[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF66076.1

[Show Plain Result]


## Summary of Sequence Search
    1::294
    1::283     e-166  93%  294 aa  FDNH_SHIFL RecName: Full=Formate dehydrogenase, nitrate-inducible,
    1::283     e-166  93%  294 aa  FDNH_ECOLI RecName: Full=Formate dehydrogenase, nitrate-inducible,
    1::283     e-134  73%  300 aa  FDOH_SHIFL RecName: Full=Formate dehydrogenase-O iron-sulfur
    1::283     e-134  73%  300 aa  FDOH_ECOLI RecName: Full=Formate dehydrogenase-O iron-sulfur
    1::283     e-134  73%  300 aa  FDOH_ECOL6 RecName: Full=Formate dehydrogenase-O iron-sulfur
    8::288     e-129  73%  312 aa  FDXH_HAEIN RecName: Full=Formate dehydrogenase iron-sulfur
    7::210     3e-32  34%  215 aa  FDHB_DESGI RecName: Full=Formate dehydrogenase subunit beta;       
   36::237     6e-31  34%  370 aa  HMC2_DESVH RecName: Full=Protein DVU_0535;AltName: Full=HMC operon
   11::155     6e-28  40%  192 aa  PHSB_SALTY RecName: Full=Thiosulfate reductase electron transport
   11::155     6e-28  40%  192 aa  PHSB_SALTI RecName: Full=Thiosulfate reductase electron transport
    9::158     1e-26  39%  205 aa  DMSB_SHIFL RecName: Full=Anaerobic dimethyl sulfoxide reductase
    9::158     1e-26  39%  205 aa  DMSB_ECOLI RecName: Full=Anaerobic dimethyl sulfoxide reductase
    9::158     3e-26  38%  205 aa  YNFG_ECOLI RecName: Full=Probable anaerobic dimethyl sulfoxide
    9::158     3e-26  38%  205 aa  YNFG_ECOL6 RecName: Full=Probable anaerobic dimethyl sulfoxide
   41::218     1e-25  36%  328 aa  HYBA_SHIFL RecName: Full=Hydrogenase-2 operon protein hybA;Flags:
   41::218     1e-25  36%  328 aa  HYBA_ECOLI RecName: Full=Hydrogenase-2 operon protein hybA;Flags:
   41::218     1e-25  36%  328 aa  HYBA_ECO57 RecName: Full=Hydrogenase-2 operon protein hybA;Flags:
    9::158     4e-24  35%  205 aa  DMSB_HAEIN RecName: Full=Anaerobic dimethyl sulfoxide reductase
   25::197     7e-24  32%  225 aa  NRFC_HAEIN RecName: Full=Protein nrfC homolog;Flags: Precursor;
   10::148     4e-23  37%  191 aa  PSRB_WOLSU RecName: Full=Polysulfide reductase chain B;AltName:
   42::180     5e-23  35%  223 aa  NRFC_SHIFL RecName: Full=Protein nrfC;Flags: Precursor;
   42::180     5e-23  35%  223 aa  NRFC_ECOLI RecName: Full=Protein nrfC;Flags: Precursor;
   42::180     5e-23  35%  223 aa  NRFC_ECO57 RecName: Full=Protein nrfC;Flags: Precursor;
   27::196     9e-22  34%  239 aa  YDHX_ECOLI RecName: Full=Uncharacterized ferredoxin-like protein
   27::196     3e-21  34%  239 aa  YDHX_ECO57 RecName: Full=Uncharacterized ferredoxin-like protein
    6::154     4e-17  33%  162 aa  YGFS_ECOLI RecName: Full=Putative electron transport protein ygfS;
    3::217     1e-16  35%  325 aa  DDHB_RHOSU RecName: Full=Dimethylsulfide dehydrogenase subunit
   68::198     2e-16  28%  208 aa  YDHY_SHIFL RecName: Full=Uncharacterized ferredoxin-like protein
   68::198     2e-16  28%  208 aa  YDHY_ECOLI RecName: Full=Uncharacterized ferredoxin-like protein
   68::198     2e-16  28%  208 aa  YDHY_ECO57 RecName: Full=Uncharacterized ferredoxin-like protein
    4::182     2e-16  36%  200 aa  FDHB_WOLSU RecName: Full=Formate dehydrogenase iron-sulfur subunit;
    5::219     9e-16  33%  328 aa  CLRB_IDEDE RecName: Full=Chlorate reductase subunit beta;AltName:
    5::218     4e-15  34%  327 aa  SERB_THASE RecName: Full=Selenate reductase subunit beta;       
   17::159     8e-15  40%  190 aa  COOF_RHORU RecName: Full=Iron-sulfur protein;
   12::166     2e-14  30%  659 aa  AEGA_ECOLI RecName: Full=Protein aegA;
   28::234     9e-14  37%  269 aa  HMEA_ARCFU RecName: Full=Hdr-like menaquinol oxidoreductase
    8::155     1e-13  37%  639 aa  YGFT_ECOLI RecName: Full=Uncharacterized protein ygfT;
  181::260     1e-13  35%  487 aa  NARH_BACSU RecName: Full=Nitrate reductase beta chain;       
   14::129     2e-13  36%  166 aa  FER9_METJA RecName: Full=Uncharacterized ferredoxin MJ0265;
    6::139     2e-13  35%  157 aa  YSAA_ECOLI RecName: Full=Putative electron transport protein ysaA;
  184::263     3e-13  35%  512 aa  NARH_SHIFL RecName: Full=Respiratory nitrate reductase 1 beta
  184::263     3e-13  35%  512 aa  NARH_ECOLI RecName: Full=Respiratory nitrate reductase 1 beta
  183::262     3e-13  35%  514 aa  NARY_ECOLI RecName: Full=Respiratory nitrate reductase 2 beta
    6::167     1e-12  31%  175 aa  HYDN_ECOLI RecName: Full=Electron transport protein hydN;
    6::167     1e-12  31%  175 aa  HYDN_ECOL6 RecName: Full=Electron transport protein hydN;
    6::167     1e-12  31%  175 aa  HYDN_ECO57 RecName: Full=Electron transport protein hydN;
   19::123     1e-11  42%  153 aa  Y264_METJA RecName: Full=Uncharacterized protein MJ0264;
    7::174     1e-11  26%  274 aa  PGTS_PELAC RecName: Full=Pyrogallol hydroxytransferase small
   42::120     9e-11  46%  151 aa  FER8_METJA RecName: Full=Uncharacterized ferredoxin MJ0155;
    1::100     2e-10  39%  266 aa  NARH_BRASZ RecName: Full=Respiratory nitrate reductase beta chain; 
    6::181     7e-09  34%  203 aa  HYCB_SHIFL RecName: Full=Formate hydrogenlyase subunit 2;       
    6::181     7e-09  34%  203 aa  HYCB_ECOLI RecName: Full=Formate hydrogenlyase subunit 2;       
    6::181     7e-09  34%  203 aa  HYCB_ECOL6 RecName: Full=Formate hydrogenlyase subunit 2;       
   34::128     1e-08  40%  157 aa  YFRA_PROVU RecName: Full=Frd operon probable iron-sulfur subunit
   12::194     3e-08  36%  205 aa  HYFA_ECOLI RecName: Full=Hydrogenase-4 component A;       
  136::318     6e-07  28%  412 aa  MVHB_METTH RecName: Full=Polyferredoxin protein mvhB;
  176::373     2e-06  29%  501 aa  Y1303_METJA RecName: Full=Uncharacterized polyferredoxin-like
   71::250     3e-06  31%  250 aa  Y514_METJA RecName: Full=Uncharacterized polyferredoxin-like
   41::136     5e-06  36%  140 aa  NUOI_CARHZ RecName: Full=NADH-quinone oxidoreductase subunit I;    
   45::127     5e-06  41%  234 aa  MAUM_METFK RecName: Full=Methylamine utilization ferredoxin-type
   61::171     7e-06  33%  408 aa  Y51B_METJA RecName: Full=Uncharacterized polyferredoxin-like
   40::106     7e-06  42%  398 aa  VHUB_METVO RecName: Full=Polyferredoxin protein vhuB;
    1::77      7e-06  36%  412 aa  MVHB_METFE RecName: Full=Polyferredoxin protein mvhB;
   56::155     9e-06  29%  189 aa  RNFB_SHEPW RecName: Full=Electron transport complex protein rnfB;
   68::155     1e-05  33%  189 aa  RNFB_SHEPA RecName: Full=Electron transport complex protein rnfB;
   68::127     2e-05  33%  131 aa  FER2_METJA RecName: Full=Uncharacterized ferredoxin MJ0099;
   36::168     3e-05  28%  168 aa  RNFB_BUCAP RecName: Full=Electron transport complex protein rnfB;
  238::328     3e-05  34%  355 aa  FWDF_METJA RecName: Full=Polyferredoxin protein fwdF;
  110::170     4e-05  39%  207 aa  RNFB_HAEDU RecName: Full=Electron transport complex protein rnfB;
  107::163     6e-05  37%  167 aa  RNFB_BUCAT RecName: Full=Electron transport complex protein rnfB;
  107::163     6e-05  37%  167 aa  RNFB_BUCAI RecName: Full=Electron transport complex protein rnfB;
  107::163     6e-05  37%  167 aa  RNFB_BUCA5 RecName: Full=Electron transport complex protein rnfB;
  223::292     8e-05  36%  357 aa  YCCM_ECOLI RecName: Full=Putative electron transport protein yccM;
   78::149     8e-05  35%  157 aa  VHCB_METVO RecName: Full=Polyferredoxin protein vhcB;
   99::155     8e-05  37%  189 aa  RNFB_SHEAM RecName: Full=Electron transport complex protein rnfB;
  101::156     8e-05  38%  197 aa  RNFB_HAHCH RecName: Full=Electron transport complex protein rnfB;
   56::128     8e-05  35%  193 aa  NDHI_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-05  35%  193 aa  NDHI_CYAP8 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-05  35%  200 aa  NDHI_CYAP7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-05  35%  193 aa  NDHI_CYAP4 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-05  35%  200 aa  NDHI_ACAM1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   47::100     1e-04  35%  166 aa  Y1043_HAEIN RecName: Full=Uncharacterized protein HI1043;
   98::191     1e-04  38%  394 aa  VHUB_METJA RecName: Full=Polyferredoxin protein vhuB;
   55::127     1e-04  32%  203 aa  NDHI_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   98::166     1e-04  36%  193 aa  RNFB_SHESR RecName: Full=Electron transport complex protein rnfB;
   98::166     1e-04  36%  193 aa  RNFB_SHESA RecName: Full=Electron transport complex protein rnfB;
    7::57      1e-04  35%   70 aa  FER2_THEAC RecName: Full=Probable ferredoxin TA0517;
  106::158     2e-04  36%  190 aa  RNFB_SODGM RecName: Full=Electron transport complex protein rnfB;
   55::127     2e-04  35%  194 aa  NDHI_PLEBO RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   98::166     2e-04  36%  193 aa  RNFB_SHESM RecName: Full=Electron transport complex protein rnfB;
   98::155     2e-04  36%  189 aa  RNFB_SHESH RecName: Full=Electron transport complex protein rnfB;
   54::126     2e-04  35%  196 aa  NDHI_THEEB RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   62::174     2e-04  34%  215 aa  NDHI_SYNPX RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     2e-04  35%  209 aa  NDHI_GLOVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     2e-04  35%  196 aa  NDHI_CYAA5 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   60::115     2e-04  42%  220 aa  MAUM_METEA RecName: Full=Methylamine utilization ferredoxin-type
  109::155     3e-04  36%  198 aa  RNFB_VIBPA RecName: Full=Electron transport complex protein rnfB;
   36::153     3e-04  32%  187 aa  RNFB_RHOCA RecName: Full=Electron transport complex protein
   39::155     3e-04  40%  181 aa  RNFB_MAGSM RecName: Full=Electron transport complex protein rnfB;
  103::157     3e-04  36%  191 aa  RNFB_ERWT9 RecName: Full=Electron transport complex protein rnfB;
   13::82      3e-04  39%   99 aa  PORD_THEMA RecName: Full=Pyruvate synthase subunit porD;AltName:
   52::124     3e-04  41%  179 aa  NUOI_DEIDV RecName: Full=NADH-quinone oxidoreductase subunit I;    
   56::130     3e-04  37%  149 aa  NUOI1_SYNFM RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
   62::154     3e-04  34%  215 aa  NDHI_SYNSC RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   62::154     3e-04  34%  210 aa  NDHI_SYNS9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
    4::62      3e-04  34%  107 aa  FER_PYRIL RecName: Full=Ferredoxin;AltName: Full=Seven-iron
  109::155     4e-04  36%  198 aa  RNFB_VIBVY RecName: Full=Electron transport complex protein rnfB;
  109::155     4e-04  36%  198 aa  RNFB_VIBVU RecName: Full=Electron transport complex protein rnfB;
  109::155     4e-04  36%  197 aa  RNFB_VIBSL RecName: Full=Electron transport complex protein rnfB;
  109::155     4e-04  36%  197 aa  RNFB_VIBHB RecName: Full=Electron transport complex protein rnfB;
   98::155     4e-04  33%  194 aa  RNFB_VIBFM RecName: Full=Electron transport complex protein rnfB;
   98::155     4e-04  33%  194 aa  RNFB_VIBF1 RecName: Full=Electron transport complex protein rnfB;
  112::158     4e-04  38%  192 aa  RNFB_PECCP RecName: Full=Electron transport complex protein rnfB;
   53::160     4e-04  40%  163 aa  NUOI_VESOH RecName: Full=NADH-quinone oxidoreductase subunit I;    
   55::127     4e-04  28%  218 aa  NDHI_PROMT RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     4e-04  28%  218 aa  NDHI_PROM1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
  163::223     4e-04  42%  337 aa  ASRC_SALTY RecName: Full=Anaerobic sulfite reductase subunit C;    
  163::223     4e-04  42%  337 aa  ASRC_SALTI RecName: Full=Anaerobic sulfite reductase subunit C;    
