[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF66015.1

[Show Plain Result]


## Summary of Sequence Search
    1::160
    1::160     2e-91 100%  160 aa  IAGB_SALTY RecName: Full=Invasion protein iagB;Flags: Precursor;
    1::160     1e-89  98%  160 aa  IAGB_SALTI RecName: Full=Invasion protein iagB;Flags: Precursor;
    4::152     2e-35  45%  152 aa  IPGF_SHIFL RecName: Full=Protein ipgF;Flags: Precursor;
   18::152     8e-35  49%  152 aa  IPGF_SHISO RecName: Full=Protein ipgF;Flags: Precursor;
   12::156     3e-23  42%  167 aa  PBL_ECO57 RecName: Full=Peptidoglycan-binding-like protein;Flags:
    4::161     1e-20  38%  169 aa  X191_ECOLX RecName: Full=X polypeptide;AltName: Full=ORF
    4::146     5e-20  37%  169 aa  X192_ECOLX RecName: Full=X polypeptide;AltName: Full=ORF
    4::146     8e-20  37%  169 aa  X19F_ECOLI RecName: Full=X polypeptide;AltName: Full=ORF
    4::146     1e-19  37%  169 aa  X193_ECOLX RecName: Full=X polypeptide;AltName: Full=ORF
   28::148     2e-19  44%  158 aa  PBL_ECOLI RecName: Full=Putative peptidoglycan-binding-like
    7::126     2e-05  29%  265 aa  VP07_BPPRD RecName: Full=Transglycosylase;       
 1429::1514    3e-05  35% 2285 aa  YOMI_BACSU RecName: Full=SPBc2 prophage-derived uncharacterized
  288::386     9e-05  37%  467 aa  MLTF_ALCBS RecName: Full=Membrane-bound lytic murein
   46::75      2e-04  53%  143 aa  LYSC_TAKRU RecName: Full=Lysozyme C;         EC=3.2.1.17;AltName:
  297::403     5e-04  35%  490 aa  MLTF_PSEAE RecName: Full=Membrane-bound lytic murein
  296::402     5e-04  35%  489 aa  MLTF_PSEAB RecName: Full=Membrane-bound lytic murein
   32::60      6e-04  55%  125 aa  LYSC1_TACAC RecName: Full=Lysozyme C I;       
   33::61      8e-04  55%  130 aa  LYSC_PHAVE RecName: Full=Lysozyme C;         EC=3.2.1.17;AltName:
   50::78      8e-04  55%  147 aa  LYSC_PHACO RecName: Full=Lysozyme C;         EC=3.2.1.17;AltName:
    1::160

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MHYFFIIVIWLLSINTAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFH
IAGB_SALTY      MHYFFIIVIWLLSINTAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFH
IAGB_SALTI      MHYFFIIVIWLLSINTAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFH
IPGF_SHIFL      ----FVFILLCFIPHLGRADCWDKAGERYNIPSSLLKAIAEKESGFNKSAVNVNNNGSKDYGIMQINDFH
IPGF_SHISO      ------------------ADCWDKAGERYNIPSSLLKAIAEKESGFNKFAVNVNNNGSKDYGIMQINDFH
PBL_ECO57       ----FTLSILITKMSFASSACFNEAGTMFRIEPNLIKAIALVESNLKKDSIGKNRDKSFDYGLMQINQMH
X191_ECOLX      ----WMLAICLMFINGICADCFDLAGRDYKIDPDLLRAISWKESRYRVNAIGINPVTGYGSGLMQVDSQH
X192_ECOLX      ----WMLAICLMFINEICTDCFDLAGRDYKIDPDLLRAISWKESRYRVNAIGINPVTGYGSGLMQVDSQH
X19F_ECOLI      ----WMLAICLMFINEICTDCFDLAGRDYKIDPDLLRAISWKESRYRVNAIGINPVTGYGSGLMQVDSQH
X193_ECOLX      ----WMLAICLMFINEICTDCFDLAGRDYKIDPDLLRAISWKESRYRVNAIGINPVTGYGSGLMQVDSQH
PBL_ECOLI       --------------------CSNEAGTMFRIEPNLIKAIALVESNLKKDSIGKNRDKSLDYWLMQINQMH
VP07_BPPRD      -----------------WWETIGAASAQYNLDPRLVAGVVQTESSGNP----RTTSGVGAMGLMQLMP--
YOMI_BACSU      ------------------------AASKYNVDPALIAAVIQQESGFNAKA----RSGVGAMGLMQLMP--
MLTF_ALCBS      -----------------YEDLFKQAEEDSGFDWRLLAALAYQESLWDPQAI----SPTGVKGLMMLTN--
LYSC_TAKRU      --------------------------------------LSKWESQYNTNAINHNTDGSTDYGIFQINS--
MLTF_PSEAE      -----------------------QSGKQLDTDWRLLAAIGYQESLWQPGAT--SKTGVR--GLMMLTN--
MLTF_PSEAB      -----------------------QSGKQLDTDWRLLAAIGYQESLWQPGAT--SKTGVR--GLMMLTN--
LYSC1_TACAC     ---------------------------------------AFHESSYNTRATNHNTDGSTDYGILQINS--
LYSC_PHAVE      ---------------------------------------AKFESNFNTGATNRNTDGSTDYGILQINS--
LYSC_PHACO      ---------------------------------------AKFESNFNTGATNRNTDGSTDYGILQINS--


