[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF66348.1

[Show Plain Result]


## Summary of Sequence Search
    1::339
    1::339     e-157  75%  339 aa  RSPB_ECOLI RecName: Full=Starvation-sensing protein rspB;       
    1::338     2e-65  41%  339 aa  YJMD_BACSU RecName: Full=Uncharacterized zinc-type alcohol
    5::325     3e-40  31%  342 aa  Y053_HAEIN RecName: Full=Uncharacterized zinc-type alcohol
    7::340     2e-39  31%  347 aa  YDJJ_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
    9::349     5e-39  31%  353 aa  DHSO_BACSU RecName: Full=Sorbitol dehydrogenase;       
   30::355     1e-37  30%  366 aa  IDND_VITVI RecName: Full=L-idonate 5-dehydrogenase;       
    1::323     2e-37  29%  340 aa  DOIAD_STRFR RecName: Full=2-deoxy-scyllo-inosamine dehydrogenase;  
   13::339     4e-37  32%  343 aa  TDH_THET8 RecName: Full=L-threonine 3-dehydrogenase;       
   13::339     5e-37  32%  343 aa  TDH_THET2 RecName: Full=L-threonine 3-dehydrogenase;       
   21::328     5e-37  34%  342 aa  TDH_COXBU RecName: Full=L-threonine 3-dehydrogenase;       
   21::328     5e-37  34%  342 aa  TDH_COXBR RecName: Full=L-threonine 3-dehydrogenase;       
   21::328     5e-37  34%  342 aa  TDH_COXBN RecName: Full=L-threonine 3-dehydrogenase;       
   21::328     5e-37  34%  342 aa  TDH_COXB2 RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     1e-36  33%  361 aa  TDH_ERWCT RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     3e-36  29%  343 aa  DHSO_BACHD RecName: Full=Sorbitol dehydrogenase;       
   23::293     3e-36  35%  343 aa  TDH_VIBPA RecName: Full=L-threonine 3-dehydrogenase;       
   25::345     3e-36  33%  347 aa  TDH_BACSU RecName: Full=L-threonine 3-dehydrogenase;       
   21::342     4e-36  32%  342 aa  TDH_AERS4 RecName: Full=L-threonine 3-dehydrogenase;       
   18::225     6e-36  40%  341 aa  TDH_EDWI9 RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     1e-35  33%  341 aa  TDH_YERPY RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     1e-35  33%  341 aa  TDH_YERPS RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     1e-35  33%  341 aa  TDH_YERPP RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     1e-35  33%  341 aa  TDH_YERPN RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     1e-35  33%  341 aa  TDH_YERPG RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     1e-35  33%  341 aa  TDH_YERPE RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     1e-35  33%  341 aa  TDH_YERPB RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     1e-35  33%  341 aa  TDH_YERPA RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     1e-35  33%  341 aa  TDH_YERP3 RecName: Full=L-threonine 3-dehydrogenase;       
   18::332     1e-35  31%  341 aa  TDH_PHOLL RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     2e-35  33%  341 aa  TDH_YERE8 RecName: Full=L-threonine 3-dehydrogenase;       
   24::334     2e-35  32%  350 aa  TDH_THEON RecName: Full=Probable L-threonine 3-dehydrogenase;      
    1::311     2e-35  32%  339 aa  DOIAD_STRSD RecName: Full=2-deoxy-scyllo-inosamine dehydrogenase;  
    5::318     3e-35  32%  344 aa  TDH_MESSB RecName: Full=L-threonine 3-dehydrogenase;       
   21::342     4e-35  32%  342 aa  TDH_AERHH RecName: Full=L-threonine 3-dehydrogenase;       
   19::328     5e-35  33%  341 aa  TDH_SHEB8 RecName: Full=L-threonine 3-dehydrogenase;       
   21::328     6e-35  32%  341 aa  TDH_SHESM RecName: Full=L-threonine 3-dehydrogenase;       
   21::328     6e-35  32%  341 aa  TDH_SHESA RecName: Full=L-threonine 3-dehydrogenase;       
   19::328     6e-35  33%  341 aa  TDH_SHEB9 RecName: Full=L-threonine 3-dehydrogenase;       
   19::328     6e-35  33%  341 aa  TDH_SHEB5 RecName: Full=L-threonine 3-dehydrogenase;       
   19::328     6e-35  33%  341 aa  TDH_SHEB2 RecName: Full=L-threonine 3-dehydrogenase;       
   19::328     8e-35  33%  341 aa  TDH_SHESW RecName: Full=L-threonine 3-dehydrogenase;       
   20::329     8e-35  33%  344 aa  TDH_DEIDV RecName: Full=L-threonine 3-dehydrogenase;       
    1::311     8e-35  28%  339 aa  DOIAD_STRRY RecName: Full=2-deoxy-scyllo-inosamine dehydrogenase;  
   21::328     1e-34  32%  341 aa  TDH_SHESR RecName: Full=L-threonine 3-dehydrogenase;       
   18::332     1e-34  31%  341 aa  TDH_SERP5 RecName: Full=L-threonine 3-dehydrogenase;       
   21::328     2e-34  32%  341 aa  TDH_SHEON RecName: Full=L-threonine 3-dehydrogenase;       
    1::315     3e-34  32%  343 aa  DOIAD_STRKN RecName: Full=2-deoxy-scyllo-inosamine dehydrogenase;  
    5::345     4e-34  32%  347 aa  TDH_BACA2 RecName: Full=L-threonine 3-dehydrogenase;       
   21::328     5e-34  31%  341 aa  TDH_SHEPC RecName: Full=L-threonine 3-dehydrogenase;       
   20::316     5e-34  32%  341 aa  TDH_CHRVO RecName: Full=L-threonine 3-dehydrogenase;       
    1::337     9e-34  29%  337 aa  YJJN_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
   16::329     9e-34  32%  348 aa  TDH_DEIRA RecName: Full=L-threonine 3-dehydrogenase;       
    5::330     2e-33  31%  345 aa  TDH_RHIEC RecName: Full=L-threonine 3-dehydrogenase;       
   21::226     2e-33  36%  341 aa  TDH_PSEHT RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     2e-33  32%  343 aa  TDH_BURPP RecName: Full=L-threonine 3-dehydrogenase;       
    5::330     2e-33  30%  345 aa  TDH_RHILW RecName: Full=L-threonine 3-dehydrogenase;       
    5::330     3e-33  31%  345 aa  TDH_RHIL3 RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     3e-33  32%  342 aa  TDH_BURVG RecName: Full=L-threonine 3-dehydrogenase;       
    1::323     3e-33  28%  340 aa  DOIAD_STRRI RecName: Full=2-deoxy-scyllo-inosamine dehydrogenase;  
    1::322     3e-33  32%  342 aa  TDH_BURP8 RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     3e-33  32%  342 aa  TDH_BURM1 RecName: Full=L-threonine 3-dehydrogenase;       
    9::350     4e-33  31%  351 aa  TDH_FRATN RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     4e-33  32%  342 aa  TDH_BURS3 RecName: Full=L-threonine 3-dehydrogenase;       
    9::350     6e-33  31%  351 aa  TDH_FRATW RecName: Full=L-threonine 3-dehydrogenase;       
    9::350     6e-33  31%  351 aa  TDH_FRATT RecName: Full=L-threonine 3-dehydrogenase;       