  104::155     5e-04  35%  195 aa  RNFB_VIBCM RecName: Full=Electron transport complex protein rnfB;
  104::155     5e-04  35%  195 aa  RNFB_VIBCH RecName: Full=Electron transport complex protein rnfB;
  104::155     5e-04  35%  195 aa  RNFB_VIBC3 RecName: Full=Electron transport complex protein rnfB;
   83::154     5e-04  32%  183 aa  RNFB_AZOSB RecName: Full=Electron transport complex protein
  111::157     5e-04  38%  194 aa  RNFB_ALCBS RecName: Full=Electron transport complex protein
   28::77      5e-04  36%   86 aa  PORD_METJA RecName: Full=Pyruvate synthase subunit porD;AltName:
   68::143     5e-04  32%  220 aa  NUOI_HELPJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
   68::143     5e-04  32%  220 aa  NUOI_HELPH RecName: Full=NADH-quinone oxidoreductase subunit I;    
   68::143     5e-04  32%  220 aa  NUOI_HELPG RecName: Full=NADH-quinone oxidoreductase subunit I;    
   68::143     5e-04  32%  220 aa  NUOI_HELP2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   43::123     5e-04  44%  182 aa  NQO9_THET8 RecName: Full=NADH-quinone oxidoreductase subunit 9;    
   43::123     5e-04  44%  182 aa  NQO9_THET2 RecName: Full=NADH-quinone oxidoreductase subunit 9;    
   55::127     5e-04  29%  183 aa  NDHI_HUPLU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   62::154     5e-04  35%  181 aa  NDHI_ANGEV RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   47::104     6e-04  31%  105 aa  VORD_PYRFU RecName: Full=Ketoisovalerate oxidoreductase subunit
  112::158     6e-04  38%  192 aa  RNFB_ERWCT RecName: Full=Electron transport complex protein
   98::155     6e-04  33%  194 aa  RNFB_ALISL RecName: Full=Electron transport complex protein rnfB;
  110::162     6e-04  33%  239 aa  RN151_MOUSE RecName: Full=RING finger protein 151;
   49::121     6e-04  29%  171 aa  NUOI_SHEWM RecName: Full=NADH-quinone oxidoreductase subunit I;    
   52::124     6e-04  34%  178 aa  NUOI_DEIRA RecName: Full=NADH-quinone oxidoreductase subunit I;    
   52::124     6e-04  33%  181 aa  NDHI_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   55::127     6e-04  28%  202 aa  NDHI_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     6e-04  28%  202 aa  NDHI_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   52::124     6e-04  33%  181 aa  NDHI_STAPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   55::127     6e-04  35%  173 aa  NDHI_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   55::127     6e-04  33%  190 aa  NDHI_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   52::124     6e-04  33%  182 aa  NDHI_CHAGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
    7::61      6e-04  31%  113 aa  FER1_CAUCR RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I;  
  109::160     8e-04  40%  163 aa  Y51A_METJA RecName: Full=Uncharacterized polyferredoxin-like
   85::158     8e-04  30%  192 aa  RNFB_SHISS RecName: Full=Electron transport complex protein rnfB;
   85::158     8e-04  30%  192 aa  RNFB_SHIB3 RecName: Full=Electron transport complex protein rnfB;
   98::155     8e-04  34%  193 aa  RNFB_SHEON RecName: Full=Electron transport complex protein rnfB;
  111::158     8e-04  33%  192 aa  RNFB_KLEP3 RecName: Full=Electron transport complex protein
   85::158     8e-04  30%  192 aa  RNFB_ECOUT RecName: Full=Electron transport complex protein rnfB;
   85::158     8e-04  30%  192 aa  RNFB_ECOSM RecName: Full=Electron transport complex protein rnfB;
   85::158     8e-04  30%  192 aa  RNFB_ECOSE RecName: Full=Electron transport complex protein rnfB;
   85::158     8e-04  30%  192 aa  RNFB_ECOL5 RecName: Full=Electron transport complex protein rnfB;
   85::158     8e-04  30%  192 aa  RNFB_ECOK1 RecName: Full=Electron transport complex protein rnfB;
   85::158     8e-04  30%  192 aa  RNFB_ECO81 RecName: Full=Electron transport complex protein rnfB;
   85::158     8e-04  30%  192 aa  RNFB_ECO7I RecName: Full=Electron transport complex protein rnfB;
   85::158     8e-04  30%  192 aa  RNFB_ECO5E RecName: Full=Electron transport complex protein rnfB;
   85::158     8e-04  30%  192 aa  RNFB_ECO57 RecName: Full=Electron transport complex protein rnfB;
   85::158     8e-04  30%  192 aa  RNFB_ECO55 RecName: Full=Electron transport complex protein rnfB;
   85::158     8e-04  30%  192 aa  RNFB_ECO45 RecName: Full=Electron transport complex protein rnfB;
   85::158     8e-04  30%  192 aa  RNFB_ECO24 RecName: Full=Electron transport complex protein rnfB;
   56::156     8e-04  27%  187 aa  RNFB_AERS4 RecName: Full=Electron transport complex protein rnfB;
   56::156     8e-04  27%  187 aa  RNFB_AERHH RecName: Full=Electron transport complex protein rnfB;
   53::160     8e-04  38%  163 aa  NUOI_RUTMC RecName: Full=NADH-quinone oxidoreductase subunit I;    
   60::130     8e-04  41%  182 aa  NUOI_PSEU2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   60::130     8e-04  41%  182 aa  NUOI_PSEPK RecName: Full=NADH-quinone oxidoreductase subunit I;    
   60::130     8e-04  41%  182 aa  NUOI_PSEPF RecName: Full=NADH-quinone oxidoreductase subunit I;    
   60::130     8e-04  41%  182 aa  NUOI_PSEFL RecName: Full=NADH-quinone oxidoreductase subunit I;    
   60::130     8e-04  41%  182 aa  NUOI_PSEF5 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   60::130     8e-04  41%  182 aa  NUOI_PSEE4 RecName: Full=NADH-quinone oxidoreductase subunit I;    
   74::143     8e-04  34%  220 aa  NUOI_HELPY RecName: Full=NADH-quinone oxidoreductase subunit I;    
   74::143     8e-04  34%  220 aa  NUOI_HELPS RecName: Full=NADH-quinone oxidoreductase subunit I;    
   74::143     8e-04  34%  220 aa  NUOI_HELAH RecName: Full=NADH-quinone oxidoreductase subunit I;    
   52::124     8e-04  34%  179 aa  NUOI_DEIGD RecName: Full=NADH-quinone oxidoreductase subunit I;    
   55::127     8e-04  28%  219 aa  NDHI_SYNS3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-04  28%  218 aa  NDHI_SYNPW RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-04  28%  208 aa  NDHI_PROMS RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-04  28%  208 aa  NDHI_PROMP RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-04  28%  218 aa  NDHI_PROMM RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-04  28%  219 aa  NDHI_PROMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-04  28%  208 aa  NDHI_PROM9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-04  28%  208 aa  NDHI_PROM5 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-04  28%  215 aa  NDHI_PROM4 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-04  28%  218 aa  NDHI_PROM3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-04  28%  208 aa  NDHI_PROM2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-04  28%  208 aa  NDHI_PROM0 RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-04  29%  176 aa  NDHI_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   55::127     8e-04  29%  175 aa  NDHI_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit I,
   55::127     8e-04  32%  194 aa  NDHI_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
   55::127     8e-04  32%  194 aa  NDHI_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase subunit I; 
  223::274     8e-04  34%  287 aa  MAUN_METEA RecName: Full=Methylamine utilization ferredoxin-type
   25::87      8e-04  41%  605 aa  AB2E_ARATH RecName: Full=ABC transporter E family member 2;        
    1::294

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSMETQDIIKRSATNAITPPPQARDYKAEVAKLIDVSSCVGCKACQVACSEWNDIRDNVGHCVGVYDNPA
FDNH_SHIFL      MAMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPA
FDNH_ECOLI      MAMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPA
FDOH_SHIFL      MAYQSQDIIRRSATNGLTPAPQARDFQEEVAKLIDVTTCIGCKACQVACSEWNDIRDTVGNNIGVYDNPN
FDOH_ECOLI      MAYQSQDIIRRSATNGLTPAPQARDFQEEVAKLIDVTTCIGCKACQVACSEWNDIRDTVGNNIGVYDNPN
FDOH_ECOL6      MAYQSQDIIRRSATNGLTPAPQARDFQEEVAKLIDVTTCIGCKACQVACSEWNDIRDTVGNNIGVYDNPN
FDXH_HAEIN      --VQTQDVIKISATSGLTPAPQARDHKVEIAKLIDVSTCIGCKACQVGCSEWNDIRSDINQCVGVYDNPV
FDHB_DESGI      ---------------------------------VDTTRCTACRGCQVACKQWHGNPATPTENTGFHQNPP
HMC2_DESVH      -------------------------YKDSYGVLHDTTRCIGCRKCEQACNEVNKLPAPKAKFLTVLEKTR
PHSB_SALTY      --------------------------------LHDEKRCIGCQACTVACKVLNDVPEGF-----------
PHSB_SALTI      --------------------------------LHDEKRCIGCQACTVACKVLNDVPEGF-----------
DMSB_SHIFL      ---------------------------------IDSSRCAGCKTCELACKDYKDLTPEVS-----FRRIY
DMSB_ECOLI      ---------------------------------IDSSRCTGCKTCELACKDYKDLTPEVS-----FRRIY
YNFG_ECOLI      ---------------------------------IDSSRCTGCKTCELACKDFKDLGPEVS-----FRRIY
YNFG_ECOL6      ---------------------------------IDSSRCTGCKTCELACKDFKDLGPEVS-----FRRIY
HYBA_SHIFL      --------------------------------LYDSTLCVGCQACVTKCQDINFPERNP-QGEQTWSNND
HYBA_ECOLI      --------------------------------LYDSTLCVGCQACVTKCQDINFPERNP-QGEQTWSNND
HYBA_ECO57      --------------------------------LYDSTLCVGCQACVTKCQDINFPERNP-QGEQTWSNND
DMSB_HAEIN      ----------------------------------DSERCTGCKTCELACKDYKDLGTEVN-----FRRIY
NRFC_HAEIN      -------------------PAFAKENKADKPKIHDENACIGCTACMDSCRDVNQVPEGVSRL--------
PSRB_WOLSU      ----------------------------------DENLCIGCQACNIACRSENKIPDSVYRLQVWVQGPK
NRFC_SHIFL      ----------------------------------DESLCIGCTACMDACREVNKVPEGVSRL--------
NRFC_ECOLI      ----------------------------------DESLCIGCTACMDACREVNKVPEGVSRL--------
NRFC_ECO57      ----------------------------------DESLCIGCTACMDACREVNKVPEGVSRL--------
YDHX_ECOLI      LGMGTVIFFTGSASSLLANTRQEKEVR--YAMIHDESRCNGCNICARACRKTNHV-------------PA
YDHX_ECO57      LGMGTVIFFTGSASSLLANTRQEKEVR--YAMIHDESRCNGCNICARACRKTNHA-------------PA
YGFS_ECOLI      --------------------------------IVNPADCIGCRTCEVAC-------------VVAHPSEQ
DDHB_RHOSU      --------------------------KRQISMVLDLNKCIGCQTCTSACKYWNNVETHPGHSGGGFDEEG
YDHY_SHIFL      --------------------------------------CTGCHRCEISCTNFND------GSVGTFFSRI
YDHY_ECOLI      --------------------------------------CTGCHRCEISCTNFND------GSVGTFFSRI
YDHY_ECO57      --------------------------------------CTGCHRCEISCTNFND------GSVGTFFSRI
FDHB_WOLSU      --------------------------QARVKFYCDEARCIDCHGCDVACKEAHHL-------------PV
CLRB_IDEDE      ----------------------------QVAYVFDLNKCIGCHTCTMACKQWNNVETRPGKGYGGFDQEG
SERB_THASE      ----------------------------QLAYVFDLNKCIGCHTCTMACKQWNNVESRPGKGYGIIPIRA
COOF_RHORU      --------------------------------------CLSCHSCELACA--------VAHSGG-HDMIE
AEGA_ECOLI      --------------------------------------CLGCHACEIAC-------------VMAHNDEQ
HMEA_ARCFU      -------------TQFIESPEEVRE-KRRWAMAVDVERCTQCMECVVACDKENNVPE-------FEEERF
YGFT_ECOLI      ----------------------------------EAAECIGCHACEIACANWSDFRPRI-HVVGKGQNPV
NARH_BACSU      ----------------------------------------------------------------------
FER9_METJA      --------------------------------------------------------DNCGDCVKA-----
YSAA_ECOLI      --------------------------------IADATKCIGCRTCEVACA------------VSHHENQ-
NARH_SHIFL      ----------------------------------------------------------------------
NARH_ECOLI      ----------------------------------------------------------------------
NARY_ECOLI      ----------------------------------------------------------------------
HYDN_ECOLI      --------------------------------IADASKCIGCRTCEVAC---------------VVSHQE
HYDN_ECOL6      --------------------------------IADASKCIGCRTCEVAC---------------VVSHQE
HYDN_ECO57      --------------------------------IADASKCIGCRTCEVAC---------------VVSHQE
Y264_METJA      --------------------------------VVNVGSCIGCRRCERSCPI-NGITFN------------
