
NORV_ECOUT      ----------------------------------------------------------------------
NORV_ECOSM      ----------------------------------------------------------------------
NORV_ECOLI      ----------------------------------------------------------------------
NORV_ECOLC      ----------------------------------------------------------------------
NORV_ECOL6      ----------------------------------------------------------------------
NORV_ECOL5      ----------------------------------------------------------------------
NORV_ECOK1      ----------------------------------------------------------------------
NORV_ECODH      ----------------------------------------------------------------------
NORV_ECO57      ----------------------------------------------------------------------
NORV_ECO24      ----------------------------------------------------------------------
NORV_SALCH      ----------------------------------------------------------------------
NORV_CITK8      ----------------------------------------------------------------------
NORV_KLEP7      ----------------------------------------------------------------------
RUBR_CLOTS      ----------------------------------------------------------------------
RUBR_ANASP      ----------------------------------------------------------------------
RUBR_METTH      ----------------------------------------------------------------------
RUBR_ANAVT      ----------------------------------------------------------------------
NORV_ERWCT      ----------------------------------------------------------------------
NORV_SERP5      ----------------------------------------------------------------------
HRB_MOOTA       ----------------------------------------------------------------------
NORV_PECCP      ----------------------------------------------------------------------
RUBR_DESGI      ----------------------------------------------------------------------
RUBR2_CLOPE     ----------------------------------------------------------------------
RUBR1_CHLTE     ----------------------------------------------------------------------
RUBR2_CHLTE     ----------------------------------------------------------------------
RUBR1_CLOPE     ----------------------------------------------------------------------
RUBR_TREPA      ----------------------------------------------------------------------
RUBR_PYRFU      ----------------------------------------------------------------------
RUBR2_PSEOL     ----------------------------------------------------------------------
NORV_AERS4      ----------------------------------------------------------------------
RUBR_BUTME      ----------------------------------------------------------------------
NORV_AERHH      ----------------------------------------------------------------------
RUBR_HELMO      ----------------------------------------------------------------------
RUBR1_DESDA     ----------------------------------------------------------------------
RUBR_PYRAB      ----------------------------------------------------------------------
RUBR_SYNY3      ----------------------------------------------------------------------
RUBR_CLOAB      ----------------------------------------------------------------------
RUBR_CLOST      ----------------------------------------------------------------------
NORV_VIBVY      ----------------------------------------------------------------------
NORV_VIBVU      ----------------------------------------------------------------------
RUBR_CHLLT      ----------------------------------------------------------------------
RUBR2_METJA     ----------------------------------------------------------------------
RUBR_DESVH      ----------------------------------------------------------------------
RUBR_MEGEL      ----------------------------------------------------------------------
RUBR_CLOPA      ----------------------------------------------------------------------
NORV_VIBF1      ----------------------------------------------------------------------
RUBR_ACIAD      ----------------------------------------------------------------------
RUBR3_CHLTE     ----------------------------------------------------------------------
NORV_ALISL      ----------------------------------------------------------------------
RUBR2_DESDA     ----------------------------------------------------------------------
RUBR_DESVM      ----------------------------------------------------------------------
RUBR3_RHOSQ     ----------------------------------------------------------------------
