[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF66055.1

[Show Plain Result]


## Summary of Sequence Search
    1::377
  159::352     9e-22  30%  361 aa  Y1143_METJA RecName: Full=Uncharacterized mscS family protein
  151::357     3e-19  25%  368 aa  Y812_AQUAE RecName: Full=Uncharacterized mscS family protein
  261::509     6e-17  28%  623 aa  Y415_HELPY RecName: Full=Uncharacterized mscS family protein
  261::509     6e-17  28%  623 aa  Y415_HELPJ RecName: Full=Uncharacterized mscS family protein
   63::344     6e-17  24%  350 aa  Y170_METJA RecName: Full=Uncharacterized mscS family protein
   19::348     5e-16  21%  371 aa  YHDY_BACSU RecName: Full=Uncharacterized mscS family protein yhdY;
  842::1110    3e-13  25% 1120 aa  KEFA_ECOLI RecName: Full=Potassium efflux system kefA;       
  139::328     3e-12  23%  343 aa  YNAI_ECOLI RecName: Full=MscS family inner membrane protein ynaI;
  139::328     3e-12  23%  343 aa  YNAI_ECO57 RecName: Full=MscS family inner membrane protein ynaI;
   10::277     5e-12  23%  296 aa  Y639_SYNY3 RecName: Full=Uncharacterized mscS family protein
   69::275     6e-12  23%  283 aa  Y437_BUCAP RecName: Full=Uncharacterized mscS family protein
   69::193     2e-10  26%  281 aa  Y402_BUCBP RecName: Full=Uncharacterized mscS family protein
  915::1093    2e-10  27% 1111 aa  Y195A_HAEIN RecName: Full=Uncharacterized mscS family protein
  514::657     6e-09  26%  734 aa  Y5208_ARATH RecName: Full=Uncharacterized protein At5g12080;
   69::257     8e-09  26%  286 aa  MSCS_SHIFL RecName: Full=Small-conductance mechanosensitive
   46::275     8e-09  25%  286 aa  MSCS_EDWI9 RecName: Full=Small-conductance mechanosensitive
   69::257     8e-09  26%  286 aa  MSCS_ECOLI RecName: Full=Small-conductance mechanosensitive
   69::257     8e-09  26%  286 aa  MSCS_ECO57 RecName: Full=Small-conductance mechanosensitive
   55::181     1e-08  24%  283 aa  Y1546_ARCFU RecName: Full=Uncharacterized mscS family protein
   93::217     3e-08  24%  305 aa  Y452_BUCAI RecName: Full=Uncharacterized mscS family protein BU452;
  101::188     2e-07  31%  280 aa  YFKC_BACSU RecName: Full=Uncharacterized mscS family protein yfkC;
  503::604     5e-07  22%  741 aa  YBIO_ECOLI RecName: Full=Uncharacterized mscS family protein ybiO;
  109::179     1e-06  30%  267 aa  YKUT_BACSU RecName: Full=Uncharacterized mscS family protein ykuT;
   16::130     2e-06  25%  491 aa  Y1270_CORGL RecName: Full=Uncharacterized protein Cgl1270/cg1434;
  860::1082    4e-06  20% 1107 aa  YJEP_ECOLI RecName: Full=Uncharacterized mscS family protein
  673::756     3e-05  27%  856 aa  Y1861_ARATH RecName: Full=Uncharacterized mscS family protein
    1::377

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxINLAVVFFVTLITYWLINWLLNVVYKALQRPDKKDDAHGRLRPIVFEMLKK
Y1143_METJA     ----------------------------------------------------------------------
Y812_AQUAE      ----------------------------------------------------------------------
Y415_HELPY      ---------------------------------WLLALLLDRIFEIMQRNKKM---HVNVQKSI------
Y415_HELPJ      ---------------------------------WLLALLLDRIFEIMQRNKKM---HVNVQSSI------