PGTS_PELAC      --------------------------------VIDVAKCQDCNNCFMGCMDEHELNEWPGYTASMQ----
FER8_METJA      ----------------------------------------------------------------------
NARH_BRASZ      ---------------------------SQVGMVLNLDKCIGCHTCSVTCKEGMEY---------------
HYCB_SHIFL      --------------------------------IADSTLCIGCHTCEAACSETH--------------RQH
HYCB_ECOLI      --------------------------------IADSTLCIGCHTCEAACSETH--------------RQH
HYCB_ECOL6      --------------------------------IADSTLCIGCHTCEAACSETH--------------RQH
YFRA_PROVU      ----------------------------------------------------------------------
HYFA_ECOLI      --------------------------------------CTGCNTCLAACSD-------VHKTQGLQQHPR
MVHB_METTH      ----------------------------EIEGPIFIADCVGCGMCVPECPVDAITLDKVG---GVIEIDE
Y1303_METJA     ---------------------------------IDRDKCVGCLRCSYLCPRDTIVPDSIDACTSIKDGEV
Y514_METJA      ------------------------------AKIIE-DKCVKCEICAQTCP--------VG-AIYVIEGRA
NUOI_CARHZ      ----------------------------------------------------------------------
MAUM_METFK      ----------------------------------------------------------------------
Y51B_METJA      ----------------------------------------------------------------------
VHUB_METVO      ----------------------------------------------------------------------
MVHB_METFE      ----------------------------------------------------------------------
RNFB_SHEPW      ----------------------------------------GCRPYAEAIANGDKINKCPPGGTATMEKIA
RNFB_SHEPA      --------------------------------------------------------DKVNKCAATMEKLA
FER2_METJA      ----------------------------------------------------------------------
RNFB_BUCAP      ---------------------------AEVDDLLPQSQCAQCSGCYPYAKAIVKNNENIDKCIPGGNNLK
FWDF_METJA      ----------------------------------------------------------------------
RNFB_HAEDU      ----------------------------------------------------------------------
RNFB_BUCAT      ----------------------------------------------------------------------
RNFB_BUCAI      ----------------------------------------------------------------------
RNFB_BUCA5      ----------------------------------------------------------------------
YCCM_ECOLI      ----------------------------------------------------------------------
VHCB_METVO      ----------------------------------------------------------------------
RNFB_SHEAM      ----------------------------------------------------------------------
RNFB_HAHCH      ----------------------------------------------------------------------
NDHI_SYNY3      ----------------------------------------------------------------------
NDHI_CYAP8      ----------------------------------------------------------------------
NDHI_CYAP7      ----------------------------------------------------------------------
NDHI_CYAP4      ----------------------------------------------------------------------
NDHI_ACAM1      ----------------------------------------------------------------------
Y1043_HAEIN     ----------------------------------------------------------------------
VHUB_METJA      ----------------------------------------------------------------------
NDHI_SYNP2      ----------------------------------------------------------------------
RNFB_SHESR      ----------------------------------------------------------------------
RNFB_SHESA      ----------------------------------------------------------------------
FER2_THEAC      ----------------------------------------------------------------------
RNFB_SODGM      ----------------------------------------------------------------------
NDHI_PLEBO      ----------------------------------------------------------------------
RNFB_SHESM      ----------------------------------------------------------------------
RNFB_SHESH      ----------------------------------------------------------------------
NDHI_THEEB      ----------------------------------------------------------------------
NDHI_SYNPX      ----------------------------------------------------------------------
NDHI_GLOVI      ----------------------------------------------------------------------
NDHI_CYAA5      ----------------------------------------------------------------------
MAUM_METEA      ----------------------------------------------------------------------
RNFB_VIBPA      ----------------------------------------------------------------------
RNFB_RHOCA      ----------------------------EIAKILPGTNCPGCNGLAEAMAEGNA---PVTACTPGGRDVA
RNFB_MAGSM      ----------------------------------------------------------------------
RNFB_ERWT9      ----------------------------------------------------------------------
PORD_THEMA      ---------------------------------------------------------------GVIDKPG
NUOI_DEIDV      ----------------------------------------------------------------------
NUOI1_SYNFM     ----------------------------------------------------------------------
NDHI_SYNSC      ----------------------------------------------------------------------
NDHI_SYNS9      ----------------------------------------------------------------------
FER_PYRIL       ----------------------------------------------------------------------
RNFB_VIBVY      ----------------------------------------------------------------------
RNFB_VIBVU      ----------------------------------------------------------------------
RNFB_VIBSL      ----------------------------------------------------------------------
RNFB_VIBHB      ----------------------------------------------------------------------
RNFB_VIBFM      ----------------------------------------------------------------------
RNFB_VIBF1      ----------------------------------------------------------------------
RNFB_PECCP      ----------------------------------------------------------------------
NUOI_VESOH      ----------------------------------------------------------------------
NDHI_PROMT      ----------------------------------------------------------------------
NDHI_PROM1      ----------------------------------------------------------------------
ASRC_SALTY      ---------------------------------------------------------------------A
ASRC_SALTI      ---------------------------------------------------------------------A
RNFB_VIBCM      ----------------------------------------------------------------------
RNFB_VIBCH      ----------------------------------------------------------------------
RNFB_VIBC3      ----------------------------------------------------------------------
RNFB_AZOSB      ---------------------------------------------------------------------A
RNFB_ALCBS      ----------------------------------------------------------------------
PORD_METJA      ----------------------------------------------------------------------
NUOI_HELPJ      ----------------------------------------------------------------------
NUOI_HELPH      ----------------------------------------------------------------------
NUOI_HELPG      ----------------------------------------------------------------------
NUOI_HELP2      ----------------------------------------------------------------------
NQO9_THET8      ----------------------------------------------------------------------
NQO9_THET2      ----------------------------------------------------------------------
NDHI_HUPLU      ----------------------------------------------------------------------
NDHI_ANGEV      ----------------------------------------------------------------------
VORD_PYRFU      ----------------------------------------------------------------------
RNFB_ERWCT      ----------------------------------------------------------------------
RNFB_ALISL      ----------------------------------------------------------------------
RN151_MOUSE     ----------------------------------------------------------------------
NUOI_SHEWM      ----------------------------------------------------------------------
NUOI_DEIRA      ----------------------------------------------------------------------
NDHI_ZYGCR      ----------------------------------------------------------------------
NDHI_SYNP6      ----------------------------------------------------------------------
NDHI_SYNE7      ----------------------------------------------------------------------
NDHI_STAPU      ----------------------------------------------------------------------
NDHI_NEPOL      ----------------------------------------------------------------------
NDHI_MICAN      ----------------------------------------------------------------------
NDHI_CHAGL      ----------------------------------------------------------------------
FER1_CAUCR      ----------------------------------------------------------------------
Y51A_METJA      ----------------------------------------------------------------------
RNFB_SHISS      ----------------------------------------------------------IAELLNVEPQPL
RNFB_SHIB3      ----------------------------------------------------------IAELLNVEPQPL
RNFB_SHEON      ----------------------------------------------------------------------
RNFB_KLEP3      ----------------------------------------------------------------------
RNFB_ECOUT      ----------------------------------------------------------IAELLNVEPQPL
RNFB_ECOSM      ----------------------------------------------------------IAELLNVEPQPL
RNFB_ECOSE      ----------------------------------------------------------IAELLNVEPQPL
RNFB_ECOL5      ----------------------------------------------------------IAELLNVEPQPL
RNFB_ECOK1      ----------------------------------------------------------IAELLNVEPQPL
RNFB_ECO81      ----------------------------------------------------------IAELLNVEPQPL
RNFB_ECO7I      ----------------------------------------------------------IAELLNVEPQPL
RNFB_ECO5E      ----------------------------------------------------------IAELLNVEPQPL
RNFB_ECO57      ----------------------------------------------------------IAELLNVEPQPL
RNFB_ECO55      ----------------------------------------------------------IAELLNVEPQPL
RNFB_ECO45      ----------------------------------------------------------IAELLNVEPQPL
RNFB_ECO24      ----------------------------------------------------------IAELLNVEPQPL
RNFB_AERS4      ----------------------------------------GCKPYAEALANGDQINKCVPGGDATMRKIA
RNFB_AERHH      ----------------------------------------GCKPYAEALANGDQINKCVPGGDATMRKIA
NUOI_RUTMC      ----------------------------------------------------------------------
NUOI_PSEU2      ----------------------------------------------------------------------
NUOI_PSEPK      ----------------------------------------------------------------------
NUOI_PSEPF      ----------------------------------------------------------------------
NUOI_PSEFL      ----------------------------------------------------------------------
NUOI_PSEF5      ----------------------------------------------------------------------
NUOI_PSEE4      ----------------------------------------------------------------------
NUOI_HELPY      ----------------------------------------------------------------------
NUOI_HELPS      ----------------------------------------------------------------------
NUOI_HELAH      ----------------------------------------------------------------------
NUOI_DEIGD      ----------------------------------------------------------------------
NDHI_SYNS3      ----------------------------------------------------------------------
NDHI_SYNPW      ----------------------------------------------------------------------
NDHI_PROMS      ----------------------------------------------------------------------
NDHI_PROMP      ----------------------------------------------------------------------
