[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF66209.1

[Show Plain Result]


## Summary of Sequence Search
    1::71
   15::85      9e-05  26%   87 aa  YSCF_YEREN RecName: Full=Yop proteins translocation protein F;
   16::85      3e-04  27%   85 aa  PSCF_PSEAE RecName: Full=Type III export protein pscF;AltName:
    1::71

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xDIAQLVDMLSHMAHQAGQAINDKMNGNDLLNPESMIKAQFALQQYSTFINYESSLIKMIKDMLSGIIAK
YSCF_YEREN      -DLDAVAQTLKKPADDANKAVNDSIAADTPDNPALLADLQHSINKWSVIYNISSTIVRSMKDLMQGILQK
PSCF_PSEAE      -----VANALKEQANAANKDVNDALQGTDNANPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQK


                         .         .         *         .         .         .         .:140
query           I
YSCF_YEREN      -
PSCF_PSEAE      I