RUBR3_RHOER     ----------------------------------------------------------------------
RUBR4_RHOSQ     ----------------------------------------------------------------------
RUBR4_RHOER     ----------------------------------------------------------------------
RUBR_PEPAS      ----------------------------------------------------------------------
RUBR2_RHOER     ----------------------------------------------------------------------
RN126_MOUSE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LPFPLSYKLNATEQQNSGLLDQLLGEGEISARVLLSDGKEQRIQETVFTGVWRVREYNADQQRVADEIII
HOXQ_RALEH      QPNP-RIELWALDEENRQLLKQVLGEGEVSARI---EGEYQYIQEAVFAGVWRVVSTCPDA--TTDYIEV
HYAF_ECOLI      RQPPLGEXXXXXXXXXXXFINTLLGEGEVSVRIQQADDSESEIQEAIFCGLWRVRRRRGEKL-LEDKLEA
HUPH_RHOCA      RGGMASFDLAGLDAQNRALIAETMGQGEVAMKI--RGIPALMVQESVFAGVWSVAGAGVDR------IEV
HOXQ_AZOVI      YRIGEQSRVIGLDRQPKALLQQILGEGEVAIQV--GGQRPARIQETVLAGVWWVQLQIGRGEVVGQWLEV
HUPQ_AZOCH      YRIGEQSRVIGLDRQPKALLQQILGEGEVAIQV--GGQRPVRIQETVLAGVWXXXXXXXXXXXXXXXXXX
HUPH_RHILV      -----------------------------------------QMQEAVMAGVWRIRFTDVDGRLIADYIEV
HUPH_BRAJA      ------------------------------------DGSLAQIQESVLAGIWRVRETDANHEYLE----I
RUBR_AZOVI      ----------------------------------------------------------------------
RUBL_RHILV      ----------------------------------------------------------------------
RUBR_RALEH      ----------------------------------------------------------------------
RUBL_BRAJA      ----------------------------------------------------------------------
RUBR_AZOCH      ----------------------------------------------------------------------
HUPJ_RHOCA      ----------------------------------------------------------------------
RUBR1_METJA     ----------------------------------------------------------------------
NORV_SALPA      ----------------------------------------------------------------------
NORV_SALTI      ----------------------------------------------------------------------
NORV_SALPB      ----------------------------------------------------------------------
NORV_SALAR      ----------------------------------------------------------------------
NORV_ENT38      ----------------------------------------------------------------------
NORV_SHISS      ----------------------------------------------------------------------
NORV_ECOHS      ----------------------------------------------------------------------
NORV_SALTY      ----------------------------------------------------------------------
NORV_SHIFL      ----------------------------------------------------------------------
NORV_SHIF8      ----------------------------------------------------------------------
NORV_SHIDS      ----------------------------------------------------------------------
NORV_SHIBS      ----------------------------------------------------------------------
NORV_ECOUT      ----------------------------------------------------------------------
NORV_ECOSM      ----------------------------------------------------------------------
NORV_ECOLI      ----------------------------------------------------------------------
NORV_ECOLC      ----------------------------------------------------------------------
NORV_ECOL6      ----------------------------------------------------------------------
NORV_ECOL5      ----------------------------------------------------------------------
NORV_ECOK1      ----------------------------------------------------------------------
NORV_ECODH      ----------------------------------------------------------------------
NORV_ECO57      ----------------------------------------------------------------------
NORV_ECO24      ----------------------------------------------------------------------
NORV_SALCH      ----------------------------------------------------------------------
NORV_CITK8      ----------------------------------------------------------------------
NORV_KLEP7      ----------------------------------------------------------------------
RUBR_CLOTS      ----------------------------------------------------------------------
RUBR_ANASP      ----------------------------------------------------------------------
RUBR_METTH      ----------------------------------------------------------------------
RUBR_ANAVT      ----------------------------------------------------------------------
NORV_ERWCT      ----------------------------------------------------------------------
NORV_SERP5      ----------------------------------------------------------------------
HRB_MOOTA       ----------------------------------------------------------------------