NDHI_PROMM      ----------------------------------------------------------------------
NDHI_PROMA      ----------------------------------------------------------------------
NDHI_PROM9      ----------------------------------------------------------------------
NDHI_PROM5      ----------------------------------------------------------------------
NDHI_PROM4      ----------------------------------------------------------------------
NDHI_PROM3      ----------------------------------------------------------------------
NDHI_PROM2      ----------------------------------------------------------------------
NDHI_PROM0      ----------------------------------------------------------------------
NDHI_MESVI      ----------------------------------------------------------------------
NDHI_CHLAT      ----------------------------------------------------------------------
NDHI_ANAVT      ----------------------------------------------------------------------
NDHI_ANASP      ----------------------------------------------------------------------
MAUN_METEA      ----------------------------------------------------------------------
AB2E_ARATH      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DLSAKSWTVMRFTETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSEHCIGCGYCI
FDNH_SHIFL      DLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCI
FDNH_ECOLI      DLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCI
FDOH_SHIFL      DLSAKSWTVMRFSEVEQNDKLEWLIRKDGCMHCSDPGCLKACPAEGAIIQYANGIVDFQSEQCIGCGYCI
FDOH_ECOLI      DLSAKSWTVMRFSEVEQNDKLEWLIRKDGCMHCSDPGCLKACPAEGAIIQYANGIVDFQSEQCIGCGYCI
FDOH_ECOL6      DLSAKSWTVMRFSEVEQNDKLEWLIRKDGCMHCSDPGCLKACPAEGAIIQYANGIVDFQSEQCIGCGYCI
FDXH_HAEIN      DLDAKAWTVMRFNEVEENDRLEWLIRKDGCMHCTEPGCLKACPAPGAIIQYANGIVDFQSDKCIGCGYCI
FDHB_DESGI      DFNFHTYKLVRMHEQEIDGRIDWLFFPDQCRHCIAPPCKATADESAIIHDDATGCVLFKTKDLEDYESVI
HMC2_DESVH      RTDADSWTVVN--RYNAAGLDHPVFRKQQCNHCLEPACASAC-FVKAFTKNPDGSVTYDGSLCVGCRYCM
PHSB_SALTY      ---SRVQVQIRAPEQASNALTHFQFVRVSCQHCENAPCVSVCPT-GASYRDENGIVQVDKSRCIGCDYCV
PHSB_SALTI      ---SRVQVQIRAPEQASNALTHFQFVRVSCQHCENAPCVSVCPT-GASYRDENGIVQVDKSRCIGCDYCV
DMSB_SHIFL      EYAGGDWQ-------EDNGVWHQNVLSISCNHCEDPACTKVCPS-GAMHKREDGFVVVDEDVCIGCRYCH
DMSB_ECOLI      EYAGGDWQ-------EDNGVWHQNVLSISCNHCEDPACTKVCPS-GAMHKREDGFVVVDEDVCIGCRYCH
YNFG_ECOLI      EYAGGDWQ-------EDNGVWHQNVLSISCNHCDDPACTKVCPS-GAMHKREDGFVVVDEDVCIGCRYCH
YNFG_ECOL6      EYAGGDWQ-------EDNGVWHQNVLSISCNHCDDPACTKVCPS-GAMHKREDGFVVVDEDVCIGCRYCH
HYBA_SHIFL      KLSPYTNNIIQVKDQEENG---YAYIKKQCMHCVDPNCVSVCPVSALKKDPKTGIVHYDKDVCTGCRYCM
HYBA_ECOLI      KLSPYTNNIIQVKDQEENG---YAYIKKQCMHCVDPNCVSVCPVSALKKDPKTGIVHYDKDVCTGCRYCM
HYBA_ECO57      KLSPYTNNIIQVKDQEENG---YAYIKKQCMHCVDPNCVSVCPVSALKKDPKTGIVHYDKDVCTGCRYCM
DMSB_HAEIN      EYTGGQWNQQADGCWHQNIFAYYM--SISCNHCADPACTKVCPT-GAMHKNADGFVIVNEEICIGCRYCH
NRFC_HAEIN      -------EILRSEPYGEFPNQEYEFFRQSCQHCTNAPCVAVCPTGASFIDKETGIVDVHKDLCIGCQYCI
PSRB_WOLSU      KLP--------------DGTLSFNYHRQSCVQCENTPCVSVCPTKASYVN-EDGIVSVNVDLCVGCLYCI
NRFC_SHIFL      -------TIIRSEPQGEFPDVKYRFFRKSCQHCDHAPCVDVCPTGASFRDAASGIVDVNPDLCVGCQYCI
NRFC_ECOLI      -------TIIRSEPQGEFPDVKYRFFRKSCQHCDHAPCVDVCPTGASFRDAASGIVDVNPDLCVGCQYCI
NRFC_ECO57      -------TIIRSEPQGEFPDVKYRFFRKSCQHCDHAPCVDVCPTGASFRDAASGIVDVNPDLCVGCQYCI
YDHX_ECOLI      QGSRLS--IAHIPVTDNDNETQYHFFRQSCQHCEDAPCIDVCPT-GASWRDEQGIVRVEKSQCIGCSYCI
YDHX_ECO57      QGSRLS--IAHIPVTDNDNETQYHFFRQSCQHCEDAPCIDVCPT-GASWRDEQGIVRVEKSQCIGCSYCI
YGFS_ECOLI      ELNADV-----FLPRLKVQRLDSISAPVMCHQCENAPCVGACP-VGALTM-GEQVVQTNSARCIGCQSCV
DDHB_RHOSU      ALSAEDYGIYNYEEALMTGTDPWLREDEGCNHCANPGCLAACARNAIYKRQEDGIVLVDQERCRGYRYCI
YDHY_SHIFL      KIHRNYFFXXXXXXXXXXXXXXXXXTADTCRQCKEPQCMNVCPIGAITWQQKEGCITVDHKRCIGCSACT
YDHY_ECOLI      KIHRNYFFXXXXXXXXXXXXXXXXXTADTCRQCKEPQCMNVCPIGAITWQQKEGCITVDHKRCIGCSACT
YDHY_ECO57      KIHRNYFFXXXXXXXXXXXXXXXXXTADTCRQCKEPQCMNVCPIGAITWQQKEGCITVDHKRCIGCSACT
FDHB_WOLSU      GVNRRRVVTLN----------EGLVGKEACMHCSDAPCAQVCPVDCFYVR-ADGIVLHDKEKCIGCGYCL
CLRB_IDEDE      KLKTNGIIPINLNEVLLEGKADQVVPHEKCNHCSNPACLAACPTKAIYKRPEDGIVVVDQTRCRGYRYCV
SERB_THASE      DYGG-TWNY-NLLETLVEGKSNQVVPDEKCNHCSNPACLAACPTKAIYKREEDGLVVVDQSRCKGYRYCV
COOF_RHORU      AIAANLPLHARNKVVSVDGTAMPM----QCRQCEDAPCTFACPTGAC--RQADGQVQIVEQHCIGCKLCV
AEGA_ECOLI      HVLSQHHFHPRITVIKHQQQRSAVT----CHHCEDAPCARSCPNGA--ISHVDDSIQVNQQKCIGCKSCV
HMEA_ARCFU      DPQWMRIAKLKLDKPEVNPKEYYIPLL--CNHCEHPPCVQVCLTK-ASFKRPDGIVEIDMHRCIGCRYCM
YGFT_ECOLI      ----------------------------ACHHCNNAPCVTACPVNALTFQ--SDSVQLDEQKCIGCKRCA
NARH_BACSU      -----------------------------CEHCINPACVSSCPSGAMYKREEDGIVLVDQNACRSWRYCV
FER9_METJA      --CMEKNKVGRIAIMEKDGKYIPIV----CQHCASAPCKEVCPVSA--IEHKDGYVYLNEDVCIGCGLCA
YSAA_ECOLI      DCAALSPD--EFISRIRVIKDHCWTTAVACHQCEDAPCANVCPVDA--ISREHGHIFVEQTRCIGCKSCM
NARH_SHIFL      -----------------------------CEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCI
NARH_ECOLI      -----------------------------CEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCI
NARY_ECOLI      -----------------------------CEHCLNPSCVATCPSGAIYKREEDGIVLIDQDKCRGWRLCI
HYDN_ECOLI      NQDCASLTPETFLPRIHVIKGVNISTATVCRQCEDAPCANVCPNGA--ISRDKGFVHVMQERCIGCKTCV
HYDN_ECOL6      NQDCASLTPETFLPRIHVIKGVNISTATVCRQCEDAPCANVCPNGA--ISRDKGFVHVMQERCIGCKTCV
HYDN_ECO57      NQDCASLTPETFLPRIHVIKGVNISTATVCRQCEDAPCANVCPNGA--ISRDKGFVHVMQERCIGCKTCV
Y264_METJA      ---------------------EFPIK---CMHCDRNPCLYACPENA--IERINNKVVVIKDKCVGCGLCA
PGTS_PELAC      --RGHRWMNIERRERGTYPRNDINYRPTPCMHCENAPCV--AKGNGAVYQREDGIVLIDPEKAKGKKELL
FER8_METJA      -----------------------------CMQCENAPCKEICPVDAIYLKDGIPIVD--KERCIACGMCA
NARH_BRASZ      -----AW----FNNVES--KL--------CEHCLNPACVATCPSGAIYKREEDGIVLIDQDK-----LCI
HYCB_SHIFL      GLQSMPRLRVMLNEKESAPQL--------CHHCEDAPCAVVCPVNA--ITRVDGAVQLNESLCVSCKLCG
HYCB_ECOLI      GLQSMPRLRVMLNEKESAPQL--------CHHCEDAPCAVVCPVNA--ITRVDGAVQLNESLCVSCKLCG
HYCB_ECOL6      GLQSMPRLRVMLNEKESAPQL--------CHHCEDAPCAVVCPVNA--ITRVDGAVQLNESLCVSCKLCG
YFRA_PROVU      -----------------------------CHQCEDAPCANVCPNGAIIHNKDYYYVD--QDKCIGCKTCV
HYFA_ECOLI      LALAKTSTITAPVV---------------CHHCEEAPCLQVCP-VNAISQ-RDDAIQLNESLCIGCKLCA
MVHB_METTH      DTCIKCWNAVYISKPEKRAKKKFELDEDACIGCNT--CVEACPGDFIVPRTSNLTVELPAI-CTACGLCE
Y1303_METJA     DLKVENFKVIKVKEDKTSQPTSY------CINCGL--CAEHCPSGA--LRFENGHLYYSPDVCWKCMECV
Y514_METJA      EISEVHYTIKEKSIPHRKIRLKYELDENTCIKCGI--CARFCPT-NAIKAVRRKSIEVNLDLCMGCGACA
NUOI_CARHZ      ----------------------------------------------------HGSFTLHSEKCIACGLCQ
MAUM_METFK      --------------------------------------LRSRPAPAATVLRPPGALDFQSA-CVRCGLCV
Y51B_METJA      --SCPAFAIEMIYNEEYNKKLP-VIDEGSCVACAN--CIEVCPTGVLEMKYSNLIID--EEVCVRCGNCE
VHUB_METVO      -------------------------------------CASACPT-GALVEN-NGKLIYNSSKCIKCGNCA
MVHB_METFE      ------------------------------------------------------MIVINKEDCIRCGACQ
RNFB_SHEPW      DLVGVDPEPLNATEAVQEKKVAF-IREDECIGCTK--CIQACP-VDAILGSGKLMHTVITDYCTGCDLCV
RNFB_SHEPA      DLMGVEPEPLNVTEAVQIKKVAY-IREDECIGCTK--CIQACP-VDAILGSGKLMHTVITDYCTGCDLCV
FER2_METJA      ------------------------------------------------VEEISKVIKRDLEKCVHCGCCI
RNFB_BUCAP      FKIAKVLNIKNIAKNEKNIHTTVLIDEKNCVGCSK--CASFCP-VDAIIGTPNFMHTVLQKFCTGCNICL
FWDF_METJA      -----------------------VIDKDACVTCG--WCAFICPAEAIEVEKPKGELIIDVNACNACGACI
RNFB_HAEDU      -----------------------LIHEDMCIGCTK--CIQACP-VDAIIGTNKAMHTVVADLCTGCELCV
RNFB_BUCAT      -----------------------LINESNCVGCSK--CASFCP-VDAIVGAPNFIHTVLQEFCTGCNICL
RNFB_BUCAI      -----------------------LINESNCVGCSK--CASFCP-VDAIVGAPNFIHTVLQEFCTGCNICL
RNFB_BUCA5      -----------------------LINESNCVGCSK--CASFCP-VDAIVGAPNFIHTVLQEFCTGCNICL
YCCM_ECOLI      -------------------------------------CRYLCPY-GALMGVVSLLSPFKAESCIDCGKCA
VHCB_METVO      -------------------------------------CVSACPTEGKIVHNEKEYIEFTPSLCDSCGACV
RNFB_SHEAM      --------------TEQQVKKVAYIREDECIGCTK--CIQACP-VDAIVGAGKLMHTVITQDCTGCDLCV
RNFB_HAHCH      ---------------ESKGKQVAYIREDECIGCTK--CIQACP-VDAILGAAKQMHTVIVSECTGCDLCV
NDHI_SYNY3      -----------------------------------------------------GRIHFEFDKCIACEVCV
NDHI_CYAP8      -----------------------------------------------------GRIHFEFDKCIACEVCV
NDHI_CYAP7      -----------------------------------------------------GRIHFEFDKCIACEVCV
NDHI_CYAP4      -----------------------------------------------------GRIHFEFDKCISCEVCV
NDHI_ACAM1      -----------------------------------------------------GRIHFEFDKCISCEVCV
Y1043_HAEIN     --------------------------------------------------------DLFSAVCNGCGECA
VHUB_METJA      --------------------------KGHCVLCQK--CIDVCPIE---IISLPGVIDXXTDACVGCGICV
NDHI_SYNP2      -----------------------------------------------------GRIHFEFDKCIACEVCV
RNFB_SHESR      -------------EAQSQVKKVAYIREDECIGCTK--CIQACP-VDAIIGAGKLMHTVLTADCTGCDLCV
RNFB_SHESA      -------------EAQSQVKKVAYIREDECIGCTK--CIQACP-VDAIIGAGKLMHTVLTADCTGCDLCV
FER2_THEAC      -------------------KTEMDVDRNLCNYCG--ACVGMCPTDA--IWLDETVIKIHEEKCIECGFCI
RNFB_SODGM      -------------------RVAW-IDEGNCIGCTK--CIQACP-VDAIVGATRAVHTVVSDLCTGCDLCV
NDHI_PLEBO      -----------------------------------------------------GRIHFEFDKCIACEVCV
RNFB_SHESM      -------------EAQSQVKKVAYIREDECIGCTK--CIQACP-VDAIIGAGKLMHTVLTADCTGCDLCV
RNFB_SHESH      ------------TEEVQVKKVAY-IREEECIGCTK--CIQACP-VDAILGSGKLMHTVITDYCTGCDLCV
NDHI_THEEB      -----------------------------------------------------GRIHFEFDKCIACEVCV
NDHI_SYNPX      ---------------------------DKCIACEV--CVRVCPINLPVVDWVNYSIDFGV--CIFCGNCV
NDHI_GLOVI      -----------------------------------------------------GRIHFERPKCISCEVCV
NDHI_CYAA5      -----------------------------------------------------GRIHFEFDKCIACEVCV
MAUM_METEA      --------------------------------------------------------------CVRCGLCV
RNFB_VIBPA      ------------------------IHEDMCIGCTK--CIQACP-VDAIVGGTKAVHTVIKDECTGCDLCV
RNFB_RHOCA      LALAEIVTVEAGADAGPIAEIEPMVAEDHCTGCQK--CFKRCPT-DAIVGGAKQIHTVVMDACIGCDACI
RNFB_MAGSM      -------------------KLEALLPATNCGMCGHPGCINLCTPGGAMLGVSPAAMDIDEEACIGCTACI
RNFB_ERWT9      ---------------EPERKVAW-IDEANCIGCTK--CIQACP-VDAIVGATRAMHTVLSDICTGCDLCV
PORD_THEMA      EYKTGAWRVMRP-----------ILHKEKCIDCMF--CWLYCPDQ-AIIQEGGIMKGFNYDYCKGCGLCA
NUOI_DEIDV      ------------------------------------------------------------EKCIGCSLCA
NUOI1_SYNFM     --------------------------------------------------------DTGTHKCIACGTCE
NDHI_SYNSC      ---------------------------DKCIACEV--CVRVCPINLPVVDWVNYSIDFGV--CIFCGNCV
NDHI_SYNS9      ---------------------------DKCIACEV--CVRVCPINLPVVDWVNYSIDFGV--CIFCGNCV
FER_PYRIL       -----------------------------------------------LAKYERVVID--QDICISCGACV
RNFB_VIBVY      ------------------------IHEDMCIGCTK--CIQACP-VDAIVGGTKALHTVIKDECTGCDLCV
RNFB_VIBVU      ------------------------IHEDMCIGCTK--CIQACP-VDAIVGGTKALHTVIKDECTGCDLCV
RNFB_VIBSL      ------------------------IHEDMCIGCTK--CIQACP-VDAIVGGTKALHTVIKDECTGCDLCV
RNFB_VIBHB      ------------------------IHEDMCIGCTK--CIQACP-VDAIVGGTKALHTVIKDECTGCDLCV
RNFB_VIBFM      -------------DEEKSIKKVAFIHEDMCIGCTK--CIQACP-VDAIVGGTKALHTVIESECTGCDLCV
RNFB_VIBF1      -------------DEEKSIKKVAFIHEDMCIGCTK--CIQACP-VDAIVGGTKALHTVIESECTGCDLCV
RNFB_PECCP      ------------------------IDESNCIGCTK--CIQACP-VDAIIGSTKAVHTVVSDLCTGCDLCV
NUOI_VESOH      ----------------------------------------------ALRRYPNG-----EERCIACKLCE
NDHI_PROMT      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_PROM1      -----------------------------------------------------GRIHYEFDKCIACEVCV
ASRC_SALTY      DLGIIGVAKMRFTA-------------DRCIGCG--ACVKACSHAVGCLALKNGKAVKEESACIGCGECV
ASRC_SALTI      DLGIIGVAKMRFTA-------------DRCIGCG--ACVKACSHAVGCLALKNGKAVKEESACIGCGECV
RNFB_VIBCM      -------------------KMVAFIHEDMCIGCTK--CIQACP-VDAIVGGNKAVHTVIKNECTGCDLCV