    9::350     6e-33  31%  351 aa  TDH_FRATO RecName: Full=L-threonine 3-dehydrogenase;       
    9::350     6e-33  31%  351 aa  TDH_FRATM RecName: Full=L-threonine 3-dehydrogenase;       
    9::350     6e-33  31%  351 aa  TDH_FRATH RecName: Full=L-threonine 3-dehydrogenase;       
    9::350     6e-33  31%  351 aa  TDH_FRATF RecName: Full=L-threonine 3-dehydrogenase;       
    9::350     6e-33  31%  351 aa  TDH_FRAT1 RecName: Full=L-threonine 3-dehydrogenase;       
    1::324     6e-33  31%  343 aa  TDH_BURXL RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     6e-33  32%  343 aa  TDH_BURPS RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     6e-33  32%  343 aa  TDH_BURP6 RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     6e-33  32%  343 aa  TDH_BURP1 RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     6e-33  32%  343 aa  TDH_BURP0 RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     6e-33  32%  343 aa  TDH_BURMS RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     6e-33  32%  343 aa  TDH_BURMA RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     6e-33  32%  343 aa  TDH_BURM9 RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     6e-33  32%  343 aa  TDH_BURM7 RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     6e-33  32%  342 aa  TDH_BURCJ RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     6e-33  32%  342 aa  TDH_BURCH RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     6e-33  32%  342 aa  TDH_BURCC RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     6e-33  32%  342 aa  TDH_BURCA RecName: Full=L-threonine 3-dehydrogenase;       
   21::328     8e-33  32%  341 aa  TDH_SHESH RecName: Full=L-threonine 3-dehydrogenase;       
   13::338     8e-33  32%  343 aa  TDH_SACEN RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     8e-33  32%  343 aa  TDH_BURTA RecName: Full=L-threonine 3-dehydrogenase;       
    5::330     1e-32  30%  345 aa  TDH_RHISN RecName: Full=L-threonine 3-dehydrogenase;       
   21::332     1e-32  30%  341 aa  TDH_COLP3 RecName: Full=L-threonine 3-dehydrogenase;       
    5::330     1e-32  30%  345 aa  TDH_AGRRK RecName: Full=L-threonine 3-dehydrogenase;       
    5::330     2e-32  29%  344 aa  TDH_SINMW RecName: Full=L-threonine 3-dehydrogenase;       
   21::291     2e-32  32%  341 aa  TDH_SHEWM RecName: Full=L-threonine 3-dehydrogenase;       
    5::330     2e-32  29%  344 aa  TDH_RHIME RecName: Full=L-threonine 3-dehydrogenase;       
    5::330     2e-32  31%  345 aa  TDH_RHIE6 RecName: Full=L-threonine 3-dehydrogenase;       
    9::351     2e-32  31%  351 aa  TDH_FRAP2 RecName: Full=L-threonine 3-dehydrogenase;       
   11::340     3e-32  28%  357 aa  DHSO_PONAB RecName: Full=Sorbitol dehydrogenase;       
    8::333     3e-32  29%  348 aa  DHSO_BOMMO RecName: Full=Sorbitol dehydrogenase;       
    1::322     4e-32  32%  342 aa  TDH_BURCM RecName: Full=L-threonine 3-dehydrogenase;       
    1::322     5e-32  32%  342 aa  TDH_BURA4 RecName: Full=L-threonine 3-dehydrogenase;       
   11::340     5e-32  27%  357 aa  DHSO_HUMAN RecName: Full=Sorbitol dehydrogenase;       
   19::345     6e-32  31%  347 aa  TDH_THETN RecName: Full=L-threonine 3-dehydrogenase;       
   21::271     6e-32  34%  341 aa  TDH_SHEFN RecName: Full=L-threonine 3-dehydrogenase;       
    8::344     6e-32  31%  346 aa  TDH_BACLD RecName: Full=L-threonine 3-dehydrogenase;       
   24::334     8e-32  33%  348 aa  TDH_PYRHO RecName: Full=Probable L-threonine 3-dehydrogenase;      
   21::291     8e-32  32%  341 aa  TDH_IDILO RecName: Full=L-threonine 3-dehydrogenase;       
    5::332     1e-31  30%  344 aa  TDH_RHILO RecName: Full=L-threonine 3-dehydrogenase;       
   21::328     1e-31  31%  343 aa  TDH_PECCP RecName: Full=L-threonine 3-dehydrogenase;       
   20::332     5e-31  30%  341 aa  TDH_PROMH RecName: Full=L-threonine 3-dehydrogenase;       
    1::311     7e-31  28%  339 aa  DOIAD_STRLV RecName: Full=2-deoxy-scyllo-inosamine dehydrogenase;  
   18::339     9e-31  32%  351 aa  TDH_SYMTH RecName: Full=L-threonine 3-dehydrogenase;       
   11::340     9e-31  27%  357 aa  DHSO_MACFA RecName: Full=Sorbitol dehydrogenase;       
    1::319     2e-30  34%  342 aa  TDH_STRAW RecName: Full=L-threonine 3-dehydrogenase;       
   21::333     2e-30  29%  343 aa  TDH_ANADF RecName: Full=L-threonine 3-dehydrogenase;       
   24::334     2e-30  32%  348 aa  TDH_PYRFU RecName: Full=Probable L-threonine 3-dehydrogenase;      
    1::326     3e-30  33%  342 aa  TDH_STRGG RecName: Full=L-threonine 3-dehydrogenase;       
    9::337     3e-30  26%  354 aa  DHSO_SHEEP RecName: Full=Sorbitol dehydrogenase;       
   24::334     6e-30  32%  348 aa  TDH_PYRAB RecName: Full=Probable L-threonine 3-dehydrogenase;      
   18::316     6e-30  31%  341 aa  TDH_MARMS RecName: Full=L-threonine 3-dehydrogenase;       
   11::340     6e-30  25%  357 aa  DHSO_RAT RecName: Full=Sorbitol dehydrogenase;       
   11::340     8e-30  25%  357 aa  DHSO_MOUSE RecName: Full=Sorbitol dehydrogenase;       
   24::334     1e-29  31%  350 aa  TDH_PYRKO RecName: Full=Probable L-threonine 3-dehydrogenase;      
   10::339     1e-29  26%  356 aa  DHSO_BOVIN RecName: Full=Sorbitol dehydrogenase;       
    1::281     3e-29  32%  340 aa  TDH_STRMK RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     3e-29  31%  341 aa  TDH_ESCF3 RecName: Full=L-threonine 3-dehydrogenase;       
    1::323     4e-29  30%  340 aa  TDH_LEGPH RecName: Full=L-threonine 3-dehydrogenase;       
    1::323     4e-29  30%  340 aa  TDH_LEGPC RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     4e-29  31%  341 aa  TDH_ENTS8 RecName: Full=L-threonine 3-dehydrogenase;       
    1::323     7e-29  30%  340 aa  TDH_LEGPA RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     9e-29  30%  341 aa  TDH_KLEP7 RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     9e-29  30%  341 aa  TDH_KLEP3 RecName: Full=L-threonine 3-dehydrogenase;       
    1::323     1e-28  30%  340 aa  TDH_LEGPL RecName: Full=L-threonine 3-dehydrogenase;       
   21::328     1e-28  30%  341 aa  TDH_SHEAM RecName: Full=L-threonine 3-dehydrogenase;       