NORV_PECCP      ----------------------------------------------------------------------
RUBR_DESGI      ----------------------------------------------------------------------
RUBR2_CLOPE     ----------------------------------------------------------------------
RUBR1_CHLTE     ----------------------------------------------------------------------
RUBR2_CHLTE     ----------------------------------------------------------------------
RUBR1_CLOPE     ----------------------------------------------------------------------
RUBR_TREPA      ----------------------------------------------------------------------
RUBR_PYRFU      ----------------------------------------------------------------------
RUBR2_PSEOL     ----------------------------------------------------------------------
NORV_AERS4      ----------------------------------------------------------------------
RUBR_BUTME      ----------------------------------------------------------------------
NORV_AERHH      ----------------------------------------------------------------------
RUBR_HELMO      ----------------------------------------------------------------------
RUBR1_DESDA     ----------------------------------------------------------------------
RUBR_PYRAB      ----------------------------------------------------------------------
RUBR_SYNY3      ----------------------------------------------------------------------
RUBR_CLOAB      ----------------------------------------------------------------------
RUBR_CLOST      ----------------------------------------------------------------------
NORV_VIBVY      ----------------------------------------------------------------------
NORV_VIBVU      ----------------------------------------------------------------------
RUBR_CHLLT      ----------------------------------------------------------------------
RUBR2_METJA     ----------------------------------------------------------------------
RUBR_DESVH      ----------------------------------------------------------------------
RUBR_MEGEL      ----------------------------------------------------------------------
RUBR_CLOPA      ----------------------------------------------------------------------
NORV_VIBF1      ----------------------------------------------------------------------
RUBR_ACIAD      ----------------------------------------------------------------------
RUBR3_CHLTE     ----------------------------------------------------------------------
NORV_ALISL      ----------------------------------------------------------------------
RUBR2_DESDA     ----------------------------------------------------------------------
RUBR_DESVM      ----------------------------------------------------------------------
RUBR3_RHOSQ     ----------------------------------------------------------------------
RUBR3_RHOER     ----------------------------------------------------------------------
RUBR4_RHOSQ     ----------------------------------------------------------------------
RUBR4_RHOER     ----------------------------------------------------------------------
RUBR_PEPAS      ----------------------------------------------------------------------
RUBR2_RHOER     ----------------------------------------------------------------------
RN126_MOUSE     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GPIPESIWQTHXXXXXXXXXXXXXAGLMNGAFIAHEIAERVKQPVKEPHIINLTLLPVNDADREYLDHFL
HOXQ_RALEH      GAAPEVLRGAYGANQWSLDVGRVPDGVMNAPSILAEIDDQLLSPGKPVHVVNLTLLPMSPQDITFLDETL
HYAF_ECOLI      GCAPLALWQTQNLLPTDSLLPPPIDGLMNGLPLAHELLAHVRNPDAQPHSINLTQLPISEADRLFLSRLC
HUPH_RHOCA      GAVPAAALSREPFRKGQTALPPLSDGVVNAPALIAELFDKSAAYVGAADVINLTLLPHTEEDLTLLDYML
HOXQ_AZOVI      ADVPALVRRRAFAETRWPQLGELPDGLLNAGPVLVELLDAAKRHAERPHAVNLSLLPFSPEDRRFLAERL
HUPQ_AZOCH      ADIPALVRRAFAEARWPRLGATLPDDLLNAGPVLVELLEAAKQHAEHPHVINLSLLPFSAEDQRFLAEQL
HUPH_RHILV      ASIPAAVRQACSGLPASISHGPAPAGAMNVMPVLTEIGDRIARDGDPAHVITFSLFPMSPEDMAFLQDAL
HUPH_BRAJA      GAVPEIVKRAAADLTSADFEIGQVPGAMNVLPVLAEIRERALRPGIRSQIINFTLLPMSPVDMSFLQDTI
RUBR_AZOVI      ----------------------------------------------------------------------
RUBL_RHILV      ----------------------------------------------------------------------
RUBR_RALEH      ----------------------------------------------------------------------
RUBL_BRAJA      ----------------------------------------------------------------------
RUBR_AZOCH      ----------------------------------------------------------------------
HUPJ_RHOCA      ----------------------------------------------------------------------