Y170_METJA      ----------------------------------------------------------------------
YHDY_BACSU      -------------------ISLAILLVFLILRKLFTRYFFNLLFNLTNRPKTEI-----FKQVVLAFDKP
KEFA_ECOLI      ----------------------------------------------------------------------
YNAI_ECOLI      ----------------------------------------------------------------------
YNAI_ECO57      ----------------------------------------------------------------------
Y639_SYNY3      ----------------------------------------------------------------------
Y437_BUCAP      ----------------------------------------------------------------------
Y402_BUCBP      ----------------------------------------------------------------------
Y195A_HAEIN     ----------------------------------------------------------------------
Y5208_ARATH     ----------------------------------------------------------------------
MSCS_SHIFL      ----------------------------------------------------------------------
MSCS_EDWI9      ----------------------------------------------------------------------
MSCS_ECOLI      ----------------------------------------------------------------------
MSCS_ECO57      ----------------------------------------------------------------------
Y1546_ARCFU     ----------------------------------------------------------------------
Y452_BUCAI      ----------------------------------------------------------------------
YFKC_BACSU      ----------------------------------------------------------------------
YBIO_ECOLI      ----------------------------------------------------------------------
YKUT_BACSU      ----------------------------------------------------------------------
Y1270_CORGL     ----------------------------------------------------------------------
YJEP_ECOLI      ----------------------------------------------------------------------
Y1861_ARATH     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TSKMLIFFAAFLFSLRFVALPDRLFSTLSHAWFLVVAIQMAIWLDQGVQSWMRHLLYAPGSNKNPVTLVI
Y1143_METJA     ----------------------------------------------------------------------
Y812_AQUAE      ----------------------------------------------------------------------
Y415_HELPY      VSPVSVFLALFSCD---VALDIFYYPNASSMWVGAVYIMLLAWLVIALFKGYGEALVTNMATKSTHNFEV
Y415_HELPJ      VSPVSVFLALFSCD---VALDIFYYPNASSMWVGAVYIMLLAWLVIALFKGYGEALVTNVATKSTHNFEV
Y170_METJA      ---VLVVTLFFYFGLRFLILPDYILKLIDEAVKVVVILSATYFAVKFIDGIFEHYLI-PLTEKTETELXX
YHDY_BACSU      ARWFFVALGLFL-AIRYSPFLDEQMPVISKIYLIVALLCWGLCNLTATSSFIFHKVNQRFEDMDDILAPF
KEFA_ECOLI      --------------------------TMGSLLFAIIASMVAWALIRNLPGLLEVLVLSRLNMRQGASYAI
YNAI_ECOLI      ----------------------------------------------------------------------
YNAI_ECO57      ----------------------------------------------------------------------
Y639_SYNY3      ---IMSFFPNNIFDYDQQAITDLLITXXXXXXXXXXXXXXGFWLSKRLQKLIIRALRK--SNLEPTFISF
Y437_BUCAP      ----------------------------------------------------------------------
Y402_BUCBP      ----------------------------------------------------------------------
Y195A_HAEIN     ----------------------------------------------------------------------
Y5208_ARATH     ---------------------------------------------------------------NKLVTAI