RNFB_VIBCH      -------------------KMVAFIHEDMCIGCTK--CIQACP-VDAIVGGNKAVHTVIKNECTGCDLCV
RNFB_VIBC3      -------------------KMVAFIHEDMCIGCTK--CIQACP-VDAIVGGNKAVHTVIKNECTGCDLCV
RNFB_AZOSB      DLLGREFKPLSAEHGEEKPKAVAYIDENVCIGCTL--CLQACP-VDAIVGAAKQMHTVVDPLCTGCELCV
RNFB_ALCBS      ------------------------IREDECIGCTK--CIQACP-VDAIVGAAKLMHTVIVDECTGCDLCV
PORD_METJA      -----------------------ILDNEKCVKCEN--CYIFCPE-GAIQEDENGNFKIDYDYCKGCLICM
NUOI_HELPJ      ------------------------------------------------VHHLQRLLDSGSERCIGCGLCE
NUOI_HELPH      ------------------------------------------------VHHLQRLLDSGSERCIGCGLCE
NUOI_HELPG      ------------------------------------------------VHHLQRLLDSGSERCIGCGLCE
NUOI_HELP2      ------------------------------------------------VHHLQRLLDSGSERCIGCGLCE
NQO9_THET8      -----------------------------------------------LTRHPNGL-----EKCIGCSLCA
NQO9_THET2      -----------------------------------------------LTRHPNGL-----EKCIGCSLCA
NDHI_HUPLU      -----------------------------------------------------GRIHFEFDKCIACEVCV
NDHI_ANGEV      ---------------------------DKCIACEV--CVRVCPINLPVVQLKNYSIDFAV--CIFCGNCV
VORD_PYRFU      -----------------------VVNEEKCVKCYI--CWKYCPEPAIYIK-PDGYVAIDYDYCKGCGICA
RNFB_ERWCT      ------------------------IDESNCIGCTK--CIQACP-VDAIIGSTKAVHTVVSDLCTGCDLCI
RNFB_ALISL      -------------DEEKSIKKIAFIHEDMCIGCTK--CIQACP-VDAIVGGTKALHTVIEAECTGCDLCV
RN151_MOUSE     --------------------------------------LMACPNEGCTVQVLRGVLDEHRQHCQQNGQCP
NUOI_SHEWM      ------------------------------------------------------------ERCVACNLCS
NUOI_DEIRA      ------------------------------------------------------------EKCIGCSLCA
NDHI_ZYGCR      -----------------------------------------------------GRIHFEFDKCIACEVCV
NDHI_SYNP6      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_SYNE7      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_STAPU      -----------------------------------------------------GRIHFEFDKCIACEVCV
NDHI_NEPOL      -----------------------------------------------------GRIHFEFDKCIACEVCV
NDHI_MICAN      -----------------------------------------------------GRIHFEFDKCIACEVCV
NDHI_CHAGL      -----------------------------------------------------GRIHFEFDKCIACEVCV
FER1_CAUCR      ---------------------------DACVRCKFMDCVEVCP-VDCFYEGENFLV-INPDECIDCGVCE
Y51A_METJA      -------------------------------------------------------IDYISERCASCLVCL
RNFB_SHISS      DGEAQELTPARMVA---------VIDENNCIGCTK--CIQACP-VDAIVGATRAMHTVMSDLCTGCNLCV
RNFB_SHIB3      DGEAQELTPARMVA---------VIDENNCIGCTK--CIQACP-VDAIVGATRAMHTVMSDLCTGCNLCV
RNFB_SHEON      -------------EAQSQVKKVAYIREDECIGCTK--CIQACP-VDAIIGAGKLMHTVLTADCTGCDLCV
RNFB_KLEP3      -----------------------VIDEPNCIGCTK--CIQACP-VDAIVGATRAMHTVMNDLCTGCNLCV
RNFB_ECOUT      DGEAQELTPARMVA---------VIDENNCIGCTK--CIQACP-VDAIVGATRAMHTVMSDLCTGCNLCV
RNFB_ECOSM      DGEAQELTPARMVA---------VIDENNCIGCTK--CIQACP-VDAIVGATRAMHTVMSDLCTGCNLCV
RNFB_ECOSE      DGEAQELTPARMVA---------VIDENNCIGCTK--CIQACP-VDAIVGATRAMHTVMSDLCTGCNLCV
RNFB_ECOL5      DGEAQELTPARMVA---------VIDENNCIGCTK--CIQACP-VDAIVGATRAMHTVMSDLCTGCNLCV
RNFB_ECOK1      DGEAQELTPARMVA---------VIDENNCIGCTK--CIQACP-VDAIVGATRAMHTVMSDLCTGCNLCV
RNFB_ECO81      DGEAQELTPARMVA---------VIDENNCIGCTK--CIQACP-VDAIVGATRAMHTVMSDLCTGCNLCV
RNFB_ECO7I      DGEAQELTPARMVA---------VIDENNCIGCTK--CIQACP-VDAIVGATRAMHTVMSDLCTGCNLCV
RNFB_ECO5E      DGEAQELTPARMVA---------VIDENNCIGCTK--CIQACP-VDAIVGATRAMHTVMSDLCTGCNLCV
RNFB_ECO57      DGEAQELTPARMVA---------VIDENNCIGCTK--CIQACP-VDAIVGATRAMHTVMSDLCTGCNLCV
RNFB_ECO55      DGEAQELTPARMVA---------VIDENNCIGCTK--CIQACP-VDAIVGATRAMHTVMSDLCTGCNLCV
RNFB_ECO45      DGEAQELTPARMVA---------VIDENNCIGCTK--CIQACP-VDAIVGATRAMHTVMSDLCTGCNLCV
RNFB_ECO24      DGEAQELTPARMVA---------VIDENNCIGCTK--CIQACP-VDAIVGATRAMHTVMSDLCTGCNLCV
RNFB_AERS4      DLMGVDPQPLGSAEAAIPVKKVAFIHEDQCIGCTK--CIQACP-VDAIVGATKAMHTVITDECTGCDLCV
RNFB_AERHH      DLMGVEPQPLGGAEAAAPIKKVAFIHEDQCIGCTK--CIQACP-VDAIVGATKAMHTVIADECTGCDLCV
NUOI_RUTMC      ----------------------------------------------ALRRYPNG-----EERCIACKLCE
NUOI_PSEU2      ------------------------------------------------------------ERCVACNLCA
NUOI_PSEPK      ------------------------------------------------------------ERCVACNLCA
NUOI_PSEPF      ------------------------------------------------------------ERCVACNLCA
NUOI_PSEFL      ------------------------------------------------------------ERCVACNLCA
NUOI_PSEF5      ------------------------------------------------------------ERCVACNLCA
NUOI_PSEE4      ------------------------------------------------------------ERCVACNLCA
NUOI_HELPY      ------------------------------------------------------LLDSGSERCIGCGLCE
NUOI_HELPS      ------------------------------------------------------LLDSGSERCIGCGLCE
NUOI_HELAH      ------------------------------------------------------LLDSGSERCIGCGLCE
NUOI_DEIGD      ------------------------------------------------------------EKCIGCSLCA
NDHI_SYNS3      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_SYNPW      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_PROMS      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_PROMP      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_PROMM      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_PROMA      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_PROM9      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_PROM5      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_PROM4      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_PROM3      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_PROM2      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_PROM0      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_MESVI      -----------------------------------------------------GRIHFEFDKCIACEVCV
NDHI_CHLAT      -----------------------------------------------------GRIHFEFDKCIACEVCV
NDHI_ANAVT      -----------------------------------------------------GRIHYEFDKCIACEVCV
NDHI_ANASP      -----------------------------------------------------GRIHYEFDKCIACEVCV
MAUN_METEA      -------------------------RREGCTNCG--ACFQICTEPHVITPALKGTGSILSGDCVNCGSCI
AB2E_ARATH      -------------------------------------CKKSCPKTGKLVTVGSKLAFISEELCIGCGICV


                         +         .         .         .         .         *         .:210
query           AGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELGEQRVEKLKARGFEH
FDNH_SHIFL      AGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEH
FDNH_ECOLI      AGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEH
FDOH_SHIFL      AGCPFDIPRLNPEDNRVYKCTLCVDRVVVGQEPACVKTCPTGAIHFGTKESMKTLASERVAELKTRGYDN
FDOH_ECOLI      AGCPFDIPRLNPEDNRVYKCTLCVDRVVVGQEPACVKTCPTGAIHFGTKESMKTLASERVAELKTRGYDN
FDOH_ECOL6      AGCPFDIPRLNPEDNRVYKCTLCVDRVVVGQEPACVKTCPTGAIHFGTKESMKTLASERVAELKTRGYDN
FDXH_HAEIN      AGCPFNIPRMNPEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIRFGSKEEMKIYAEQRVADLKSRGYEN
FDHB_DESGI      SACPYDVPRKVAESNQMAKCDMCIDRITNGLRPACVTSCPTGAMNFGDLSEMEAMASARLAEIKA-AYSD
HMC2_DESVH      VACPFNVPAFQYADPLIQKCTMCHPRLAEGKLPGCVEICPKEALTFGRRKDLVRIAHDRIRQNPGRYIDH
PHSB_SALTY      AACPFHVRYLNPQTGVADKCNFCADRLAAGQSPACVSVCPTDALKFGRLDE-------------------
PHSB_SALTI      AACPFHVRYLNPQTGVADKCNFCADRLAAGQSPACVSVCPTDALKFGRLDE-------------------
DMSB_SHIFL      MACPYGAPQYNETKGHMTKCDGCYDRVAEGKKPICVESCPLRALDFGPIDEL------------------
DMSB_ECOLI      MACPYGAPQYNETKGHMTKCDGCYDRVAEGKKPICVESCPLRALDFGPIDEL------------------
YNFG_ECOLI      MACPYGAPQYNAEKGHMTKCDGCYSRVAEGKQPICVESCPLRALEFGPIEEL------------------
YNFG_ECOL6      MACPYGAPQYNAEKGHMTKCDGCYSRVAEGKQPICVESCPLRALEFGPIEEL------------------
HYBA_SHIFL      VACPYNVPKYNNPFGALHKCELCVERLDKGGLPGCVEVCPAGAVIFGTREELMAEAKKRL----------
HYBA_ECOLI      VACPYNVPKYNNPFGALHKCELCVERLDKGGLPGCVEVCPAGAVIFGTREELMAEAKKRL----------
HYBA_ECO57      VACPYNVPKYNNPFGALHKCELCVERLDKGGLPGCVEVCPAGAVIFGTREELMAEAKKRL----------
DMSB_HAEIN      MACPYDAPQYDAQKGHMTKCDGCYSRVKSGQKPICVDACPLRALDFAPIDEL------------------
NRFC_HAEIN      AVCPYRVRFIHPIHRTADKCNFCRDNLANGKQPACVEACPTKALTFGDMNDPTSAVSRKVKE--------
PSRB_WOLSU      AACPYQARYVDPVTKAPDKCNFCKDRLARGEEPACVTVCPTDALTFG-----------------------
NRFC_SHIFL      AACPYRVRFIHPVTKTADKCDFCKTNLQAGKLPACVEACPTKALTFG-----------------------
NRFC_ECOLI      AACPYRVRFIHPVTKTADKCDFCKTNLQAGKLPACVEACPTKALTFG-----------------------
NRFC_ECO57      AACPYRVRFIHPVTKTADKCDFCKTNLQAGKLPACVEACPTKALTFG-----------------------
YDHX_ECOLI      GACPYQVRYLNPVTKVADKCDFCAERLAKGFPPICVSACPEHALIFG-----------------------
YDHX_ECO57      GACPYQVRYLNPVTKVADKCDFCAERLAKGFPPICVSACPEHALIFG-----------------------
YGFS_ECOLI      SACPFGMITIQSTRQQIVKCDLCEQRE---EGPACVESCPTQALQLLTERELRRVRQQRI----------
DDHB_RHOSU      TACPYKKVYFNEQISKAEKCIFCYPRIEKGLPTACAKQC-VGRIRF------------------------
YDHY_SHIFL      TACPWMMATVNTESKKSSKCVLCGE---------CANACPTGAL--------------------------
YDHY_ECOLI      TACPWMMATVNTESKKSSKCVLCGE---------CANACPTGAL--------------------------
YDHY_ECO57      TACPWMMATVNTESKKSSKCVLCGE---------CANACPTGAL--------------------------
FDHB_WOLSU      YACPFGAPQFPKSGGPMDKCTFCANRIAEGKVPVCAAMCSTKALLAGDSDSISLIIRERVLK--------
CLRB_IDEDE      KACPYGKMYFNLQKGKSEKCIGCYPRVEKGEAPACVKQC-SGRIRF------------------------
SERB_THASE      KACPYGKMYFNLQKGTSEKCIGCYPRVEKGEAPACVKQC-SGRIRF------------------------
COOF_RHORU      MVCPFGAITVRSETNRAKKCDLCVDRASTGKAPACVEACPTKAI--------------------------
AEGA_ECOLI      VACPFGTMQIGKVKATAHKCDLCAGREN---GPACVENCPADALQLVTDVALSGMAKSR--RLRTARQEH
HMEA_ARCFU      IACPYGARCFNFIDPRVEKCTFCVHRVKKGEEPACVEACGKGALVFGNIKD-------------------
YGFT_ECOLI      IACPFGV--VEMVDTIAQKCDLCNQRSSGTQ--ACIEVCPTQALRLMDDKGLQQIKVARQRKTAA-----
NARH_BACSU      SSCPYKKVYFNWQTNKAEKCTLCFPRLEAGLPTICSETC-------------------------------
FER9_METJA      LACPFGAILM---EDKAYKCILC-----NGDEPACVKACSKRCLELVDVNELI-----------------
YSAA_ECOLI      LACPFGAMEVSRKKARAIKCDLCWHRET---GPACVEACPTKAL--------------------------
NARH_SHIFL      TGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCSETC-------------------------------
NARH_ECOLI      TGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCSETC-------------------------------
NARY_ECOLI      SGCPYKKIYFNWKSGKSEKCIFCYPRIESGQPTVCSETC-------------------------------
HYDN_ECOLI      VACPYGAMNVRADKAEANKCDLCNHR---EDGPACMAACPTHALICVDRNKLEQLSAEK-----------
HYDN_ECOL6      VACPYGAMNVRADKAEANKCDLCNHR---EDGPACMAACPTHALICVDRNKLEQLSAEK-----------
HYDN_ECO57      VACPYGAMNVRADKAEANKCDLCNHR---EDGPACMAACPTHALICVDRNKLEQLSAEK-----------
Y264_METJA      LACPFGAIRI---DGVAIKCNGCYKR----DVEICKEVCPTGA---------------------------
PGTS_PELAC      DTCPYGVMYWNEEENVAQKCTMCADESWAPKMPRCAHNCGSFVYEF-----LKTTPEAMAKKVEEEGLE-
FER8_METJA      IACPIGAIFIK---NRVHKCTLCVDRIT----PACVEACKDKAL--------------------------
NARH_BRASZ      SGCP-------------YKCIFCYPRIESGQPTVCSETC-------------------------------
HYCB_SHIFL      IACPFGAIEFSXXXXRVVKCDLCFDE----QGPACVRMCPTKALHLVDNTDIARVSKRKRE---------
HYCB_ECOLI      IACPFGAIEFSXXXXRVVKCDLCFDE----QGPACVRMCPTKALHLVDNTDIARVSKRKRE---------
HYCB_ECOL6      IACPFGAIEFSXXXXRVVKCDLCFDE----QGPACVRMCPTKALHLVDNTDIARVSKRKRE---------
YFRA_PROVU      LACPYKLTALNTIEAEANKCDLCHHR---AEGPACVEVCPTQAL--------------------------
HYFA_ECOLI      VVCPFGASLKDGEENAAVKCDLC-DFLPEG--PACVRACPNQALRLIT-GDSLQRQMKEKQRLAASWFAN
MVHB_METTH      QLCPVDAIDLEVELGPAKPASLVWDEEKCDFIGACANICPNDAIRVVTKEGMKVPDNEKVDE--------
Y1303_METJA     KICPNDVRRIKQDNNKLYSCESPVDDRVVGLCEICINNCPEEAISITTVK--------------------
Y514_METJA      EVCPKKCIKVERELGEVIKCLVCIDKVKINKDKCCVDVCPTNAIKMWEKK--------------------
NUOI_CARHZ      QACPNKVIKVGKDENNKRKCLFC---------GLCVEACPTNALVF---NQEYELAKYRIEDIKLTLFKR
