[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF66063.1

[Show Plain Result]


## Summary of Sequence Search
    1::127
    4::116     5e-14  37%  117 aa  YJEI_SHIFL RecName: Full=Uncharacterized protein yjeI;Flags:
    4::116     5e-14  37%  117 aa  YJEI_ECOLI RecName: Full=Uncharacterized protein yjeI;Flags:
    4::116     5e-14  37%  117 aa  YJEI_ECOL6 RecName: Full=Uncharacterized protein yjeI;Flags:
    1::127

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxKILVCFVGLALTACSANSLNYGAEQVRVMTSEPGKECSYLGDITGSQGNFFTGGWTSNSN
YJEI_SHIFL      ----------KYLAGIVGAALLMASSNELSAAGQSVRIVDEQPGAECQLIGTATGKQSNWLSGQHGEEGG
YJEI_ECOLI      ----------KYLAGIVGAALLMASSNELSAAGQSVRIVDEQPGAECQLIGTATGKQSNWLSGQHGEEGG
YJEI_ECOL6      ----------KYLAGIVGAALLMASSNELSAAGQSVRIVDEQPGAECQLIGTATGKQSNWLSGQHGEEGG


                         .         .         *         .         .         .         .:140
query           LETGARNDLKNKAYKMGGNTVVLLTQRAGQTGSSWHGSGSSKQTNVTLSGNVYRCPx
YJEI_SHIFL      SMRGAANDLRNQAAAMGGNVIY------GISSPSQGMLSSFVPTDSQIIGQVYKCP-
YJEI_ECOLI      SMRGAANDLRNQAAAMGGNVIY------GISSPSQGMLSSFVPTDSQIIGQVYKCP-
YJEI_ECOL6      SMRGAANDLRNQAAAMGGNVIY------GISSPSQGMLSSFVPTDSQIIGQVYKCP-