MSCS_SHIFL      ----------------------------------------------------------------------
MSCS_EDWI9      ---------------------------------------------RGISTTLIRLLKARGLD---VTVVF
MSCS_ECOLI      ----------------------------------------------------------------------
MSCS_ECO57      ----------------------------------------------------------------------
Y1546_ARCFU     ----------------------------------------------------------------------
Y452_BUCAI      ----------------------------------------------------------------------
YFKC_BACSU      ----------------------------------------------------------------------
YBIO_ECOLI      ------------------------------------------------------------SARTRTLLTL
YKUT_BACSU      ----------------------------------------------------------------------
Y1270_CORGL     ------------------------------------------------------------TTKNQLAFAG
YJEP_ECOLI      ---------------------------------------------------LQHLDLTPGTGYAITTIT-
Y1861_ARATH     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LGMILRVLVWSMMLLSILANVGVDITALVASLGVGGIAIALAVQTVLSDVFASLSIGFDKPFEIGDFVVF
Y1143_METJA     ------------------SNLGYDIKTXXXXXXXXXXXXXXXSQNLVSNLIAGLIILTDKPFKIGNWITF
Y812_AQUAE      ---ILKAFVVVIVGASLLQEWGVNXXXXXXXXXXXXXXXXXXXKDTFENILSGLIILLDKPVKVGETVKV
Y415_HELPY      INLILKVLIFIVALLGVLKQLGFNVSAIIASLGIGGXXXXXXXXXXXXNFFASVILLLDNSFSQGDWIVC
Y415_HELPJ      INLILKVLIFIVALLGVLKQLGFNVSAIIASLGIGGXXXXXXXXXXXXNFFASVILLLDNSFSQGDWIVC
Y170_METJA      XXXXXXXXXXXXXXXXALSSVGYDITXXXXXXXXXXXXXXXXMQDTIKNFIAGILILIDKPFSLGHWVKV
YHDY_BACSU      LSKLLRFVIIALSVSVIAQEFNYDVNXXXXXXXXXXXXXXXXXKDTISNFFGGIIIITEKPFTIGDWVET
KEFA_ECOLI      T-TILNYIIIAVGAMTVFGSLGVSLQWLAAALSVG---LGFGLQEIFGNFVSGLIILFERPVRIGDTVTI
YNAI_ECOLI      ---------------------GMSLSGLLTFXXXXXXXXXXXXKDILSNFFSGIMLYFDRPFSIGDWIRS
YNAI_ECO57      ---------------------GMSLSGLLTFXXXXXXXXXXXXKDILSNFFSGIMLYFDRPFSIGDWIRS
Y639_SYNY3      AGNISYYXXXXXXXXXXXAQLGIQTSSLVALLGASTLAIGLALQGSLANVAGGILLVLFNYFRVGERIEV
Y437_BUCAP      LSALMRYIIITFTLIASLGRIGVQTTSVXXXXXXXXXXXXXXXQGSLSNFAAGVLLVTLRPLKTGEYVNL
Y402_BUCBP      LAALVRYIIITFALIASLGCIGVQTTSVXXXXXXXXXXXXXXXQGSLSNFAAGVLLVILRPFRTGEYVNL
Y195A_HAEIN     ---------------------------LFAALSVG---LGFGMQEIFANFVSGIILLFERPIRVGDVVTI
Y5208_ARATH     L-MVVTVVIWLLLL-------EVATTKVLLFFSTQLVALAFIIGSTCKNLFESIVFVFVMPYDVGDRCVV
MSCS_SHIFL      LSALVRYGIIAFTLIAALGRVGVQTXXXXXXXXXXXXXXXXXXXXXXXNLAAGVLLVMFRPFRAGEYVDL
MSCS_EDWI9      LAAMVRYAILAFTIIAALGRLGVQTTXXXXXXXXXXXXXXXXXXXXXXNFAAGVLLVLFRPFRAGEVVDL
MSCS_ECOLI      LSALVRYGIIAFTLIAALGRVGVQTXXXXXXXXXXXXXXXXXXXXXXXNLAAGVLLVMFRPFRAGEYVDL
MSCS_ECO57      LSALVRYGIIAFTLIAALGRVGVQTXXXXXXXXXXXXXXXXXXXXXXXNLAAGVLLVMFRPFRAGEYVDL
Y1546_ARCFU     LELMLKVIYFGIIIVAFIAXXXXXXXXXXXXXXITGIVLGFASQSVVANLVSGIFLISEKPIKIGDQVNI
Y452_BUCAI      LSALMRYIIITFTFIAALGRIGVQTTSVXXXXXXXXXXXXXXXQGSLSNFAAGVLLVTLRPLKTEEYVDL
YFKC_BACSU      -------------------------------------------QSLIKDVLAGVFLIYERQLHKGDYVTV
YBIO_ECOLI      FRNALAVIISTITIMIVLSEIGVNIAPXXXXXXXXXXXISFGSQTLVKDIITGVFIQFENGMNTGDLVTI
YKUT_BACSU      -------------------------------------------QGLVSDIVTGFFILLEKQLDVGDYITV