MAUM_METFK      EDCPFDILKLASWADRDEPCRMC-------QDIPCVRACPTGALN-------------------------
Y51B_METJA      RACPINVIE-RKEGKYVINMALCISC------KECIKVCP------------------------------
VHUB_METVO      TACPTGIKKV--DDRFPYSCVLC---------EKCVDACPIDII--------------------------
MVHB_METFE      GVCPTGAISVKPED--VIYCDMC------GGEPKCVEACPNDALRHGIKKKKITYSPEKCDK--------
RNFB_SHEPW      APCP------------------------------------------------------------------
RNFB_SHEPA      APCP------------------------------------------------------------------
FER2_METJA      TQCPINVIYMDEDYNVVFKEEDCVGCKN------CLKACPFKAI--------------------------
RNFB_BUCAP      LHCPTNCIKIIKE---------------------------------------------------------
FWDF_METJA      SICPCSALEFPKPKDKAEK----VPRIIVNQNGACAKACPVNAI--------------------------
RNFB_HAEDU      APCPTN----------------CIEMIKVKQNP-------------------------------------
RNFB_BUCAT      LHCPTNCIEIKKE---------------------------------------------------------
RNFB_BUCAI      LHCPTNCIEIKKE---------------------------------------------------------
RNFB_BUCA5      LHCPTNCIEIKKE---------------------------------------------------------
YCCM_ECOLI      KNCPSRIPVDKLIQVRTVECTGCM---------TCVESCPVAS---------------------------
VHCB_METVO      EICPQNVLKLNEEYKLKGFCVMCLKCID-----ACDKT--------------------------------
RNFB_SHEAM      EPCP------------------------------------------------------------------
RNFB_HAHCH      EPCP------------------------------------------------------------------
NDHI_SYNY3      RVCPINLPVVDWEFNKAVKCIFCGN---------CVEYCPTNCLSMTEEYEL------------------
NDHI_CYAP8      RVCPINLPVVDWEFNKAVKCIFCGN---------CVEYCPTNCLSMTEEYEL------------------
NDHI_CYAP7      RVCPINLPVVDWEFNKAVKCIFCGN---------CVEYCPTNCLSMTEEYEL------------------
NDHI_CYAP4      RVCPINLPVVDWEFNKELKCIFCAN---------CVEYCPTNCLSVTEEYEL------------------
NDHI_ACAM1      RVCPINLPVVDWEFNKEIKCIFCAN---------CVEYCPTNCLSVTEEYEL------------------
Y1043_HAEIN     SACPNGLIQLKQQ-----QATLEIDYAPCDLCGKCAEVCPTNALH-------------------------
VHUB_METJA      PECPVNAITLNKAVIDKSKCIYC---------SICAQTCPWNAIFVAGK---------------------
NDHI_SYNP2      RVCPINLPVVDWEDKSIKKKTLKHYSIDFGVCGNCVEYCPTNCLSMTEEYEL------------------
RNFB_SHESR      EPCPVD----------------CIDMIPVGQ---------------------------------------
RNFB_SHESA      EPCPVD----------------CIDMIPVGQ---------------------------------------
FER2_THEAC      VGCP------------------------------------------------------------------
RNFB_SODGM      APCPTN----------------------------------------------------------------
NDHI_PLEBO      RVCPINLPVVDWEFNKETKCIFCGN---------CVEYCPTNCLSMTEEYEL------------------
RNFB_SHESM      EPCPVD----------------CIDMLPVGQ---------------------------------------
RNFB_SHESH      APCP------------------------------------------------------------------
NDHI_THEEB      RVCPINLPELKKKELKHYSCIFCAN---------CVEYCPTNCLSVTEEYEL------------------
NDHI_SYNPX      EYCPTNCLSMTEEYELAARHSLNYDNVALGRLPTSVTTDPS------------------VQPLRELAYLP
NDHI_GLOVI      RVCPINLPVVDYEFNKETKCIFCGN---------CVEYCPTSCLSMTEEYEL------------------
NDHI_CYAA5      RVCPINLPVVDWEFNKDAKCIFCGN---------CVEYCPTNCLSMTEEYEL------------------
MAUM_METEA      RACPYDTLRLAEMGERETPCFMCTD-------VPCAKACPTGAL--------------------------
RNFB_VIBPA      APCP------------------------------------------------------------------
RNFB_RHOCA      EVCP------------------------------------------------------------------
RNFB_MAGSM      KVCPVDIVGANKQSHTVIECTSC---------QLCLEPCPTDCI--------------------------
RNFB_ERWT9      APCP------------------------------------------------------------------
PORD_THEMA      NVCP------------------------------------------------------------------
NUOI_DEIDV      AACPAYAIYVEAGENDPH------DPVSPGERYACEEACPTGAVVLGNEFEMAD----------------
NUOI1_SYNFM     RMCPSNVIKVQGTKAQFTRCSLC---------GICVESCPTGTLQYSTEYEL--AGESR-----------
NDHI_SYNSC      EYCPTNCLSMTEEYELAARHSLNYDNVALGRLPTSVTTDPS-----------------------------
NDHI_SYNS9      EYCPTNCLSMTEEYELAARHSLNYDNVALGRLPTSVTTDPS-----------------------------
FER_PYRIL       AACPYQALELDENGKSRLIWEKCKDDFS------CVAVCPVKAI--------------------------
RNFB_VIBVY      APCP------------------------------------------------------------------
RNFB_VIBVU      APCP------------------------------------------------------------------
RNFB_VIBSL      APCP------------------------------------------------------------------
RNFB_VIBHB      APCP------------------------------------------------------------------
RNFB_VIBFM      APCP------------------------------------------------------------------
RNFB_VIBF1      APCP------------------------------------------------------------------
RNFB_PECCP      APCP------------------------------------------------------------------
NUOI_VESOH      AVCPANTRRTTQYDIDLFKCIFC---------GFCEEACPVDAISIMTKERLLEVGSQNEQVINQTKFED
NDHI_PROMT      RVCPINLPVMNKETKKKELRNYSIDFGACIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_PROM1      RVCPINLPVMNKETKKKELRNYSIDFGACIFCGNCVEYCPTNCLSMTEEYEL------------------
ASRC_SALTY      LACP------------------------------------------------------------------
ASRC_SALTI      LACP------------------------------------------------------------------
RNFB_VIBCM      APCP------------------------------------------------------------------
RNFB_VIBCH      APCP------------------------------------------------------------------
RNFB_VIBC3      APCP------------------------------------------------------------------
RNFB_AZOSB      APCP------------------------------------------------------------------
RNFB_ALCBS      EPCP------------------------------------------------------------------
PORD_METJA      NECPVN----------------------------------------------------------------
NUOI_HELPJ      KICTSNCIRIKGEDNRKKIDSYTINLGRCIYCGLCAEVCPELAIVMGNRFE-------------------
NUOI_HELPH      KICTSNCIRIKGEDNRKKIDSYTINLGRCIYCGLCAEVCPELAIVMGNRFE-------------------
NUOI_HELPG      KICTSNCIRIKGEDNRKKIDSYTINLGRCIYCGLCAEVCPELAIVMGNRFE-------------------
NUOI_HELP2      KICTSNCIRIKGEDNRKKIDSYTINLGRCIYCGLCAEVCPELAIVMGNRFE-------------------
NQO9_THET8      AACPYVEPAENDPENKVYRCIFC---------GLCEEACPTGAIVLGYDFEMAD----------------
NQO9_THET2      AACPYVEPAENDPENKVYRCIFC---------GLCEEACPTGAIVLGYDFEMAD----------------
NDHI_HUPLU      RVCPINLPVVDWEEKNIRKKQLTSYSIDFGVCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_ANGEV      EYCPTNCLSMTEEELSTYRHELNYDQIALGRLPVSVVQDPT-----------------------------
VORD_PYRFU      NECPTKAITMIKEE--------------------------------------------------------
RNFB_ERWCT      SPCP------------------------------------------------------------------
RNFB_ALISL      APCP------------------------------------------------------------------
RN151_MOUSE     LGCGSTLAALEGEHHNCYR---------------------------------------------------
NUOI_SHEWM      VACPISVVKTEKEDGRWEAESFTINFSRCIMCGFCEEACPTHAIQLTPDVEMAEYDRQNL----------
NUOI_DEIRA      AACPANDPRDPVSPGERYAKVYEINMLRCIFCGLCEEACPTGAVVLGNEFEMAD----------------
NDHI_ZYGCR      RVCPINLPVVDWEFQKSMKCIFCGN---------CVEYCPTNCLSMTEEYEL------------------
NDHI_SYNP6      RVCPINLPVVNKETKKKDLKNYSIDFGACIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_SYNE7      RVCPINLPVVNKETKKKDLKNYSIDFGACIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_STAPU      RVCPINLPVVDWEFQKSMKCIFCGN---------CVEFCPTNCLSMTEEYEL------------------
NDHI_NEPOL      RVCPINLPSVKKKQLRSYSCIFCGN---------CVEYCPTNCLSMTEEYEL------------------
NDHI_MICAN      RVCPINLPVVDWTFNKEIKCIFCGN---------CVEYCPTNCLSMTEEYEL------------------
NDHI_CHAGL      RVCPINLPVVDWEFQKSIKCIFCGN---------CVEYCPTNCLSMTEEYEL------------------
FER1_CAUCR      PECPVDAIKPDTED--------------------------------------------------------
Y51A_METJA      RNCPFNAIEEYGSKIRINKCELC---------GKCEEICPLNAI--------------------------
RNFB_SHISS      DPCP------------------------------------------------------------------
RNFB_SHIB3      DPCP------------------------------------------------------------------
RNFB_SHEON      EPCP------------------------------------------------------------------
RNFB_KLEP3      APCP------------------------------------------------------------------
RNFB_ECOUT      DPCP------------------------------------------------------------------
RNFB_ECOSM      DPCP------------------------------------------------------------------
RNFB_ECOSE      DPCP------------------------------------------------------------------
RNFB_ECOL5      DPCP------------------------------------------------------------------
RNFB_ECOK1      DPCP------------------------------------------------------------------
RNFB_ECO81      DPCP------------------------------------------------------------------
RNFB_ECO7I      DPCP------------------------------------------------------------------
RNFB_ECO5E      DPCP------------------------------------------------------------------
RNFB_ECO57      DPCP------------------------------------------------------------------
RNFB_ECO55      DPCP------------------------------------------------------------------
RNFB_ECO45      DPCP------------------------------------------------------------------
RNFB_ECO24      DPCP------------------------------------------------------------------
RNFB_AERS4      DPCP------------------------------------------------------------------
RNFB_AERHH      DPCP------------------------------------------------------------------
NUOI_RUTMC      AVCPANAITIESEDIDLFKCIFC---------GFCEEACPVDAISIMTKERLLEVGSQNEQAINQARLED
NUOI_PSEU2      VACPVGCISLQKEDGRWYRCIFC---------GLCEEACPTTAIQLTPDFEMAEFKRQ------------
NUOI_PSEPK      VACPVGCISLQKEDGRWYRCIFC---------GLCEEACPTTAIQLTPDFEMAEFKRQ------------
NUOI_PSEPF      VACPVGCISLQKEDGRWYRCIFC---------GLCEEACPTTAIQLTPDFEMAEFKRQ------------
NUOI_PSEFL      VACPVGCISLQKEDGRWYRCIFC---------GLCEEACPTTAIQLTPDFEMAEFKRQ------------
NUOI_PSEF5      VACPVGCISLQKEDGRWYRCIFC---------GLCEEACPTTAIQLTPDFEMAEFKRQ------------
NUOI_PSEE4      VACPVGCISLQKEDGRWYRCIFC---------GLCEEACPTTAIQLTPDFEMAEFKRQ------------
NUOI_HELPY      KICTSNCIRIKGEDNRKKIDSYTINLGRCIYCGLCAEVCPELAIVMGNRFE-------------------
NUOI_HELPS      KICTSNCIRIKGEDNRKKIDSYTINLGRCIYCGLCAEVCPELAIVMGNRFE-------------------
NUOI_HELAH      KICTSNCIRIKGEDNRKKIDSYTINLGRCIYCGLCAEVCPELAIVMGNRFE-------------------
NUOI_DEIGD      AVCPAYAIYVEAAENDPLNPTSPGERYAKVYEGLCEEACPTGAVVLGNEFEMAD----------------
NDHI_SYNS3      RVCPINLPVMNKETKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_SYNPW      RVCPINLPVMNKETKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_PROMS      RVCPINLPVMNKETKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_PROMP      RVCPINLPVMNKETKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_PROMM      RVCPINLPVMNKETKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_PROMA      RVCPINLPVMNKETKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_PROM9      RVCPINLPVMNKETKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_PROM5      RVCPINLPVMNKETKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_PROM4      RVCPINLPVMNKETKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_PROM3      RVCPINLPVMNKETKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_PROM2      RVCPINLPVMNKETKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_PROM0      RVCPINLPVMNKETKKKELRNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_MESVI      RVCPINLPVVNWEXXXXXXXTYSIDFGVCIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_CHLAT      RVCPINLPVVNWEXXXXXXXTYSIDFGVCIFCGNCVEYCPTNCLSMTEEYEL------------------
NDHI_ANAVT      RVCPINLPVVDWEFDKATKCIFCGN---------CVEYCPTNCLSMTEEYEL------------------
NDHI_ANASP      RVCPINLPVVDWEFDKATKCIFCGN---------CVEYCPTNCLSMTEEYEL------------------
