[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF66317.1

[Show Plain Result]


## Summary of Sequence Search
    1::82
    3::65      7e-06  37%   97 aa  YAFN_ECOLI RecName: Full=Uncharacterized protein yafN;
    1::48      2e-04  35%  179 aa  DNAT_ECOL6 RecName: Full=Primosomal protein 1;AltName:
    1::48      2e-04  35%  179 aa  DNAT_ECO81 RecName: Full=Primosomal protein 1;AltName:
    1::82

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAFQILTTTAASITELKRDPMGTFNAGDGAPVAILNRNEPAFYCVPPALYAHLMDILEDEELGRIIDERx
YAFN_ECOLI      ---RILAEKSVNITELRKNPAKYFI---DQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKAR-
DNAT_ECOL6      MSSRVLTPDVVGIDALVHDHQTVLAKAEGGVVAVFDNNAPAFYAVTPA----------------------
DNAT_ECO81      MSSRVLTPDVVGIDALVHDHQTVLAKAEGGVVAVFDNNAPAFYAVTPA----------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxx
YAFN_ECOLI      ------------
DNAT_ECOL6      ------------
DNAT_ECO81      ------------