RUBR1_METJA     ----------------------------------------------------------------------
NORV_SALPA      ----------------------------------------------------------------------
NORV_SALTI      ----------------------------------------------------------------------
NORV_SALPB      ----------------------------------------------------------------------
NORV_SALAR      ----------------------------------------------------------------------
NORV_ENT38      ----------------------------------------------------------------------
NORV_SHISS      ----------------------------------------------------------------------
NORV_ECOHS      ----------------------------------------------------------------------
NORV_SALTY      ----------------------------------------------------------------------
NORV_SHIFL      ----------------------------------------------------------------------
NORV_SHIF8      ----------------------------------------------------------------------
NORV_SHIDS      ----------------------------------------------------------------------
NORV_SHIBS      ----------------------------------------------------------------------
NORV_ECOUT      ----------------------------------------------------------------------
NORV_ECOSM      ----------------------------------------------------------------------
NORV_ECOLI      ----------------------------------------------------------------------
NORV_ECOLC      ----------------------------------------------------------------------
NORV_ECOL6      ----------------------------------------------------------------------
NORV_ECOL5      ----------------------------------------------------------------------
NORV_ECOK1      ----------------------------------------------------------------------
NORV_ECODH      ----------------------------------------------------------------------
NORV_ECO57      ----------------------------------------------------------------------
NORV_ECO24      ----------------------------------------------------------------------
NORV_SALCH      ----------------------------------------------------------------------
NORV_CITK8      ----------------------------------------------------------------------
NORV_KLEP7      ----------------------------------------------------------------------
RUBR_CLOTS      ----------------------------------------------------------------------
RUBR_ANASP      ----------------------------------------------------------------------
RUBR_METTH      ----------------------------------------------------------------------
RUBR_ANAVT      ----------------------------------------------------------------------
NORV_ERWCT      ----------------------------------------------------------------------
NORV_SERP5      ----------------------------------------------------------------------
HRB_MOOTA       ----------------------------------------------------------------------
NORV_PECCP      ----------------------------------------------------------------------
RUBR_DESGI      ----------------------------------------------------------------------
RUBR2_CLOPE     ----------------------------------------------------------------------
RUBR1_CHLTE     ----------------------------------------------------------------------
RUBR2_CHLTE     ----------------------------------------------------------------------
RUBR1_CLOPE     ----------------------------------------------------------------------
RUBR_TREPA      ----------------------------------------------------------------------
RUBR_PYRFU      ----------------------------------------------------------------------
RUBR2_PSEOL     ----------------------------------------------------------------------
NORV_AERS4      ----------------------------------------------------------------------
RUBR_BUTME      ----------------------------------------------------------------------
NORV_AERHH      ----------------------------------------------------------------------
RUBR_HELMO      ----------------------------------------------------------------------
RUBR1_DESDA     ----------------------------------------------------------------------
RUBR_PYRAB      ----------------------------------------------------------------------
RUBR_SYNY3      ----------------------------------------------------------------------
RUBR_CLOAB      ----------------------------------------------------------------------
RUBR_CLOST      ----------------------------------------------------------------------
NORV_VIBVY      ----------------------------------------------------------------------
NORV_VIBVU      ----------------------------------------------------------------------