Y1270_CORGL     VGVIAQIVAFFMLAVSAMQAFGFSLXXXXXXXXXXXXXXGLGAQSIVADFLAGFFILTEKQFGVGDWVRF
YJEP_ECOLI      --KYLLMLIGGLVGFSM---IGIEWSKLQWXXXXXXXXXXXXXQEIFANFISGLIILFEKPIRIGDTVTI
Y1861_ARATH     ------------------------------------------------------------PFDVGDRCEI


                         .         .         .         +         .         .         .:280
query           NDVAGTIEHIGLKTTRIRSLSGEQIVCANAQLLQQTIHNYKRMQTRRIVFTFGVATATPPEKLRLIGDMV
Y1143_METJA     SGGSGIVEDIGIRSTKIRATDNSIIVVPNSKLIDEIIQNVPSKNKWKVSTTIGVTYNTPVEKIRKAEEII
Y812_AQUAE      KDFMGSVEDIGLRSTKIRTFDKSLVTIPNRDIVNNHVENFTRRNKRRVRFYIGVVYSTKREQLENILKEI
Y415_HELPY      GEVEGTVVEMGLRRTTIRAFDNALLSVPNSELAGKPIRNWSRRKVRRIKMEIGLTYSSSQSALQLCVKDI
Y415_HELPJ      GEVEGTVVEMGLRRTTIRAFDNALLSVPNSELAGKPIRNWSRRKVRRIKMEIGLTYSSSQSALQLCVKDI
Y170_METJA      KGAEGIVEEIGIRSTRIRTFDYTLITIPNSELLDSAIENLTVRDRRRVLMTIGLTYNTPVXXXXXXXXXX
YHDY_BACSU      STVTGSVEDITFRSTRFRTAQGALVTVPNSTLSMEAITNWTRMTKRQITFSIHVSYATPIENLRSIHSLR
KEFA_ECOLI      GSFSGTVSKIRIRATTITDFDRKEVIIPNKAFVTERLINWSLTDTTRLVIRLGVAYGSDLEKVRKV---L
YNAI_ECOLI      PDIEGTVAEIGWRITKITTFDNRPLYVPNSLFSSISVENPGRMTNRRITTTIGL-RYEDAAKVGVIVEAV
YNAI_ECO57      PDIEGTVAEIGWRITKITTFDNRPLYVPNSLFSSISVENPGRMTNRRITTTIGL-RYEDAAKVGVIVEAV
Y639_SYNY3      AGIEGIVESIEILSTTICTYDNRLVTIPNKQIIENNIINHVGKPERRIDLVIGVGY---EEDIDHVRSSL
Y437_BUCAP      GNVAGTVLNIHIFYTTLRTLDGKIVVVPNNKIISGNIINYSREPARRNEFSISVSYNT---DIDLVIKVL
Y402_BUCBP      EKISGTVLNIHVFYTTFRTLDGKIVVIPNGKIISGNIINYSREKARRNEFIIGVS---------------
Y195A_HAEIN     NEVSGTVAKIRIRAITLIDFDRKEVIVPNKSFVTGQVTNWALSNTTRLVISVGVAYGSDLTLVRQLADEQ
Y5208_ARATH     DGVAMLVEEMNLLTTVFLKLNNEKVYYPNAVLATKPISNYFRSPNMGETVEFSISFSTPVSKIAHLKERI
MSCS_SHIFL      GGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDI-------DQV
MSCS_EDWI9      GGVTGTVREVQIFSTTLATADNKVIVVPNGKIIAGNIINFSREPKRRIDIIVGVAYDADIDVVRVLGDVV
MSCS_ECOLI      GGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDI-------DQV
MSCS_ECO57      GGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDI-------DQV
Y1546_ARCFU     DGVAGFVEDVNILSTIIRTYDGLYVRIPNEKVFTSNITNYVAHIARRFEYVVGI----------------
Y452_BUCAI      GSVSGTVLNIHIFYTTLRTLDGKIVVVPNNKIISGNIINYSREPARRNEFIISVS---------------
YFKC_BACSU      NNLFGTVEEIGLRSLQIREWSGKLLTISNGEVRQ--IENY-NIDFMRITESFLISFKEDPDRV-------
YBIO_ECOLI      GPLTGTVERMSIRSVGVRQDTG------------------------------------------------
YKUT_BACSU      STFDGIVEQVGLRTTQIRSFDGTLHYIPNRNITNVSNHSRGTMQ--------------------------
Y1270_CORGL     EGVEGTVIEITMRATKIRTIAQETVIIPNS----------------------------------------
YJEP_ECOLI      RDLTGSVTKINTRATTISDWDRKEIIVPNKAFITEQFINWSLSDSTRVVLTIPAPADANSEEVTEILLTA
Y1861_ARATH     DGVQMVVEEMNILTTVFLRFDNQKVVYPNSLLWTKSIGNYYRSPDMGDGIEFSIHITTPAEKIILIKQRI


                         .         *         .         .         .         .         +:350
query           KKIITDVGETQFDRAHLLAFGQDRLTYEVVHIVNTADYNKYMDIQQEINIRIIEKLIENDIELALPSLVV
Y1143_METJA     KNILLEHPNVEDETVYFKEFGDWSLNIQVVYYIKNSRYNKYISTINEVNLKIKEEFDRKGIEFAFPT---
Y812_AQUAE      RELLKEVAKDEKFYVYFENYGDSSLNILIQYYANTNDYEEYLKIIEDINLKIMEIVEKNGSSFAFPS---
Y415_HELPY      KEML------------------------------------------------------------------