MAUN_METEA      DACPVNV---------------------------------------------------------------
AB2E_ARATH      KKCPFNLPRLEKDTTHRY----------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AGIYNPQGVGGTHVMYVLHHANQPELYHGLPKDPQIDTSINLWKGALKPLAAAGFIATFAGLIYHYIGIG
FDNH_SHIFL      AGVYNPEGVGGTHVMYVLHHADQPELYHGLPKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIG
FDNH_ECOLI      AGVYNPEGVGGTHVMYVLHHADQPELYHGLPKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIG
FDOH_SHIFL      AGLYDPAGVGGTHVMYVLHHADKPNLYHGLPENPEISETVKFWKGIWKPLXXXXXXXXXXXSIFHYVGVG
FDOH_ECOLI      AGLYDPAGVGGTHVMYVLHHADKPNLYHGLPENPEISETVKFWKGIWKPLXXXXXXXXXXXSIFHYVGVG
FDOH_ECOL6      AGLYDPAGVGGTHVMYVLHHADKPNLYHGLPENPEISETVKFWKGIWKPLXXXXXXXXXXXSIFHYVGVG
FDXH_HAEIN      AGLYDPPGVGGTHVMYVLHHADKPELYNGLPKDPQIDLSVTLWKDVLKPXXXXXXXXXXXXXXXHYLTVG
FDHB_DESGI      AKLCDPDDV---RVIFLTAH--NPKLYH------------------------------------------
HMC2_DESVH      --VYGEQEMGGTAWMYL-----------------------------------------------------
PHSB_SALTY      ----------------------------------------------------------------------
PHSB_SALTI      ----------------------------------------------------------------------
DMSB_SHIFL      ----------------------------------------------------------------------
DMSB_ECOLI      ----------------------------------------------------------------------
YNFG_ECOLI      ----------------------------------------------------------------------
YNFG_ECOL6      ----------------------------------------------------------------------
HYBA_SHIFL      ----------------------------------------------------------------------
HYBA_ECOLI      ----------------------------------------------------------------------
HYBA_ECO57      ----------------------------------------------------------------------
DMSB_HAEIN      ----------------------------------------------------------------------
NRFC_HAEIN      ----------------------------------------------------------------------
PSRB_WOLSU      ----------------------------------------------------------------------
NRFC_SHIFL      ----------------------------------------------------------------------
NRFC_ECOLI      ----------------------------------------------------------------------
NRFC_ECO57      ----------------------------------------------------------------------
YDHX_ECOLI      ----------------------------------------------------------------------
YDHX_ECO57      ----------------------------------------------------------------------
YGFS_ECOLI      ----------------------------------------------------------------------
DDHB_RHOSU      ----------------------------------------------------------------------
YDHY_SHIFL      ----------------------------------------------------------------------
YDHY_ECOLI      ----------------------------------------------------------------------
YDHY_ECO57      ----------------------------------------------------------------------
FDHB_WOLSU      ----------------------------------------------------------------------
CLRB_IDEDE      ----------------------------------------------------------------------
SERB_THASE      ----------------------------------------------------------------------
COOF_RHORU      ----------------------------------------------------------------------
AEGA_ECOLI      ----------------------------------------------------------------------
HMEA_ARCFU      ----------------------------------------------------------------------
YGFT_ECOLI      ----------------------------------------------------------------------
NARH_BACSU      ----------------------------------------------------------------------
FER9_METJA      ----------------------------------------------------------------------
YSAA_ECOLI      ----------------------------------------------------------------------
NARH_SHIFL      ----------------------------------------------------------------------
NARH_ECOLI      ----------------------------------------------------------------------
NARY_ECOLI      ----------------------------------------------------------------------
HYDN_ECOLI      ----------------------------------------------------------------------
HYDN_ECOL6      ----------------------------------------------------------------------
HYDN_ECO57      ----------------------------------------------------------------------
Y264_METJA      ----------------------------------------------------------------------
PGTS_PELAC      ----------------------------------------------------------------------
FER8_METJA      ----------------------------------------------------------------------
NARH_BRASZ      ----------------------------------------------------------------------
HYCB_SHIFL      ----------------------------------------------------------------------
HYCB_ECOLI      ----------------------------------------------------------------------
HYCB_ECOL6      ----------------------------------------------------------------------
YFRA_PROVU      ----------------------------------------------------------------------
HYFA_ECOLI      GG--------------------------------------------------------------------
MVHB_METTH      ----------------------------------------------------------------------
Y1303_METJA     ----------------------------------------------------------------------
Y514_METJA      ----------------------------------------------------------------------
NUOI_CARHZ      EEITTGEG--------------------------------------------------------------
MAUM_METFK      ----------------------------------------------------------------------
Y51B_METJA      ----------------------------------------------------------------------
VHUB_METVO      ----------------------------------------------------------------------
MVHB_METFE      ----------------------------------------------------------------------
RNFB_SHEPW      ----------------------------------------------------------------------
RNFB_SHEPA      ----------------------------------------------------------------------
FER2_METJA      ----------------------------------------------------------------------
RNFB_BUCAP      ----------------------------------------------------------------------
FWDF_METJA      ----------------------------------------------------------------------
RNFB_HAEDU      ----------------------------------------------------------------------
RNFB_BUCAT      ----------------------------------------------------------------------
RNFB_BUCAI      ----------------------------------------------------------------------
RNFB_BUCA5      ----------------------------------------------------------------------
YCCM_ECOLI      ----------------------------------------------------------------------
VHCB_METVO      ----------------------------------------------------------------------
RNFB_SHEAM      ----------------------------------------------------------------------
RNFB_HAHCH      ----------------------------------------------------------------------
NDHI_SYNY3      ----------------------------------------------------------------------
NDHI_CYAP8      ----------------------------------------------------------------------
NDHI_CYAP7      ----------------------------------------------------------------------
NDHI_CYAP4      ----------------------------------------------------------------------
NDHI_ACAM1      ----------------------------------------------------------------------
Y1043_HAEIN     ----------------------------------------------------------------------
VHUB_METJA      ----------------------------------------------------------------------
NDHI_SYNP2      ----------------------------------------------------------------------
RNFB_SHESR      ----------------------------------------------------------------------
RNFB_SHESA      ----------------------------------------------------------------------
FER2_THEAC      ----------------------------------------------------------------------
RNFB_SODGM      ----------------------------------------------------------------------
NDHI_PLEBO      ----------------------------------------------------------------------
RNFB_SHESM      ----------------------------------------------------------------------
RNFB_SHESH      ----------------------------------------------------------------------
NDHI_THEEB      ----------------------------------------------------------------------
NDHI_SYNPX      AGEMDPHGV-------------------------------------------------------------
NDHI_GLOVI      ----------------------------------------------------------------------
NDHI_CYAA5      ----------------------------------------------------------------------
MAUM_METEA      ----------------------------------------------------------------------
RNFB_VIBPA      ----------------------------------------------------------------------
RNFB_RHOCA      ----------------------------------------------------------------------
RNFB_MAGSM      ----------------------------------------------------------------------
RNFB_ERWT9      ----------------------------------------------------------------------
PORD_THEMA      ----------------------------------------------------------------------
NUOI_DEIDV      ----------------------------------------------------------------------
NUOI1_SYNFM     ----------------------------------------------------------------------
NDHI_SYNSC      ----------------------------------------------------------------------
NDHI_SYNS9      ----------------------------------------------------------------------
FER_PYRIL       ----------------------------------------------------------------------
RNFB_VIBVY      ----------------------------------------------------------------------
RNFB_VIBVU      ----------------------------------------------------------------------
RNFB_VIBSL      ----------------------------------------------------------------------
RNFB_VIBHB      ----------------------------------------------------------------------
RNFB_VIBFM      ----------------------------------------------------------------------
RNFB_VIBF1      ----------------------------------------------------------------------
RNFB_PECCP      ----------------------------------------------------------------------
NUOI_VESOH      A---------------------------------------------------------------------
NDHI_PROMT      ----------------------------------------------------------------------
NDHI_PROM1      ----------------------------------------------------------------------
ASRC_SALTY      ----------------------------------------------------------------------
ASRC_SALTI      ----------------------------------------------------------------------
RNFB_VIBCM      ----------------------------------------------------------------------
RNFB_VIBCH      ----------------------------------------------------------------------
RNFB_VIBC3      ----------------------------------------------------------------------
RNFB_AZOSB      ----------------------------------------------------------------------
RNFB_ALCBS      ----------------------------------------------------------------------
PORD_METJA      ----------------------------------------------------------------------
NUOI_HELPJ      ----------------------------------------------------------------------
NUOI_HELPH      ----------------------------------------------------------------------
NUOI_HELPG      ----------------------------------------------------------------------
NUOI_HELP2      ----------------------------------------------------------------------
NQO9_THET8      ----------------------------------------------------------------------
NQO9_THET2      ----------------------------------------------------------------------