RUBR_CHLLT      ----------------------------------------------------------------------
RUBR2_METJA     ----------------------------------------------------------------------
RUBR_DESVH      ----------------------------------------------------------------------
RUBR_MEGEL      ----------------------------------------------------------------------
RUBR_CLOPA      ----------------------------------------------------------------------
NORV_VIBF1      ----------------------------------------------------------------------
RUBR_ACIAD      ----------------------------------------------------------------------
RUBR3_CHLTE     ----------------------------------------------------------------------
NORV_ALISL      ----------------------------------------------------------------------
RUBR2_DESDA     ----------------------------------------------------------------------
RUBR_DESVM      ----------------------------------------------------------------------
RUBR3_RHOSQ     ----------------------------------------------------------------------
RUBR3_RHOER     ----------------------------------------------------------------------
RUBR4_RHOSQ     ----------------------------------------------------------------------
RUBR4_RHOER     ----------------------------------------------------------------------
RUBR_PEPAS      ----------------------------------------------------------------------
RUBR2_RHOER     ----------------------------------------------------------------------
RN126_MOUSE     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GEGCSAIFSRGYGKCRIVSTHFPGVWRVNYFNDMNTLLQDMIEIADIPDIAVAGIDDIEDAYAGLKNTLE
HOXQ_RALEH      GAASVTILSRGYGNCRISSTAVPYCWRVVYFNSQDTTILNTVEITDLPEVACAAPEDLRDSHERLTEVLK
HYAF_ECOLI      GPGNIQIRTIGYGESYINATGLRHVWHLRCTDTLKGPLLESYEICPIPEVVLAAPEDLVDSAQRLSEVCQ
HUPH_RHOCA      GEGAVTILSRGYGNCRITATATPHVWRVQFYNSTDALILDTIEVTTMPEVALAAREDLEDSAGRIREVLE
HOXQ_AZOVI      GEGSVTLLSRGYGNCRIASTATPGIWCVQYFNSSDRLILDTLEVTGIPQVACAAQEDIDDS---------
HUPQ_AZOCH      GEGPVTVLSRGYGNCRIASTATPGIWRVQYFNSTDRLILDTLEVTAIPQAACAAQEDIDDS---------
HUPH_RHILV      GAGPVQLTSRGYGTCRVVATGARNVWSVQFYNAMDTIILDTLEVCNIPSVAIAAEEDFRDSEARLRDIWE
HUPH_BRAJA      RNGPIQLVSRGYGTCRVLSTGIRNVWSVQFFNAMDTIILDTLEVGGVPTVALAADEDFEDSAERLKEIIE
RUBR_AZOVI      ----------------------------------------------------------------------
RUBL_RHILV      ----------------------------------------------------------------------
RUBR_RALEH      ----------------------------------------------------------------------
RUBL_BRAJA      ----------------------------------------------------------------------
RUBR_AZOCH      ----------------------------------------------------------------------
HUPJ_RHOCA      ----------------------------------------------------------------------
RUBR1_METJA     ----------------------------------------------------------------------
NORV_SALPA      ----------------------------------------------------------------------
NORV_SALTI      ----------------------------------------------------------------------
NORV_SALPB      ----------------------------------------------------------------------
NORV_SALAR      ----------------------------------------------------------------------
NORV_ENT38      ----------------------------------------------------------------------
NORV_SHISS      ------------------------------------------------------------------NTVV
NORV_ECOHS      ------------------------------------------------------------------NTVV
NORV_SALTY      ----------------------------------------------------------------------
NORV_SHIFL      ----------------------------------------------------------------------
NORV_SHIF8      ----------------------------------------------------------------------
NORV_SHIDS      ----------------------------------------------------------------------
NORV_SHIBS      ----------------------------------------------------------------------
NORV_ECOUT      ----------------------------------------------------------------------
NORV_ECOSM      ----------------------------------------------------------------------
NORV_ECOLI      ----------------------------------------------------------------------
NORV_ECOLC      ----------------------------------------------------------------------
NORV_ECOL6      ----------------------------------------------------------------------
NORV_ECOL5      ----------------------------------------------------------------------
NORV_ECOK1      ----------------------------------------------------------------------