Y415_HELPJ      KEML------------------------------------------------------------------
Y170_METJA      XXXXXNHPATLPPRVHFREYGDWSLNLRVEYFVRNMGFDYYLNAVDEINLXXXXXXXXXXXXMAFPTYTV
YHDY_BACSU      TMLLEHEGDNEIIMVNFDTFADSYYNLFFNFYTKTTVWAENLNIREDINYKIIEILGAEGVQFAYPGQMV
KEFA_ECOLI      LKAATEVMHEPMPEVFFTAFGASTLDHELLYVRELRDRSRTVD---ELNRTIDQLCRENDINIAFNQLEV
YNAI_ECOLI      REMLKNIDQRQTLLVYFNQFADSSLNIMVYCFTKTTVWAEWLAAQQDVYLKIIDIVQSHGADFAFPS---
YNAI_ECO57      REMLKNIDQRQTLLVYFNQFADSSLNIMVYCFTKTTVWAEWLAAQQDVYLKIIDIVQSHGADFAFPS---
Y639_SYNY3      QWVIDQNSEVCTEPAPTIALGESSVNFYVRPWVKSEDYFR---LKLQLTEAIKRKLDEENISIPFP----
Y437_BUCAP      KRVIENEDRVMKDRDIVIGLSESSLNFIIRCWSSTDELNA---VYWDLMVKFKKELDKNNINIPYPQIDV
Y402_BUCBP      ----------------------------------------------------------------------
Y195A_HAEIN     PTILRDPKPS----AYFLTFGASTLDHELVYVEQVGDRTSTTD---ALNRRINELFAEHNIDIAFNQLDV
Y5208_ARATH     AEYL------------------------------------------------------------------
MSCS_SHIFL      KQILTNIIQSE-DRVRLNELGASSINFVVRVWSNSGDQNVYWDVLERI----------------------
MSCS_EDWI9      TRILHDDGVT----IRLNEMAASSLNFVVRVWGNNADYAIYFDLMENFK----RALDANNIGIPFPQMDV
MSCS_ECOLI      KQILTNIIQSE-DRVRLNELGASSINFVVRVWSNSGDQNVYWDVLERI----------------------
MSCS_ECO57      KQILTNIIQSE-DRVRLNELGASSINFVVRVWSNSGDQNVYWDVLERI----------------------
Y1546_ARCFU     ----------------------------------------------------------------------
Y452_BUCAI      ----------------------------------------------------------------------
YFKC_BACSU      ----------------------------------------------------------------------
YBIO_ECOLI      ----------------------------------------------------------------------
YKUT_BACSU      ----------------------------------------------------------------------
Y1270_CORGL     ----------------------------------------------------------------------
YJEP_ECOLI      ARRCSLVIDNPAPEVFLVDLQQGIQIFEL--RIYAAEMGHRMPLRHEIHQLILAGFHAHGIDMPFPPFQM
Y1861_ARATH     TSYI------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RAPVQVEETRDYxxxxxxxxxxxxxxx
Y1143_METJA     ---------------------------
Y812_AQUAE      ---------------------------
Y415_HELPY      ---------------------------
Y415_HELPJ      ---------------------------
Y170_METJA      ---------------------------
YHDY_BACSU      ---------------------------
KEFA_ECOLI      KGDEVTEVKRDY---------------
YNAI_ECOLI      ---------------------------
YNAI_ECO57      ---------------------------
Y639_SYNY3      ---------------------------
Y437_BUCAP      ---------------------------
Y402_BUCBP      ---------------------------
Y195A_HAEIN     ---------------------------
Y5208_ARATH     ---------------------------
MSCS_SHIFL      ---------------------------
MSCS_EDWI9      ---------------------------
MSCS_ECOLI      ---------------------------
MSCS_ECO57      ---------------------------
Y1546_ARCFU     ---------------------------
Y452_BUCAI      ---------------------------
YFKC_BACSU      ---------------------------
YBIO_ECOLI      ---------------------------
YKUT_BACSU      ---------------------------
Y1270_CORGL     ---------------------------
YJEP_ECOLI      R--------------------------
Y1861_ARATH     ---------------------------