[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF65952.1

[Show Plain Result]


## Summary of Sequence Search
    1::87
  395::445     7e-04  44%  476 aa  GATB1_CLOAB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   34::90      0.001  45%  113 aa  SYME_ECOLI RecName: Full=Toxic protein symE;AltName:
   34::90      0.001  45%  113 aa  SYME_ECOBW RecName: Full=Endoribonuclease symE;       
   34::90      0.001  45%  112 aa  SYME_ECO27 RecName: Full=Endoribonuclease symE;       
    1::87

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxYSQIPSGDCQEEAGFETGASVVVKISERGLILIAETDEVRDLRKELYQVK
GATB1_CLOAB     ----------------------------------FETGKSPKNIIEEEGLIQNSNEDEILNIVKELSENE
SYME_ECOLI      --------------------YSRIPAGQWLEAAGFATGTAVDVKVMEGCIVLTAQAAEESELMQSLRQVC
SYME_ECOBW      --------------------YSRIPAGQWLEAAGFATGTAVDVKVMEGCIVLTAQAAEESELMQSLRQVC
SYME_ECO27      --------------------YSRIPAGQWLETAGFATGTAVDVKVMEGCIVLTAQAAEESELMQSLRQVC


                         .         .         *         .         .         .         .:140
query           KSMKHIKAGVNNVVxxx
GATB1_CLOAB     KSIEDYKNGKNRVV---
SYME_ECOLI      K----------------
SYME_ECOBW      K----------------
SYME_ECO27      K----------------