NORV_ECODH      ----------------------------------------------------------------------
NORV_ECO57      ----------------------------------------------------------------------
NORV_ECO24      ----------------------------------------------------------------------
NORV_SALCH      ----------------------------------------------------------------------
NORV_CITK8      ----------------------------------------------------------------------
NORV_KLEP7      ----------------------------------------------------------------------
RUBR_CLOTS      ----------------------------------------------------------------------
RUBR_ANASP      ----------------------------------------------------------------------
RUBR_METTH      ----------------------------------------------------------------------
RUBR_ANAVT      ----------------------------------------------------------------------
NORV_ERWCT      ----------------------------------------------------------------------
NORV_SERP5      ----------------------------------------------------------------------
HRB_MOOTA       ----------------------------------------------------------------------
NORV_PECCP      ----------------------------------------------------------------------
RUBR_DESGI      ----------------------------------------------------------------------
RUBR2_CLOPE     ----------------------------------------------------------------------
RUBR1_CHLTE     ----------------------------------------------------------------------
RUBR2_CHLTE     ----------------------------------------------------------------------
RUBR1_CLOPE     ----------------------------------------------------------------------
RUBR_TREPA      ----------------------------------------------------------------------
RUBR_PYRFU      ----------------------------------------------------------------------
RUBR2_PSEOL     ----------------------------------------------------------------------
NORV_AERS4      ----------------------------------------------------------------------
RUBR_BUTME      ----------------------------------------------------------------------
NORV_AERHH      ----------------------------------------------------------------------
RUBR_HELMO      ----------------------------------------------------------------------
RUBR1_DESDA     ----------------------------------------------------------------------
RUBR_PYRAB      ----------------------------------------------------------------------
RUBR_SYNY3      ----------------------------------------------------------------------
RUBR_CLOAB      ----------------------------------------------------------------------
RUBR_CLOST      ----------------------------------------------------------------------
NORV_VIBVY      ----------------------------------------------------------------------
NORV_VIBVU      ----------------------------------------------------------------------
RUBR_CHLLT      ----------------------------------------------------------------------
RUBR2_METJA     ----------------------------------------------------------------------
RUBR_DESVH      ----------------------------------------------------------------------
RUBR_MEGEL      ----------------------------------------------------------------------
RUBR_CLOPA      ----------------------------------------------------------------------
NORV_VIBF1      ----------------------------------------------------------------------
RUBR_ACIAD      ----------------------------------------------------------------------
RUBR3_CHLTE     ----------------------------------------------------------------------
NORV_ALISL      ----------------------------------------------------------------------
RUBR2_DESDA     ----------------------------------------------------------------------
RUBR_DESVM      ----------------------------------------------------------------------
RUBR3_RHOSQ     ----------------------------------------------------------------------
RUBR3_RHOER     ----------------------------------------------------------------------
RUBR4_RHOSQ     ----------------------------------------------------------------------
RUBR4_RHOER     ----------------------------------------------------------------------
RUBR_PEPAS      ----------------------------------------------------------------------
RUBR2_RHOER     ----------------------------------------------------------------------
RN126_MOUSE     -----------------------------------------------------------------KEKIQ


                         .         *         .         .         .         .         +:350
query           WLKEYPVTENEPVVRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDEGxxx
HOXQ_RALEH      WV--------------------------------------------------------------------
HYAF_ECOLI      WLAE------------------------------------------------------------------
HUPH_RHOCA      AIR-------------------------------------------------------------------
HOXQ_AZOVI      ----------------------------------------------------------------------
HUPQ_AZOCH      ----------------------------------------------------------------------
HUPH_RHILV      ----------------------------------------------------------------------
HUPH_BRAJA      ----------------------------------------------------------------------
RUBR_AZOVI      ---------------LECKICWQRYDPAEGDPVWQIPPGTPFAALPAHWRCPRCDGDREQFMVVD-----
RUBL_RHILV      --------------RMECGICWHVYDPAEGDPVWQIPPGTPFSNLTEDWRCPNCDALQSKFMRLGDG---
RUBR_RALEH      --------------RLECKICWWEYDPEVGDPVWQIAPGTSFSALPAHWRCPNCDGEAEQFMVL------
RUBL_BRAJA      ------------VTRLECGICWTVYDPADGDDVAQIAPGTPFAALPEEWHCPNCDAPKSKFMAIE-----
RUBR_AZOCH      ---------------LECKICWHRYDPAVGDEVWQILAGTPFAALPAHWRCPQCDGDREQFMVVDD----
HUPJ_RHOCA      ---------------MECKICWTPYDPASGDEFRQVLPGTPFTALPEDWHCPNCDAPKAQFIV-------
RUBR1_METJA     --------------KYKCKVCGWVYDPLKGDPSQNIPPKTPFEELPDTWICPVCKVGKESFEPLDE----
NORV_SALPA      --------------KMQCSVCQWIYDPALGEPLQDVAPGTPWSEVPDNFLCPECSLGKDVFDVL------
NORV_SALTI      --------------KMQCSVCQWIYDPALGEPLQDVAPGTPWSDVPDNFLCPECSLGKDVFDVL------
NORV_SALPB      --------------KMQCSVCQWIYDPALGEPLQDVAPGTPWSDVPDNFLCPECSLGKDVFDVL------
NORV_SALAR      --------------KMQCSVCQWIYDPALGEPLQDVAPGTPWSDVPDNFLCPECSLGKDVFDVL------
NORV_ENT38      ---------------MQCSVCQWVYDPALGEPLQDVAPGTPWSDVPDNFLCPECSLGKDVFDVL------
NORV_SHISS      KEETSATTKSDLGPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_ECOHS      KEETSATTKSDLGPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_SALTY      --------------KMQCSVCQWIYDPALGEPLQDVAPGTPWNDVPDNFLCPECSLGKDVFDVL------
NORV_SHIFL      --------------RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_SHIF8      --------------RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_SHIDS      --------------RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_SHIBS      --------------RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_ECOUT      --------------RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_ECOSM      --------------RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_ECOLI      --------------RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_ECOLC      --------------RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_ECOL6      --------------RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_ECOL5      --------------RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_ECOK1      --------------RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_ECODH      --------------RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_ECO57      --------------RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_ECO24      --------------RMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVF---------
NORV_SALCH      --------------KMQCSVCQWIYDPAQGEPLQDVAPGTPWSDVPDNFLCPECSLGKDVFDVL------
NORV_CITK8      ---------------MQCSVCQWIYDPAKGEPLQDVAPGTPWSDVPDNFLCPECSLGKDVFDVL------
NORV_KLEP7      ---------------MQCSVCQWVYDPAKGEPNQDVQPGTPWSEVPDNFLCPECSLGKDVFDVL------
RUBR_CLOTS      --------------KWQCTVCGYIYDPEVGDPTQNIPPGTKFEDLPDDWVCPDCGVGKDQF---------
RUBR_ANASP      --------ENTVLDRFECRSCGYVYEPEKGDNKHDIAPETPFAELPINWRCPVCTAKKAAF---------
RUBR_METTH      -------SEVSAMKRYKCRVCGYIYDPEKGEPRTDTPPGTPFEDLPETWRCPSCGAKKKMFKPLD-----
RUBR_ANAVT      --------ENTVLDRFECRSCGYVYEPEKGDSKHDIAPETPFAELPINWRCPVCTAKKAAF---------
NORV_ERWCT      -----PQSATQPTVQMQCSVCQWIYDPALGEPMQDVTPGTMWSDVPDSFLCPECGLGKDVF---------
NORV_SERP5      --------------RMQCSVCLWIYDPALGEPMQDVAPGTCWQEVPDDFLCPECAMGKEVF---------
HRB_MOOTA       --------------KYQCTICNYVYDPVQGDPEHGIAPGTPFADLPEDWTCPICGAGKDAF---------
NORV_PECCP      ---------------MQCSVCQWIYDPALGEPMQDVTPGTMWSDVPDSFLCPECGLGKDVF---------
RUBR_DESGI      -----------------CTVCGYEYDPAKGDPDSGIKPGTKFEDLPDDWACPVCGASKDAF---------
RUBR2_CLOPE     -----------------CDVCGYIYDPAVGDPDNGVEPGTEFKDIPDDWVCPLCGVDKSQF---------
RUBR1_CHLTE     ------VKESEPAASWMCAECGYIYDPAEGNLETNIRPGMPFDKLPDDWSCPVCNHPKNQF---------
RUBR2_CHLTE     ----------------KCNICGYIYNPETGDPEGDIPAGTSFESLPDSWMCPVCGAGKEEFTKI------
RUBR1_CLOPE     -----------------CDVCGYIYDPVVGDPDNGVAPGTKFKDIPDTWVCPLCKLDKTHFSKVE-----
RUBR_TREPA      -----------------CDLCGWGYNPEVGDADGGIPAGTAFENLPDHWECPLCGVDKTSFVKV------