    3::330     3e-28  29%  338 aa  XYLD_MORMO RecName: Full=D-xylulose reductase;       
   20::328     3e-28  30%  341 aa  TDH_ECOLI RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     3e-28  30%  341 aa  TDH_ECODH RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     3e-28  30%  341 aa  TDH_ECOBW RecName: Full=L-threonine 3-dehydrogenase;       
    8::339     3e-28  26%  357 aa  DHSO1_YEAST RecName: Full=Sorbitol dehydrogenase 1;       
   18::328     3e-28  31%  341 aa  TDH_SALTY RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     3e-28  31%  341 aa  TDH_SALSV RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     3e-28  31%  341 aa  TDH_SALPK RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     3e-28  31%  341 aa  TDH_SALPC RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     3e-28  31%  341 aa  TDH_SALPB RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     3e-28  31%  341 aa  TDH_SALPA RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     3e-28  31%  341 aa  TDH_SALNS RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     3e-28  31%  341 aa  TDH_SALHS RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     3e-28  31%  341 aa  TDH_SALEP RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     3e-28  31%  341 aa  TDH_SALDC RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     3e-28  31%  341 aa  TDH_SALCH RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     3e-28  31%  341 aa  TDH_SALA4 RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     3e-28  30%  341 aa  TDH_ECOLU RecName: Full=L-threonine 3-dehydrogenase;       
   20::340     3e-28  29%  341 aa  TDH_CITK8 RecName: Full=L-threonine 3-dehydrogenase;       
   18::319     4e-28  33%  342 aa  TDH_STRCO RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_SHIFL RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_SHIF8 RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_SHIBS RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_SHIB3 RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     4e-28  31%  341 aa  TDH_SALTI RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     4e-28  31%  341 aa  TDH_SALAR RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECOUT RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECOSM RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECOSE RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECOLC RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECOL6 RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECOL5 RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECOK1 RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECOHS RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECO8A RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECO81 RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECO7I RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECO5E RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECO57 RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECO55 RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECO45 RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     4e-28  30%  341 aa  TDH_ECO27 RecName: Full=L-threonine 3-dehydrogenase;       
    8::339     4e-28  26%  357 aa  DHSO2_YEAST RecName: Full=Sorbitol dehydrogenase 2;       
    1::224     6e-28  35%  340 aa  TDH_XANC5 RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     6e-28  29%  341 aa  TDH_SHISS RecName: Full=L-threonine 3-dehydrogenase;       
    3::329     6e-28  28%  344 aa  TDH_PSYIN RecName: Full=L-threonine 3-dehydrogenase;       
   18::328     6e-28  30%  341 aa  TDH_ENT38 RecName: Full=L-threonine 3-dehydrogenase;       
    1::328     6e-28  30%  341 aa  TDH_ALTMD RecName: Full=L-threonine 3-dehydrogenase;       
    1::330     6e-28  29%  346 aa  GATD_ECOLI RecName: Full=Galactitol-1-phosphate 5-dehydrogenase;   
    1::330     6e-28  29%  346 aa  GATD_ECO57 RecName: Full=Galactitol-1-phosphate 5-dehydrogenase;   
    8::339     7e-28  27%  356 aa  XYL2_YEAST RecName: Full=D-xylulose reductase;       
   18::328     7e-28  31%  341 aa  TDH_SALG2 RecName: Full=L-threonine 3-dehydrogenase;       
   22::293     1e-27  32%  343 aa  TDH_VIBCM RecName: Full=L-threonine 3-dehydrogenase;       
   22::293     1e-27  32%  343 aa  TDH_VIBCH RecName: Full=L-threonine 3-dehydrogenase;       
   22::293     1e-27  32%  343 aa  TDH_VIBC3 RecName: Full=L-threonine 3-dehydrogenase;       
    1::224     1e-27  34%  340 aa  TDH_XANOR RecName: Full=L-threonine 3-dehydrogenase;       
    1::224     1e-27  34%  340 aa  TDH_XANOM RecName: Full=L-threonine 3-dehydrogenase;       
    1::224     1e-27  35%  340 aa  TDH_XANAC RecName: Full=L-threonine 3-dehydrogenase;       
   21::328     1e-27  30%  341 aa  TDH_SHELP RecName: Full=L-threonine 3-dehydrogenase;       
    1::333     2e-27  31%  350 aa  XYLD_AGRT5 RecName: Full=Putative D-xylulose reductase;       
   20::328     2e-27  30%  341 aa  TDH_ECO24 RecName: Full=L-threonine 3-dehydrogenase;       
    1::329     2e-27  29%  345 aa  TDH_ANASK RecName: Full=L-threonine 3-dehydrogenase;       
   20::328     5e-27  29%  341 aa  TDH_SHIDS RecName: Full=L-threonine 3-dehydrogenase;       
    1::329     5e-27  29%  345 aa  TDH_ANAD2 RecName: Full=L-threonine 3-dehydrogenase;       
    6::343     6e-27  25%  343 aa  IDND_ECOLI RecName: Full=L-idonate 5-dehydrogenase;       
    1::224     1e-26  34%  340 aa  TDH_XANCP RecName: Full=L-threonine 3-dehydrogenase;       
    1::224     1e-26  34%  340 aa  TDH_XANCB RecName: Full=L-threonine 3-dehydrogenase;       
    1::224     1e-26  34%  340 aa  TDH_XANC8 RecName: Full=L-threonine 3-dehydrogenase;       
   29::293     1e-26  32%  343 aa  TDH_VIBVU RecName: Full=L-threonine 3-dehydrogenase;       
    1::292     1e-26  34%  345 aa  TDH_PROAC RecName: Full=L-threonine 3-dehydrogenase;       
   29::293     1e-26  32%  343 aa  TDH_VIBVY RecName: Full=L-threonine 3-dehydrogenase;       
   21::328     1e-26  29%  341 aa  TDH_SHEHH RecName: Full=L-threonine 3-dehydrogenase;       
    1::291     1e-26  29%  340 aa  TDH_PSEA6 RecName: Full=L-threonine 3-dehydrogenase;       
   21::291     2e-26  30%  341 aa  TDH_SHEPA RecName: Full=L-threonine 3-dehydrogenase;       