                         .         .         *         .         .         .         .:140
query           MKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYR
IAGB_SALTY      MKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYR
IAGB_SALTI      MKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGFSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYR
IPGF_SHIFL      SKRLREMGYSEEMLISHPCLSVHYAAKLLNEFMMMYGRGWEAVGAYNAGTSPKKKKERLKYAEDIYRRYL
IPGF_SHISO      SKRLREMGYSEEMLISHPCLSVHYAAKLLNEFMMMYGRGWEAVGAYNAGTSPKKKKERLKYAEDIYRRYL
PBL_ECO57       IPMLKKRGIDERDLLDNPCLNIKIGTEILYKHFSRCGMTWQCLGTYNAGFAMDNQKKRLQYAKKIYIVYT
X191_ECOLX      FNELARYGIKPEHLTTDPCMNIYTGAYYLAIAFKKWGVSWEAVGAYNAGKTERQNQRRLAYASEVYRIYK
X192_ECOLX      FNELARYGIKPEHLTTDPCMNIYTGAYYLAIAFKKWGVTWEAVGAYNAGKSERQNQRRLAYASEVYRIYT
X19F_ECOLI      FNELARYGIKPEHLTTDPCMNIYTGAYYLAIAFKKWGVSWEAVGAYNAGKTERQNQRRLAYASDVYRIYT
X193_ECOLX      FNELARYGINPEHLTTDPCMNIYTGAYYLAIAFKKWGITWEAVGAYNAGKTERQNQRRLAYASDVYRIYT
PBL_ECOLI       IPLLKKRGIDERDLLDNPCLNIKIGTEILYNHFSRCGVTWQCLGTYNAGFAMDNQKKRQQYAPK------
VP07_BPPRD      -ATAKSLGVTNAY---DPTQNIYGGAALLRENLDRYGDVNTALLAYHGGTNQANWGAKKSYPGKVMKNIN
YOMI_BACSU      -ATAKSLGVNN---AYDPYQNVMGGTKYLAQQLEKFGGNVEALAAYNAG---------------------
MLTF_ALCBS      -NTARQMGISDR---TDPSQSIRAGAGYLPDRIPEPSRTWMALAAYNVG---------------------
LYSC_TAKRU      ----------------------------------------------------------------------
MLTF_PSEAE      -RTAQAMGVSNKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIG-GAHLEDARKMAEKE------
MLTF_PSEAB      -RTAQAMGVSNKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIG-GAHLEDARKMAEKE------
LYSC1_TACAC     ----------------------------------------------------------------------
LYSC_PHAVE      ----------------------------------------------------------------------
LYSC_PHACO      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KLKGMSAEEKNKRLSIAANK
IAGB_SALTY      KLKGMSAEEKNKRLSIAANK
IAGB_SALTI      KLKEMSAEEKNKRLSIAVNK
IPGF_SHIFL      RIAAES-KQNNRRI------
IPGF_SHISO      RIAAES-KQNNRRI------
PBL_ECO57       RL------------------
X191_ECOLX      SSKGIRVPTTKKSLS-----
X192_ECOLX      GIK-----------------
X19F_ECOLI      GIK-----------------
X193_ECOLX      GIK-----------------
PBL_ECOLI       --------------------
VP07_BPPRD      LLFGNS--------------
YOMI_BACSU      --------------------
MLTF_ALCBS      --------------------
LYSC_TAKRU      --------------------
MLTF_PSEAE      --------------------
MLTF_PSEAB      --------------------
LYSC1_TACAC     --------------------
LYSC_PHAVE      --------------------
LYSC_PHACO      --------------------