RUBR_PYRFU      -----------------CKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED----
RUBR2_PSEOL     -----------------CITCGHIYDEALGDEAEGFTPGTRFEDIPDDWCCPDCGATKEDYVLYEE----
NORV_AERS4      ---------------MLCTVCQWIYDPALGEPDQLVAPGTPWARVPDSFLCPGCGIGKEVF---------
RUBR_BUTME      -----------------CDICGYVYDPAVGDPDNGVAPGTAFADLPEDWVCPECGVSKDEF---------
NORV_AERHH      ---------------MLCTVCQWVYDPAQGEPDQLVAPGTPWAQVPDSFLCPGCGIGKEVF---------
RUBR_HELMO      -----------------CLVCGYVYDPAKGDPDHGIAPGTAFEDLPADWVCPLCGVSKDEF---------
RUBR1_DESDA     -----------------CNVCGYEYDPAEHDNV-------PFDQLPDDWCCPVCGVSKDQF---------
RUBR_PYRAB      ------------MAKWRCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGAPKSEFERIE-----
RUBR_SYNY3      ----------------ECRACGYVYIPSQGDQKTSVSPGTPFEALPLNWKCPVCGAPRNYFISTGE----
RUBR_CLOAB      -----------------CVVCGYIYDPAEGDPDNGVNPGTSFEDIPDDWVCPLCGVGKDQFEPSEE----
RUBR_CLOST      -----------------CTVCGYVYDPEVGDPDNNINPGTSFQDIPEDWVCPLCGVGKDQF---------
NORV_VIBVY      ---QQPLTETTPTADMVCTVCNWVYDPAKGEPNQGIEVGTTWADVPDYFLCPECHLGKDVFV--------
NORV_VIBVU      ---QQPLTETTPTADMVCTVCNWVYDPAKGEPNQGIEVGTTWADVPDYFLCPECHLGKDVFV--------
RUBR_CHLLT      -----------------CSVCGYVYDPADGEPDDPIDPGTGFEDLPEDWVCPVCGVDKDLF---------
RUBR2_METJA     ------------MARYQC-MCGWVYDEDKGEPSQNIPPGTKFEDLPDTFRCPQCGLGKNAFRKID-----
RUBR_DESVH      -----------------CTVCGYEYDPAEGDPDNGVKPGTSFDDLPADWVCPVCGAPKSEF---------
RUBR_MEGEL      --------------KYECSICGYIYDEAEGDD-GNVAAGTKFADLPADWVCPTCGADKDAFVKMD-----
RUBR_CLOPA      -----------------CTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE----
NORV_VIBF1      ---------------MLCSVCNWVYDPEIGEPNQGVEPNTPWSSVPNDFLCPECHLGKDVFVEI------
RUBR_ACIAD      --------------KYQCIVCGWIYDEAEGWPQDGIAPGTKWEDIPDDWTCPDCGVSKVDFEMIE-----
RUBR3_CHLTE     -----------------CVPCGYEYDPADGDPENGIEPGTAFEDLPEDWVCPVCGVDKSFF---------
NORV_ALISL      ---------------MLCTVCNWVYDPEIGEPNQGVEPNTAWIDVPDYFLCPECNLGKDVFVEV------
RUBR2_DESDA     ----------EPQDMWRCQMCGYVYDPDRGDKRRKVPAGTKFEDLPEDWRCPVCGAGKKSF---------
RUBR_DESVM      -----------------CTVCGYEYDPAEGDPDNGVKPGTAFEDVPADWVCPICGAPKSEF---------
RUBR3_RHOSQ     -----------------CPVCEYVYDESKGAPREGFPAGTPWDAVPDDWCCPDC----------------
RUBR3_RHOER     -----------------CPVCEYVYDESKGAPREGFPAGTPWDAVPDDWCCPDC----------------
RUBR4_RHOSQ     ----------------QCAQCGFEYDEAVGWPEDGIEPGTRWDDIPEDWSCPDCGAAKSDFFMVE-----
RUBR4_RHOER     ----------------QCAQCGFEYDEAVGWPEDGIEPGTRWDDIPEDWSCPDCGAAKSDFFMVE-----
RUBR_PEPAS      --------------KFECTLCGYIYDPAL------VGPDTPFEDVSENWVCPLCGAGKEDFEVYED----
RUBR2_RHOER     -----------------CLQCGFEYDEAIGWPDDGIEPGTRWDEIPEDWSCPDCGAAKVDFEMVE-----
RN126_MOUSE     ALPTVPVTEEHVGSGLECPVC--KEDYALGESVRQLPCNHLFHDLEQHDSCPVCRKSLTG----------


                         .         .         .         .         *         .         .:420
query           xxx
HOXQ_RALEH      ---
HYAF_ECOLI      ---
HUPH_RHOCA      ---
HOXQ_AZOVI      ---
HUPQ_AZOCH      ---
HUPH_RHILV      ---
HUPH_BRAJA      ---
RUBR_AZOVI      ---
RUBL_RHILV      ---
RUBR_RALEH      ---
RUBL_BRAJA      ---
RUBR_AZOCH      ---
HUPJ_RHOCA      ---
RUBR1_METJA     ---
NORV_SALPA      ---
NORV_SALTI      ---
NORV_SALPB      ---
NORV_SALAR      ---
NORV_ENT38      ---
NORV_SHISS      ---
NORV_ECOHS      ---
NORV_SALTY      ---
NORV_SHIFL      ---
NORV_SHIF8      ---
NORV_SHIDS      ---
NORV_SHIBS      ---
NORV_ECOUT      ---
NORV_ECOSM      ---
NORV_ECOLI      ---
NORV_ECOLC      ---
NORV_ECOL6      ---
NORV_ECOL5      ---
NORV_ECOK1      ---
NORV_ECODH      ---
NORV_ECO57      ---
NORV_ECO24      ---
NORV_SALCH      ---
NORV_CITK8      ---
NORV_KLEP7      ---
RUBR_CLOTS      ---
RUBR_ANASP      ---
RUBR_METTH      ---
RUBR_ANAVT      ---
NORV_ERWCT      ---
NORV_SERP5      ---
HRB_MOOTA       ---
NORV_PECCP      ---
RUBR_DESGI      ---
RUBR2_CLOPE     ---
RUBR1_CHLTE     ---
RUBR2_CHLTE     ---
RUBR1_CLOPE     ---
RUBR_TREPA      ---
RUBR_PYRFU      ---
RUBR2_PSEOL     ---
NORV_AERS4      ---
RUBR_BUTME      ---
NORV_AERHH      ---
RUBR_HELMO      ---
RUBR1_DESDA     ---
RUBR_PYRAB      ---
RUBR_SYNY3      ---
RUBR_CLOAB      ---
RUBR_CLOST      ---
NORV_VIBVY      ---
NORV_VIBVU      ---
RUBR_CHLLT      ---
RUBR2_METJA     ---
RUBR_DESVH      ---
RUBR_MEGEL      ---
RUBR_CLOPA      ---
NORV_VIBF1      ---
RUBR_ACIAD      ---
RUBR3_CHLTE     ---
NORV_ALISL      ---
RUBR2_DESDA     ---
RUBR_DESVM      ---
RUBR3_RHOSQ     ---
RUBR3_RHOER     ---
RUBR4_RHOSQ     ---
RUBR4_RHOER     ---
RUBR_PEPAS      ---
RUBR2_RHOER     ---
RN126_MOUSE     ---