   23::293     4e-26  31%  343 aa  TDH_VIBF1 RecName: Full=L-threonine 3-dehydrogenase;       
   18::327     4e-26  30%  341 aa  TDH_SOLUE RecName: Full=L-threonine 3-dehydrogenase;       
   23::293     7e-26  31%  343 aa  TDH_VIBFM RecName: Full=L-threonine 3-dehydrogenase;       
    1::267     2e-25  28%  337 aa  ADH1_ZYMMO RecName: Full=Alcohol dehydrogenase 1;       
   23::293     3e-25  30%  343 aa  TDH_VIBSL RecName: Full=L-threonine 3-dehydrogenase;       
   28::333     3e-25  30%  342 aa  TDH_PARUW RecName: Full=L-threonine 3-dehydrogenase;       
   24::321     3e-25  29%  340 aa  DOIAD_MICEC RecName: Full=2-deoxy-scyllo-inosamine dehydrogenase;  
   19::354     3e-25  30%  358 aa  YDJL_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
   23::293     3e-25  30%  343 aa  TDH_ALISL RecName: Full=L-threonine 3-dehydrogenase;       
   23::293     6e-25  29%  343 aa  TDH_PHOPR RecName: Full=L-threonine 3-dehydrogenase;       
    4::335     6e-25  29%  347 aa  ADH_SULTO RecName: Full=NAD-dependent alcohol dehydrogenase;       
    4::325     2e-24  27%  339 aa  ADH2_BACST RecName: Full=Alcohol dehydrogenase;         Short=ADH; 
    1::328     6e-24  28%  348 aa  XYLD_RHILO RecName: Full=Putative D-xylulose reductase;       
    1::224     4e-23  31%  336 aa  ADHP_ECOLI RecName: Full=Alcohol dehydrogenase,
   10::351     7e-23  32%  353 aa  YPHC_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
    1::329     9e-23  28%  345 aa  TDH_ANADE RecName: Full=L-threonine 3-dehydrogenase;       
    1::386     1e-22  28%  412 aa  YBDR_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
    3::328     1e-21  27%  346 aa  XYLD_RHIME RecName: Full=Putative D-xylulose reductase;       
    1::316     4e-21  27%  346 aa  BDHA_BACSU RecName: Full=(R,R)-butanediol dehydrogenase;       
    1::243     7e-21  28%  336 aa  ADH_STAAW RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
    1::243     7e-21  28%  336 aa  ADH_STAAS RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
    1::243     7e-21  28%  336 aa  ADH_STAAR RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
    1::243     7e-21  28%  336 aa  ADH_STAAN RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
    1::243     7e-21  28%  336 aa  ADH_STAAM RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
    1::243     7e-21  28%  336 aa  ADH_STAAC RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
    1::243     7e-21  28%  336 aa  ADH_STAAB RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
    1::243     7e-21  28%  336 aa  ADH_STAA8 RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
    1::243     7e-21  28%  336 aa  ADH_STAA3 RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
    6::335     1e-20  28%  347 aa  ADH_SULSR RecName: Full=NAD-dependent alcohol dehydrogenase;       
   11::314     1e-20  25%  348 aa  ADH1_KLUMA RecName: Full=Alcohol dehydrogenase 1;       
    6::347     2e-20  25%  363 aa  XYL2_PICST RecName: Full=D-xylulose reductase;       
    1::269     2e-20  29%  337 aa  ADH1_BACST RecName: Full=Alcohol dehydrogenase;       
    1::227     3e-20  32%  339 aa  ADH3_BACST RecName: Full=Alcohol dehydrogenase;       
    5::363     6e-20  25%  366 aa  ADH_RALEU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
    1::243     6e-19  28%  340 aa  ADH_STAEQ RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
    1::243     8e-19  27%  340 aa  ADH_STAES RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   11::147     1e-18  37%  351 aa  ADH5_YEAST RecName: Full=Alcohol dehydrogenase 5;       
   11::147     1e-18  37%  351 aa  ADH5_SACPS RecName: Full=Alcohol dehydrogenase 5;       
   11::374     2e-18  27%  375 aa  ADH6_PERMA RecName: Full=Alcohol dehydrogenase 6;       
   12::362     3e-18  25%  375 aa  ADHL_GADMO RecName: Full=Alcohol dehydrogenase class-3 chain L;    
    1::317     4e-18  29%  342 aa  TDH_SILPO RecName: Full=L-threonine 3-dehydrogenase;       
    6::133     5e-18  37%  347 aa  ADH_SULSO RecName: Full=NAD-dependent alcohol dehydrogenase;       
   30::376     2e-17  28%  378 aa  ADHB_BACSU RecName: Full=Uncharacterized zinc-type alcohol
   12::388     2e-17  26%  390 aa  FADH_METMR RecName: Full=S-(hydroxymethyl)glutathione
   23::344     2e-17  25%  360 aa  FADH_AMYME RecName: Full=NAD/mycothiol-dependent formaldehyde
   15::243     2e-17  35%  382 aa  BDH1_YEAST RecName: Full=(R,R)-butanediol dehydrogenase;       
   37::411     3e-17  29%  423 aa  YHG1_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
    6::263     6e-17  28%  340 aa  ADHA_RHIME RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   13::379     1e-16  27%  379 aa  ADHP_RABIT RecName: Full=Alcohol dehydrogenase class-2 isozyme 1;  
   15::234     1e-16  28%  381 aa  FADH_CANMA RecName: Full=S-(hydroxymethyl)glutathione
   33::281     1e-16  26%  375 aa  CADH3_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 3;        
   38::362     2e-16  27%  375 aa  ADH4_KLULA RecName: Full=Alcohol dehydrogenase 4, mitochondrial;   
   13::376     3e-16  27%  376 aa  ADHX_SPAAU RecName: Full=Alcohol dehydrogenase class-3;       
   13::363     3e-16  26%  376 aa  ADHX_MYXGL RecName: Full=Alcohol dehydrogenase class-3;       
   51::273     4e-16  36%  408 aa  YYCR_BACSU RecName: Full=Uncharacterized zinc-type alcohol
   26::144     4e-16  33%  350 aa  ADH1_EMENI RecName: Full=Alcohol dehydrogenase 1;       
   40::157     5e-16  38%  363 aa  CADH6_ARATH RecName: Full=Probable cinnamyl alcohol dehydrogenase
   15::217     6e-16  33%  386 aa  FADH_YEAST RecName: Full=S-(hydroxymethyl)glutathione
   11::242     6e-16  28%  374 aa  ADHX_HORSE RecName: Full=Alcohol dehydrogenase class-3;       
   18::375     8e-16  28%  375 aa  ADH1B_PAPHA RecName: Full=Alcohol dehydrogenase 1B;       
   18::375     8e-16  28%  375 aa  ADH1B_PANTR RecName: Full=Alcohol dehydrogenase 1B;       
   31::376     1e-15  26%  390 aa  ADHL7_ARATH RecName: Full=Alcohol dehydrogenase-like 7;       
   28::381     1e-15  30%  381 aa  ADHL6_ARATH RecName: Full=Alcohol dehydrogenase-like 6;       
   12::366     1e-15  27%  379 aa  ADH4_STRCA RecName: Full=Alcohol dehydrogenase 4;       
   13::374     1e-15  27%  374 aa  ADH1S_HORSE RecName: Full=Alcohol dehydrogenase S chain;       