NDHI_HUPLU      ----------------------------------------------------------------------
NDHI_ANGEV      ----------------------------------------------------------------------
VORD_PYRFU      ----------------------------------------------------------------------
RNFB_ERWCT      ----------------------------------------------------------------------
RNFB_ALISL      ----------------------------------------------------------------------
RN151_MOUSE     ----------------------------------------------------------------------
NUOI_SHEWM      ----------------------------------------------------------------------
NUOI_DEIRA      ----------------------------------------------------------------------
NDHI_ZYGCR      ----------------------------------------------------------------------
NDHI_SYNP6      ----------------------------------------------------------------------
NDHI_SYNE7      ----------------------------------------------------------------------
NDHI_STAPU      ----------------------------------------------------------------------
NDHI_NEPOL      ----------------------------------------------------------------------
NDHI_MICAN      ----------------------------------------------------------------------
NDHI_CHAGL      ----------------------------------------------------------------------
FER1_CAUCR      ----------------------------------------------------------------------
Y51A_METJA      ----------------------------------------------------------------------
RNFB_SHISS      ----------------------------------------------------------------------
RNFB_SHIB3      ----------------------------------------------------------------------
RNFB_SHEON      ----------------------------------------------------------------------
RNFB_KLEP3      ----------------------------------------------------------------------
RNFB_ECOUT      ----------------------------------------------------------------------
RNFB_ECOSM      ----------------------------------------------------------------------
RNFB_ECOSE      ----------------------------------------------------------------------
RNFB_ECOL5      ----------------------------------------------------------------------
RNFB_ECOK1      ----------------------------------------------------------------------
RNFB_ECO81      ----------------------------------------------------------------------
RNFB_ECO7I      ----------------------------------------------------------------------
RNFB_ECO5E      ----------------------------------------------------------------------
RNFB_ECO57      ----------------------------------------------------------------------
RNFB_ECO55      ----------------------------------------------------------------------
RNFB_ECO45      ----------------------------------------------------------------------
RNFB_ECO24      ----------------------------------------------------------------------
RNFB_AERS4      ----------------------------------------------------------------------
RNFB_AERHH      ----------------------------------------------------------------------
NUOI_RUTMC      A---------------------------------------------------------------------
NUOI_PSEU2      ----------------------------------------------------------------------
NUOI_PSEPK      ----------------------------------------------------------------------
NUOI_PSEPF      ----------------------------------------------------------------------
NUOI_PSEFL      ----------------------------------------------------------------------
NUOI_PSEF5      ----------------------------------------------------------------------
NUOI_PSEE4      ----------------------------------------------------------------------
NUOI_HELPY      ----------------------------------------------------------------------
NUOI_HELPS      ----------------------------------------------------------------------
NUOI_HELAH      ----------------------------------------------------------------------
NUOI_DEIGD      ----------------------------------------------------------------------
NDHI_SYNS3      ----------------------------------------------------------------------
NDHI_SYNPW      ----------------------------------------------------------------------
NDHI_PROMS      ----------------------------------------------------------------------
NDHI_PROMP      ----------------------------------------------------------------------
NDHI_PROMM      ----------------------------------------------------------------------
NDHI_PROMA      ----------------------------------------------------------------------
NDHI_PROM9      ----------------------------------------------------------------------
NDHI_PROM5      ----------------------------------------------------------------------
NDHI_PROM4      ----------------------------------------------------------------------
NDHI_PROM3      ----------------------------------------------------------------------
NDHI_PROM2      ----------------------------------------------------------------------
NDHI_PROM0      ----------------------------------------------------------------------
NDHI_MESVI      ----------------------------------------------------------------------
NDHI_CHLAT      ----------------------------------------------------------------------
NDHI_ANAVT      ----------------------------------------------------------------------
NDHI_ANASP      ----------------------------------------------------------------------
MAUN_METEA      ----------------------------------------------------------------------
AB2E_ARATH      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PNKxxxxxxxxxxx
FDNH_SHIFL      PNK-----------
FDNH_ECOLI      PNK-----------
FDOH_SHIFL      PNR-----------
FDOH_ECOLI      PNR-----------
FDOH_ECOL6      PNR-----------
FDXH_HAEIN      PN------------
FDHB_DESGI      --------------
HMC2_DESVH      --------------
PHSB_SALTY      --------------
PHSB_SALTI      --------------
DMSB_SHIFL      --------------
DMSB_ECOLI      --------------
YNFG_ECOLI      --------------
YNFG_ECOL6      --------------
HYBA_SHIFL      --------------
HYBA_ECOLI      --------------
HYBA_ECO57      --------------
DMSB_HAEIN      --------------
NRFC_HAEIN      --------------
PSRB_WOLSU      --------------
NRFC_SHIFL      --------------
NRFC_ECOLI      --------------
NRFC_ECO57      --------------
YDHX_ECOLI      --------------
YDHX_ECO57      --------------
YGFS_ECOLI      --------------
DDHB_RHOSU      --------------
YDHY_SHIFL      --------------
YDHY_ECOLI      --------------
YDHY_ECO57      --------------
FDHB_WOLSU      --------------
CLRB_IDEDE      --------------
SERB_THASE      --------------
COOF_RHORU      --------------
AEGA_ECOLI      --------------
HMEA_ARCFU      --------------
YGFT_ECOLI      --------------
NARH_BACSU      --------------
FER9_METJA      --------------
YSAA_ECOLI      --------------
NARH_SHIFL      --------------
NARH_ECOLI      --------------
NARY_ECOLI      --------------
HYDN_ECOLI      --------------
HYDN_ECOL6      --------------
HYDN_ECO57      --------------
Y264_METJA      --------------
PGTS_PELAC      --------------
FER8_METJA      --------------
NARH_BRASZ      --------------
HYCB_SHIFL      --------------
HYCB_ECOLI      --------------
HYCB_ECOL6      --------------
YFRA_PROVU      --------------
HYFA_ECOLI      --------------
MVHB_METTH      --------------
Y1303_METJA     --------------
Y514_METJA      --------------
NUOI_CARHZ      --------------
MAUM_METFK      --------------
Y51B_METJA      --------------
VHUB_METVO      --------------
MVHB_METFE      --------------
RNFB_SHEPW      --------------
RNFB_SHEPA      --------------
FER2_METJA      --------------
RNFB_BUCAP      --------------
FWDF_METJA      --------------
RNFB_HAEDU      --------------
RNFB_BUCAT      --------------
RNFB_BUCAI      --------------
RNFB_BUCA5      --------------
YCCM_ECOLI      --------------
VHCB_METVO      --------------
RNFB_SHEAM      --------------
RNFB_HAHCH      --------------
NDHI_SYNY3      --------------
NDHI_CYAP8      --------------
NDHI_CYAP7      --------------
NDHI_CYAP4      --------------
NDHI_ACAM1      --------------
Y1043_HAEIN     --------------
VHUB_METJA      --------------
NDHI_SYNP2      --------------
RNFB_SHESR      --------------
RNFB_SHESA      --------------
FER2_THEAC      --------------
RNFB_SODGM      --------------
NDHI_PLEBO      --------------
RNFB_SHESM      --------------
RNFB_SHESH      --------------
NDHI_THEEB      --------------
NDHI_SYNPX      --------------
NDHI_GLOVI      --------------
NDHI_CYAA5      --------------
MAUM_METEA      --------------
RNFB_VIBPA      --------------
RNFB_RHOCA      --------------
RNFB_MAGSM      --------------
RNFB_ERWT9      --------------
PORD_THEMA      --------------
NUOI_DEIDV      --------------
NUOI1_SYNFM     --------------
NDHI_SYNSC      --------------
NDHI_SYNS9      --------------
FER_PYRIL       --------------
RNFB_VIBVY      --------------
RNFB_VIBVU      --------------
RNFB_VIBSL      --------------
RNFB_VIBHB      --------------
RNFB_VIBFM      --------------
RNFB_VIBF1      --------------
RNFB_PECCP      --------------
NUOI_VESOH      --------------
NDHI_PROMT      --------------
NDHI_PROM1      --------------
ASRC_SALTY      --------------
ASRC_SALTI      --------------
RNFB_VIBCM      --------------
RNFB_VIBCH      --------------
RNFB_VIBC3      --------------
RNFB_AZOSB      --------------
RNFB_ALCBS      --------------
PORD_METJA      --------------
NUOI_HELPJ      --------------
NUOI_HELPH      --------------
NUOI_HELPG      --------------
NUOI_HELP2      --------------
NQO9_THET8      --------------
NQO9_THET2      --------------
NDHI_HUPLU      --------------
NDHI_ANGEV      --------------
VORD_PYRFU      --------------
RNFB_ERWCT      --------------
RNFB_ALISL      --------------
RN151_MOUSE     --------------
NUOI_SHEWM      --------------
NUOI_DEIRA      --------------
NDHI_ZYGCR      --------------
NDHI_SYNP6      --------------
NDHI_SYNE7      --------------
NDHI_STAPU      --------------
NDHI_NEPOL      --------------
NDHI_MICAN      --------------
NDHI_CHAGL      --------------
FER1_CAUCR      --------------
Y51A_METJA      --------------
RNFB_SHISS      --------------
RNFB_SHIB3      --------------
RNFB_SHEON      --------------
RNFB_KLEP3      --------------
RNFB_ECOUT      --------------
RNFB_ECOSM      --------------
RNFB_ECOSE      --------------
RNFB_ECOL5      --------------
RNFB_ECOK1      --------------
RNFB_ECO81      --------------
RNFB_ECO7I      --------------
RNFB_ECO5E      --------------
RNFB_ECO57      --------------
RNFB_ECO55      --------------
RNFB_ECO45      --------------
RNFB_ECO24      --------------
RNFB_AERS4      --------------
RNFB_AERHH      --------------
NUOI_RUTMC      --------------
NUOI_PSEU2      --------------
NUOI_PSEPK      --------------
NUOI_PSEPF      --------------
NUOI_PSEFL      --------------
NUOI_PSEF5      --------------
NUOI_PSEE4      --------------
NUOI_HELPY      --------------
NUOI_HELPS      --------------
NUOI_HELAH      --------------
NUOI_DEIGD      --------------
NDHI_SYNS3      --------------
NDHI_SYNPW      --------------
NDHI_PROMS      --------------
NDHI_PROMP      --------------
NDHI_PROMM      --------------
NDHI_PROMA      --------------
NDHI_PROM9      --------------
NDHI_PROM5      --------------
NDHI_PROM4      --------------
NDHI_PROM3      --------------
NDHI_PROM2      --------------
NDHI_PROM0      --------------
NDHI_MESVI      --------------
NDHI_CHLAT      --------------
NDHI_ANAVT      --------------
NDHI_ANASP      --------------
MAUN_METEA      --------------
AB2E_ARATH      --------------