   33::282     1e-15  26%  376 aa  CADH2_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 2;        
   18::375     1e-15  28%  375 aa  ADH1B_HUMAN RecName: Full=Alcohol dehydrogenase 1B;       
    6::355     2e-15  25%  360 aa  DHSO_SCHPO RecName: Full=Putative sorbitol dehydrogenase;       
   14::146     2e-15  41%  346 aa  ADHC_MYCTU RecName: Full=NADP-dependent alcohol dehydrogenase C;   
   14::146     2e-15  41%  346 aa  ADHC_MYCBO RecName: Full=NADP-dependent alcohol dehydrogenase C;   
   23::374     2e-15  27%  374 aa  ADH7_RAT RecName: Full=Alcohol dehydrogenase class 4 mu/sigma
   10::372     2e-15  26%  378 aa  ADHX_PEA RecName: Full=Alcohol dehydrogenase class-3;       
   16::356     3e-15  26%  375 aa  ADHB_MYCTU RecName: Full=Alcohol dehydrogenase B;       
   16::356     3e-15  26%  375 aa  ADHB_MYCBO RecName: Full=Alcohol dehydrogenase B;       
   13::362     3e-15  26%  375 aa  ADH1A_HUMAN RecName: Full=Alcohol dehydrogenase 1A;       
   17::361     4e-15  28%  374 aa  ADH1_ALLMI RecName: Full=Alcohol dehydrogenase 1;       
   11::249     5e-15  28%  379 aa  ADHX_ARATH RecName: Full=Alcohol dehydrogenase class-3;       
   12::117     7e-15  33%  375 aa  ADHH_GADMO RecName: Full=Alcohol dehydrogenase class-3 chain H;    
   38::167     1e-14  34%  375 aa  ADH3_YEAST RecName: Full=Alcohol dehydrogenase 3, mitochondrial;   
   13::369     2e-14  27%  381 aa  ADHX_MAIZE RecName: Full=Alcohol dehydrogenase class-3;       
   12::316     2e-14  27%  351 aa  ADH2_CAEEL RecName: Full=Alcohol dehydrogenase 2;       
   39::155     2e-14  35%  359 aa  MTDH_MEDSA RecName: Full=Probable mannitol dehydrogenase;       
   15::369     4e-14  23%  381 aa  ADHX_ORYSJ RecName: Full=Alcohol dehydrogenase class-3;       
   15::369     4e-14  23%  381 aa  ADHX_ORYSI RecName: Full=Alcohol dehydrogenase class-3;       
   14::117     4e-14  32%  379 aa  ADHX_DROME RecName: Full=Alcohol dehydrogenase class-3;       
   13::369     4e-14  26%  379 aa  ADHQ_RABIT RecName: Full=Alcohol dehydrogenase class-2 isozyme 2;  
    6::355     5e-14  28%  366 aa  XYLB_PSEPU RecName: Full=Aryl-alcohol dehydrogenase;       
   13::112     5e-14  36%  373 aa  ADH8_RANPE RecName: Full=NADP-dependent alcohol dehydrogenase;     
   14::374     5e-14  26%  380 aa  ADH1_PEA RecName: Full=Alcohol dehydrogenase 1;         EC=1.1.1.1;
   37::280     6e-14  29%  355 aa  CADH1_ARATH RecName: Full=Probable cinnamyl alcohol dehydrogenase
   15::177     6e-14  35%  417 aa  BDH2_YEAST RecName: Full=Probable (R,R)-butanediol dehydrogenase 2;
   13::374     6e-14  24%  374 aa  ADH7_HUMAN RecName: Full=Alcohol dehydrogenase class 4 mu/sigma
   18::219     8e-14  27%  350 aa  ADH_SCHPO RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   11::128     8e-14  34%  378 aa  ADHX_OCTVU RecName: Full=Alcohol dehydrogenase class-3;       
   13::375     1e-13  27%  375 aa  ADH1E_HORSE RecName: Full=Alcohol dehydrogenase E chain;       
   13::373     1e-13  26%  379 aa  ADH3_HORVU RecName: Full=Alcohol dehydrogenase 3;       
    6::356     2e-13  26%  369 aa  FRMA_SYNY3 RecName: Full=S-(hydroxymethyl)glutathione
   49::158     2e-13  44%  379 aa  CADH7_ORYSJ RecName: Full=Cinnamyl alcohol dehydrogenase 7;        
   11::116     2e-13  31%  374 aa  ADHX_BOVIN RecName: Full=Alcohol dehydrogenase class-3;       
   13::113     2e-13  34%  375 aa  ADH1_GEOAT RecName: Full=Alcohol dehydrogenase 1;       
   13::113     2e-13  34%  375 aa  ADH1_GEOKN RecName: Full=Alcohol dehydrogenase 1;       
   24::143     3e-13  37%  349 aa  YAHK_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
   11::242     3e-13  28%  374 aa  ADHX_HUMAN RecName: Full=Alcohol dehydrogenase class-3;       
   11::375     3e-13  27%  375 aa  ADH6_PONAB RecName: Full=Alcohol dehydrogenase 6;       
   14::374     3e-13  25%  380 aa  ADH1_TRIRP RecName: Full=Alcohol dehydrogenase 1;       
   13::363     3e-13  28%  376 aa  ADH1_CHICK RecName: Full=Alcohol dehydrogenase 1;       
   10::125     4e-13  31%  373 aa  ADHX_UROHA RecName: Full=Alcohol dehydrogenase class-3;       
   33::219     4e-13  29%  352 aa  ADH3_EMENI RecName: Full=Alcohol dehydrogenase 3;       
   35::113     5e-13  42%  359 aa  CADH8_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 8;        
    6::362     7e-13  22%  375 aa  FADH_PARDE RecName: Full=S-(hydroxymethyl)glutathione
   22::116     7e-13  33%  378 aa  FADH1_SCHPO RecName: Full=Probable S-(hydroxymethyl)glutathione
   35::158     7e-13  36%  360 aa  ADH6_YEAST RecName: Full=NADP-dependent alcohol dehydrogenase 6;   
   13::112     7e-13  33%  375 aa  ADH1_GEOBU RecName: Full=Alcohol dehydrogenase 1;       
   11::361     9e-13  25%  374 aa  ADHX_RABIT RecName: Full=Alcohol dehydrogenase class-3;       
   11::116     9e-13  30%  374 aa  ADHX_MOUSE RecName: Full=Alcohol dehydrogenase class-3;       
   39::156     1e-12  34%  360 aa  CADH9_ARATH RecName: Full=Probable cinnamyl alcohol dehydrogenase
   35::152     1e-12  35%  357 aa  CADH7_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 7;        
   11::116     1e-12  30%  374 aa  ADHX_RAT RecName: Full=Alcohol dehydrogenase class-3;       
   13::250     1e-12  26%  379 aa  ADH2_ORYSJ RecName: Full=Alcohol dehydrogenase 2;       
   13::250     1e-12  26%  379 aa  ADH2_ORYSI RecName: Full=Alcohol dehydrogenase 2;       
   13::112     1e-12  33%  375 aa  ADH1A_PONAB RecName: Full=Alcohol dehydrogenase 1A;       
   25::116     2e-12  34%  380 aa  FADH2_SCHPO RecName: Full=Putative S-(hydroxymethyl)glutathione
   42::157     2e-12  39%  366 aa  CADH3_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase
    1::131     2e-12  30%  344 aa  ADH_SULAC RecName: Full=NAD-dependent alcohol dehydrogenase;       
   13::377     2e-12  29%  377 aa  ADH4_RAT RecName: Full=Alcohol dehydrogenase 4;       
   12::362     2e-12  27%  375 aa  ADH1_COTJA RecName: Full=Alcohol dehydrogenase 1;       
   26::153     3e-12  32%  357 aa  CADH_PINTA RecName: Full=Probable cinnamyl alcohol dehydrogenase;  
   26::153     3e-12  32%  357 aa  CADH_PINRA RecName: Full=Probable cinnamyl alcohol dehydrogenase;  
   18::383     3e-12  23%  389 aa  ADHL5_ARATH RecName: Full=Alcohol dehydrogenase-like 5;       
   21::142     3e-12  32%  349 aa  ADH1_CAEEL RecName: Full=Alcohol dehydrogenase 1;       
   25::359     3e-12  26%  369 aa  FRMA_ECOSM RecName: Full=S-(hydroxymethyl)glutathione
   21::147     3e-12  37%  354 aa  CADH5_ORYSJ RecName: Full=Putative cinnamyl alcohol dehydrogenase
   25::359     4e-12  26%  369 aa  FRMA_ECOUT RecName: Full=S-(hydroxymethyl)glutathione
   25::359     4e-12  26%  369 aa  FRMA_ECOL5 RecName: Full=S-(hydroxymethyl)glutathione
   25::359     4e-12  26%  369 aa  FRMA_ECOK1 RecName: Full=S-(hydroxymethyl)glutathione
   11::113     4e-12  30%  368 aa  ADH6_HUMAN RecName: Full=Alcohol dehydrogenase 6;       
   14::217     4e-12  26%  350 aa  ADH1_ASPFN RecName: Full=Alcohol dehydrogenase 1;       
   25::359     6e-12  26%  369 aa  FRMA_SHISS RecName: Full=S-(hydroxymethyl)glutathione
   25::359     6e-12  26%  369 aa  FRMA_ECOLC RecName: Full=S-(hydroxymethyl)glutathione
   25::359     6e-12  26%  369 aa  FRMA_ECOHS RecName: Full=S-(hydroxymethyl)glutathione
   25::359     6e-12  26%  369 aa  FRMA_ECO57 RecName: Full=S-(hydroxymethyl)glutathione
   25::359     6e-12  26%  369 aa  FRMA_ECO24 RecName: Full=S-(hydroxymethyl)glutathione
   13::375     6e-12  29%  375 aa  ADH1_MOUSE RecName: Full=Alcohol dehydrogenase 1;       
   13::112     6e-12  34%  375 aa  ADH1G_HUMAN RecName: Full=Alcohol dehydrogenase 1C;       
   28::382     7e-12  22%  388 aa  ADHL1_ARATH RecName: Full=Alcohol dehydrogenase-like 1;       
   25::359     1e-11  26%  369 aa  FRMA_ECOL6 RecName: Full=S-(hydroxymethyl)glutathione
   13::369     1e-11  25%  373 aa  ADH2_HORVU RecName: Full=Alcohol dehydrogenase 2;       
   11::112     1e-11  37%  376 aa  ADH1_RAT RecName: Full=Alcohol dehydrogenase 1;       
   79::167     1e-11  42%  422 aa  YL498_MIMIV RecName: Full=Probable zinc-type alcohol
   37::150     1e-11  40%  360 aa  CADH6_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase
   28::142     2e-11  34%  339 aa  YJGB_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
   25::359     2e-11  26%  369 aa  FRMA_ECOLI RecName: Full=S-(hydroxymethyl)glutathione
   13::249     2e-11  26%  379 aa  ADH2_MAIZE RecName: Full=Alcohol dehydrogenase 2;       
   11::226     2e-11  29%  367 aa  ADH2_EMENI RecName: Full=Alcohol dehydrogenase 2;       
   18::375     2e-11  26%  375 aa  ADH1_RABIT RecName: Full=Alcohol dehydrogenase 1;       
   32::148     2e-11  31%  354 aa  MTDH1_STYHU RecName: Full=Probable mannitol dehydrogenase 1;       
   15::351     2e-11  26%  351 aa  ADH_MYCPN RecName: Full=Probable NADP-dependent alcohol
   13::377     2e-11  24%  379 aa  ADH1_ARATH RecName: Full=Alcohol dehydrogenase class-P;       
   16::133     4e-11  35%  337 aa  MTDH_PETCR RecName: Full=Mannitol dehydrogenase;       
   37::120     4e-11  36%  359 aa  MTDH_FRAAN RecName: Full=Probable mannitol dehydrogenase;       
   10::95      6e-11  39%   97 aa  DHSO_PIG RecName: Full=Sorbitol dehydrogenase;       
   14::136     6e-11  31%  380 aa  ADH_MALDO RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   13::155     6e-11  25%  379 aa  ADH1_HORVU RecName: Full=Alcohol dehydrogenase 1;       
   12::112     6e-11  33%  375 aa  ADH1_GADCA RecName: Full=Alcohol dehydrogenase 1;       
   12::375     6e-11  27%  375 aa  ADH1B_UROHA RecName: Full=Alcohol dehydrogenase 1B;       
   34::368     1e-10  26%  378 aa  FRMA_HAEIN RecName: Full=S-(hydroxymethyl)glutathione
   13::244     1e-10  27%  379 aa  ADHX_DICDI RecName: Full=Alcohol dehydrogenase class-3;       
   15::119     1e-10  32%  386 aa  ADHL2_ARATH RecName: Full=Alcohol dehydrogenase-like 2;       
   13::380     1e-10  26%  380 aa  ADH4_HUMAN RecName: Full=Alcohol dehydrogenase 4;       
   13::155     1e-10  26%  379 aa  ADH1_PENAM RecName: Full=Alcohol dehydrogenase 1;       
   40::158     1e-10  33%  361 aa  MTDH_MESCR RecName: Full=Probable mannitol dehydrogenase;       
   40::157     1e-10  31%  363 aa  MTDH3_STYHU RecName: Full=Probable mannitol dehydrogenase 3;       
   12::115     1e-10  31%  394 aa  ADHL3_ARATH RecName: Full=Alcohol dehydrogenase-like 3;       
   11::112     1e-10  33%  375 aa  ADH1_PERMA RecName: Full=Alcohol dehydrogenase 1;       
   36::279     2e-10  26%  354 aa  CADH4_ORYSJ RecName: Full=Putative cinnamyl alcohol dehydrogenase
   37::186     2e-10  35%  399 aa  FADH_PSEPU RecName: Full=Glutathione-independent formaldehyde
   37::115     2e-10  38%  399 aa  FADH_PSEAE RecName: Full=Glutathione-independent formaldehyde
   22::377     2e-10  27%  377 aa  ADH4_MOUSE RecName: Full=Alcohol dehydrogenase 4;       
   13::155     2e-10  26%  379 aa  ADH1_MAIZE RecName: Full=Alcohol dehydrogenase 1;       
   37::296     3e-10  23%  374 aa  ADH3_KLULA RecName: Full=Alcohol dehydrogenase 3, mitochondrial;   
   13::155     3e-10  25%  379 aa  ADH1_ORYSJ RecName: Full=Alcohol dehydrogenase 1;       
   13::155     3e-10  25%  379 aa  ADH1_ORYSI RecName: Full=Alcohol dehydrogenase 1;       
   17::137     4e-10  36%  325 aa  YBJB_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
    6::363     4e-10  22%  376 aa  ADHI_RHOS4 RecName: Full=Alcohol dehydrogenase class-3;       
   13::375     4e-10  26%  375 aa  ADH1A_MACMU RecName: Full=Alcohol dehydrogenase 1A;       
   14::136     5e-10  29%  380 aa  ADH_FRAAN RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   14::136     5e-10  29%  380 aa  ADH3_SOLTU RecName: Full=Alcohol dehydrogenase 3;       
   14::136     5e-10  29%  380 aa  ADH2_SOLTU RecName: Full=Alcohol dehydrogenase 2;       
   14::136     7e-10  29%  380 aa  ADH2_SOLLC RecName: Full=Alcohol dehydrogenase 2;       
   14::136     7e-10  29%  380 aa  ADH1_SOLTU RecName: Full=Alcohol dehydrogenase 1;       
    8::170     7e-10  28%  348 aa  ADH1_PICST RecName: Full=Alcohol dehydrogenase 1;       
   14::275     7e-10  22%  353 aa  ADH1_NEUCR RecName: Full=Alcohol dehydrogenase 1;       
   35::154     9e-10  34%  361 aa  ADH7_YEAST RecName: Full=NADP-dependent alcohol dehydrogenase 7;   
   15::118     9e-10  27%  382 aa  ADH1_PETHY RecName: Full=Alcohol dehydrogenase 1;       
   11::218     1e-09  24%  348 aa  ADH2_KLULA RecName: Full=Alcohol dehydrogenase 2;       
   29::274     2e-09  25%  329 aa  QOR_PIG RecName: Full=Quinone oxidoreductase;       
   25::356     2e-09  24%  369 aa  FRMA_PASPI RecName: Full=S-(hydroxymethyl)glutathione
   26::141     2e-09  31%  348 aa  ADH2_YEAST RecName: Full=Alcohol dehydrogenase 2;       
   10::141     2e-09  31%  348 aa  ADH2_CANAL RecName: Full=Alcohol dehydrogenase 2;       
   29::266     3e-09  27%  329 aa  QOR_HUMAN RecName: Full=Quinone oxidoreductase;       
   34::151     3e-09  33%  359 aa  CAD8A_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase
   15::306     3e-09  25%  361 aa  FDEH_PSEPU RecName: Full=5-exo-alcohol dehydrogenase;       
   19::247     4e-09  26%  329 aa  QOR_CAVPO RecName: Full=Quinone oxidoreductase;       
   26::141     4e-09  30%  348 aa  ADH2_PICST RecName: Full=Alcohol dehydrogenase 2;       
   52::124     6e-09  41%  417 aa  VAT1L_MOUSE RecName: Full=Synaptic vesicle membrane protein VAT-1
   23::151     8e-09  36%  349 aa  ADHA_BACSU RecName: Full=Probable formaldehyde dehydrogenase adhA; 
   28::272     8e-09  25%  350 aa  ADH1_CANAL RecName: Full=Alcohol dehydrogenase 1;       
   36::279     1e-08  25%  354 aa  CADH1_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase
   17::362     1e-08  27%  375 aa  ADH1A_UROHA RecName: Full=Alcohol dehydrogenase 1A;       
   54::126     1e-08  41%  419 aa  VAT1L_HUMAN RecName: Full=Synaptic vesicle membrane protein VAT-1
   13::337     1e-08  21%  350 aa  ADH1_KLULA RecName: Full=Alcohol dehydrogenase 1;       
   18::243     1e-08  28%  375 aa  ADH1G_PAPHA RecName: Full=Alcohol dehydrogenase 1C;       
   19::208     2e-08  29%  330 aa  QOR_BOVIN RecName: Full=Zeta-crystallin;
  109::226     2e-08  36%  439 aa  CAD8C_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase
   19::266     4e-08  26%  329 aa  QOR_PONAB RecName: Full=Quinone oxidoreductase;       
   39::286     4e-08  28%  365 aa  MTDH_APIGR RecName: Full=Mannitol dehydrogenase;       
   34::148     4e-08  36%  362 aa  CADH9_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase
   34::134     4e-08  35%  362 aa  CAD8D_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase
  109::213     4e-08  34%  436 aa  CAD8B_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase
   26::141     4e-08  29%  348 aa  ADH1_YEAST RecName: Full=Alcohol dehydrogenase 1;       
   17::82      5e-08  41%  319 aa  TERPD_PSESP RecName: Full=Probable alcohol dehydrogenase;       
   26::153     6e-08  28%  357 aa  CADH7_PICAB RecName: Full=Probable cinnamyl alcohol dehydrogenase
   26::153     6e-08  28%  357 aa  CADH2_PICAB RecName: Full=Probable cinnamyl alcohol dehydrogenase
    1::254     8e-08  26%  329 aa  YOGA_BACSU RecName: Full=Uncharacterized zinc-type alcohol
    1::212     1e-07  30%  335 aa  ZDH1_STAAR RecName: Full=Zinc-type alcohol dehydrogenase-like
   21::375     1e-07  26%  375 aa  ADH1_RANPE RecName: Full=Alcohol dehydrogenase 1;       
   13::113     1e-07  31%  375 aa  ADH1_APTAU RecName: Full=Alcohol dehydrogenase 1;       
   26::167     2e-07  28%  355 aa  CADH_EUCBO RecName: Full=Probable cinnamyl alcohol dehydrogenase;  
    1::208     3e-07  30%  333 aa  ZDH1_STAAC RecName: Full=Zinc-type alcohol dehydrogenase-like
   19::266     3e-07  25%  330 aa  QOR_LAMGU RecName: Full=Quinone oxidoreductase;       
   39::155     3e-07  29%  360 aa  GEDH1_OCIBA RecName: Full=Geraniol dehydrogenase 1;       
   26::158     3e-07  27%  356 aa  CADH_EUCGL RecName: Full=Probable cinnamyl alcohol dehydrogenase;  
   26::158     3e-07  27%  354 aa  CADH1_EUCGU RecName: Full=Probable cinnamyl alcohol dehydrogenase
    1::212     4e-07  29%  335 aa  ZDH1_STAAW RecName: Full=Zinc-type alcohol dehydrogenase-like
    1::212     4e-07  29%  335 aa  ZDH1_STAAS RecName: Full=Zinc-type alcohol dehydrogenase-like
    1::212     4e-07  29%  335 aa  ZDH1_STAAN RecName: Full=Zinc-type alcohol dehydrogenase-like
    1::212     4e-07  29%  335 aa  ZDH1_STAAM RecName: Full=Zinc-type alcohol dehydrogenase-like
   26::158     4e-07  26%  356 aa  CADH2_EUCGU RecName: Full=Probable cinnamyl alcohol dehydrogenase
   11::376     4e-07  26%  376 aa  ADH6_RAT RecName: Full=Alcohol dehydrogenase 6;         EC=1.1.1.1;
   30::348     5e-07  26%  350 aa  QORL2_MOUSE RecName: Full=Quinone oxidoreductase-like protein 2;   
   26::158     5e-07  26%  360 aa  CADH1_ARACO RecName: Full=Probable cinnamyl alcohol dehydrogenase
   12::111     5e-07  28%  374 aa  ADH1_STRCA RecName: Full=Alcohol dehydrogenase 1;       
   17::338     7e-07  23%  360 aa  ADH1_ENTHI RecName: Full=NADP-dependent alcohol dehydrogenase;     
   20::203     9e-07  32%  340 aa  QOR_LEIAM RecName: Full=Probable quinone oxidoreductase;       
   30::348     9e-07  27%  350 aa  QORL2_RAT RecName: Full=Quinone oxidoreductase-like protein 2;     
   25::208     2e-06  29%  336 aa  ZDH1_STAES RecName: Full=Zinc-type alcohol dehydrogenase-like
   25::208     2e-06  29%  336 aa  ZDH1_STAEQ RecName: Full=Zinc-type alcohol dehydrogenase-like
   19::200     2e-06  29%  331 aa  QOR_MOUSE RecName: Full=Quinone oxidoreductase;       
   57::273     3e-06  26%  377 aa  ZADH2_HUMAN RecName: Full=Zinc-binding alcohol dehydrogenase
   19::213     3e-06  26%  329 aa  QOR_RAT RecName: Full=Quinone oxidoreductase;       
   13::244     3e-06  26%  379 aa  FADH_PICPA RecName: Full=S-(hydroxymethyl)glutathione
   57::273     4e-06  26%  377 aa  ZADH2_BOVIN RecName: Full=Zinc-binding alcohol dehydrogenase
   30::215     4e-06  26%  346 aa  YGD6_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
   25::263     5e-06  26%  327 aa  QOR_SALTY RecName: Full=Quinone oxidoreductase;       
   23::117     5e-06  26%  384 aa  ADHX_CAEEL RecName: Full=Alcohol dehydrogenase class-3;       
   12::113     6e-06  29%  375 aa  ADH1_NAJNA RecName: Full=Alcohol dehydrogenase 1;       
   21::220     1e-05  27%  425 aa  YGGP_ECOLI RecName: Full=Uncharacterized protein yggP;
   37::327     1e-05  23%  341 aa  TARJ_BACSU RecName: Full=Putative ribitol-5-phosphate
   23::374     1e-05  23%  374 aa  ADH7_MOUSE RecName: Full=Alcohol dehydrogenase class 4 mu/sigma
   57::273     2e-05  26%  377 aa  ZADH2_MOUSE RecName: Full=Zinc-binding alcohol dehydrogenase
   94::237     2e-05  29%  484 aa  VAT1_DANRE RecName: Full=Synaptic vesicle membrane protein VAT-1
   23::139     3e-05  40%  330 aa  YHFP_BACSU RecName: Full=Putative quinone oxidoreductase yhfP;     
   11::141     3e-05  28%  348 aa  ADH2_KLUMA RecName: Full=Alcohol dehydrogenase 2;       
   26::158     4e-05  26%  357 aa  CADH_POPDE RecName: Full=Probable cinnamyl alcohol dehydrogenase;  
   22::114     9e-05  26%  380 aa  ADHL4_ARATH RecName: Full=Alcohol dehydrogenase-like 4;       
  266::400     1e-04  34%  562 aa  MAO1_SHEWM RecName: Full=NAD-dependent malic enzyme;       
   47::190     3e-04  28%  379 aa  VAT1_TORCA RecName: Full=Synaptic vesicle membrane protein VAT-1;  
 1851::1951    3e-04  34% 2513 aa  PKS7_DICDI RecName: Full=Probable polyketide synthase 7;       
    5::111     3e-04  31%  361 aa  DHG_THEAC RecName: Full=Glucose 1-dehydrogenase;       
 1821::1954    6e-04  30% 2512 aa  PKS5_DICDI RecName: Full=Probable polyketide synthase 5;       
   24::114     0.001  32%  352 aa  RT4I1_DICDI RecName: Full=Reticulon-4-interacting protein 1
 1854::1954    0.001  33% 2931 aa  PKS9_DICDI RecName: Full=Probable polyketide synthase 9/36;       
 1856::1956    0.001  33% 2514 aa  PKS8_DICDI RecName: Full=Probable polyketide synthase 8/35;       
   33::108     0.001  31%  357 aa  MECR_DROME RecName: Full=Probable trans-2-enoyl-CoA reductase,
    1::339

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKSIVIEKPNTLTIETRALPQPAPGEVRIKVKLAGICGSDSHIYRGHNPFAKYPRVIGHEFFGVIDAVGD
RSPB_ECOLI      MKSILIEKPNQLAIVEREIPTPSAGEVRVKVKLAGICGSDSHIYRGHNPFAKYPRVIGHEFFGVIDAVGE
YJMD_BACSU      MKAVQVRKAYDLTAEVKKPVLSKDDEVLVKVKRVGICGSDMHIYHGTNPLATLPRVIGHEVTGQVEAVGA
Y053_HAEIN      IKAICLEKPNNVVVKEVPYPEKSDNDVLIQVESMGICGSDIGAYRGTNPLVTYPRILGHEIVGRVIESGI
YDJJ_ECOLI      ----ILQVPGTMKIISAEIPVPKEDEVLIKVEYVGICGSDVHGFES-GPFIKDPNQLGHECAGTVVAVGS
DHSO_BACSU      MKAAVMHNTREIKIETLPVPDINHDEVLIKVMAVGICGSDLHYYRIGNYVVEKPFILGHECAGEIAAVGS
IDND_VITVI      ----------TLKIQPYILPSLGPYDVKVRIKAVGICGSDVHHFRCANFIVKKPMVIGHECAGIIEEVGS
DOIAD_STRFR     MKALVFEAPERAVLTHRDIPAPAPGEALVRVAYNSVCGSDLSFYKGVWHGFTYPVVPGHEWSGSVVDVNG
TDH_THET8       -----------LTLVDRPVPEPGPGEILVRVEAASICGTDLHIWKWDRGRIRPPLVTGHEFSGVVEAVGP
TDH_THET2       -----------LTLVDRPVPEPGPGEILVRVEAASICGTDLHIWKWDRGRIRPPLVTGHEFSGVVEAVGP
TDH_COXBU       -------------------PKPGRDEVLIKIKKTAICGTDLHIYKWDEWAQKVPMHVGHEFVGEIVEVGE
TDH_COXBR       -------------------PKPGRDEVLIKIKKTAICGTDLHIYKWDEWAQKVPMHVGHEFVGEIVEVGE
TDH_COXBN       -------------------PKPGRDEVLIKIKKTAICGTDLHIYKWDEWAQKVPMHVGHEFVGEIVEVGE
TDH_COXB2       -------------------PKPGRDEVLIKIKKTAICGTDLHIYKWDEWAQKVPMHVGHEFVGEIVEVGE
TDH_ERWCT       ------------------MPELGHNDIMIKIRKSAICGTDVHIYNWDEWSQKVPMVVGHEYVGEIVAIGQ
DHSO_BACHD      MKALVKTQHGTGHFAVQEKPEPTPGQVKIKVKYTGVCGSDIHTYEGHYPVAA-PVTLGHEFSGEIVELGE
TDH_VIBPA       -------------------PEVGHNDILIKIKKTAICGTDVHIYNWDEWSQKVPMVVGHEYVGEVVAIGQ
TDH_BACSU       ------------------IPEIDKHEVLIKVKAASICGTDVHIYNWDQQRIKTPYVFGHEFSGIVEGVGE
TDH_AERS4       -------------------PELGHNDLLIKIRKTAICGTDMHIYNWDEWAQKVPMVVGHEYVGEVVAVGQ
TDH_EDWI9       ------------------VPLPALGDIMIKIRKAAICGTDVHIYNWDTWSQKVPMVVGHEYVGEVVAVGQ
TDH_YERPY       ------------------VPQPELGDIMIKIRKTAICGTDVHIYNWDEWSQKVPMVVGHEYVGEVVAIGQ
TDH_YERPS       ------------------VPQPELGDIMIKIRKTAICGTDVHIYNWDEWSQKVPMVVGHEYVGEVVAIGQ
TDH_YERPP       ------------------VPQPELGDIMIKIRKTAICGTDVHIYNWDEWSQKVPMVVGHEYVGEVVAIGQ
TDH_YERPN       ------------------VPQPELGDIMIKIRKTAICGTDVHIYNWDEWSQKVPMVVGHEYVGEVVAIGQ
TDH_YERPG       ------------------VPQPELGDIMIKIRKTAICGTDVHIYNWDEWSQKVPMVVGHEYVGEVVAIGQ
TDH_YERPE       ------------------VPQPELGDIMIKIRKTAICGTDVHIYNWDEWSQKVPMVVGHEYVGEVVAIGQ
TDH_YERPB       ------------------VPQPELGDIMIKIRKTAICGTDVHIYNWDEWSQKVPMVVGHEYVGEVVAIGQ
TDH_YERPA       ------------------VPQPELGDIMIKIRKTAICGTDVHIYNWDEWSQKVPMVVGHEYVGEVVAIGQ
TDH_YERP3       ------------------VPQPELGDIMIKIRKTAICGTDVHIYNWDEWSQKVPMVVGHEYVGEVVAIGQ
TDH_PHOLL       ------------------VPEPELGDVMIKIRKTAICGTDVHIYNWDDWSQKVPMVVGHEYVGEVVAIGQ
TDH_YERE8       ------------------VPQPELGDIMIKIRKTAICGTDVHIYNWDEWSQKVPMVVGHEYVGEVVAIGQ
TDH_THEON       ------------------IPKPGPGEVLIKVLATSICGTDLHIYEW-NEWAKPPQIMGHEVAGEVIEVGP
DOIAD_STRSD     MKALSFEAPGEAVFGTREVPVPAPGEALIHLGYNSICGSDLSLYRGVWHGFSYPVVPGHEWSGTVVEV-N
TDH_MESSB       MKALVKAKPEELWMERVPLPEIGPNDVLIKVRKAAICGTDVHIWNWDEWARKVPLVTGHEFVGEVVDVGS
TDH_AERHH       -------------------PELGHNDLLIKIRKTAICGTDIHIYNWDEWSQKVPMVVGHEYVGEVVAIGQ
TDH_SHEB8       -------------------PKPVMGDLLIKIKKTAICGTDMHIYNWDEWSQKVPMVVGHEYVGEVVDIGQ
TDH_SHESM       -------------------PEMGHNDLLIKIKKTAICGTDMHIYNWDEWSQKVPMVVGHEYVGEVVDIGQ
TDH_SHESA       -------------------PEMGHNDLLIKIKKTAICGTDMHIYNWDEWSQKVPMVVGHEYVGEVVDIGQ
TDH_SHEB9       -------------------PKPVMGDLLIKIKKTAICGTDMHIYNWDEWSQKVPMVVGHEYVGEVVDIGQ
TDH_SHEB5       -------------------PKPVMGDLLIKIKKTAICGTDMHIYNWDEWSQKVPMVVGHEYVGEVVDIGQ
TDH_SHEB2       -------------------PKPVMGDLLIKIKKTAICGTDMHIYNWDEWSQKVPMVVGHEYVGEVVDIGQ
TDH_SHESW       -------------------PKPVMGDLLIKIKKTAICGTDMHIYNWDEWSQKVPMVVGHEYVGEVVDIGQ
TDH_DEIDV       ------------------VPRPGPNDLLIRVKKGSICGTDVHIYKWDEWAQKVPMVVGHEYVGVVAAMGS
DOIAD_STRRY     MKALMFKAPLQAVLTERDVPEPAPGEALVKLAYNSICGSDLSFYKGVWHGFTYPVVPGHEWSGTVVEAGG
TDH_SHESR       -------------------PEMGHNDLLIKIKKTAICGTDMHIYNWDEWSQKVPMVVGHEYVGEVVDIGQ
TDH_SERP5       ------------------VPQPELGDIMIKIRKTAICGTDVHIYNWDEWSQKVPMVVGHEYVGEVVAIGQ
TDH_SHEON       -------------------PEMGHNDLLIKIKKTAICGTDMHIYNWDEWSQKVPMVVGHEYVGEVVDIGQ
DOIAD_STRKN     MKALVFHSPEKATFEQRDVPTPRPGEALVHIAYNSICGSDLSLYRGVWHGFGYPVVPGHEWSGTVVEING
TDH_BACA2       MKAIV-KNENAFGATLKEIPIPSENEVLIKVQAASICGTDVHIYNWDQKRIKTPQVFGHEFSGIVAETGK
TDH_SHEPC       -------------------PEMGHNDLLIKIKKTAICGTDMHIYNWDEWSQKVPMVVGHEYVGEVVDIGQ
TDH_CHRVO       ------------------LPEVGHNDLLIKIVKTAICGTDIHIWNWDEWSQKVPMHVGHEYVGVVAGMGS
YJJN_ECOLI      MNVLICQQPKELVWKQREIPIPGDNEALIKIKSVGICGTDIHAWGGNQPFFSYPRVLGHEICGEIVGLGK
TDH_DEIRA       -------------IETE-VPTPGPNDLLIRIRKGSICGTDVHIYKWDDWASQVPMVVGHEYVGVVAGMGS
TDH_RHIEC       MKALVKSKPEVLWMENVPVPEVGPNDVLIRVKKSAICGTDVHIWNWDQWAQKVPMVVGHEFSGEIAEIGS
TDH_PSEHT       -------------------PEVGHNDLLIKIRKTAICGTDVHIYKWDEWAQKTPMVVGHEYVGEVVDMGQ
TDH_BURPP       MKALALERAPGLTLTDVKKPEVGHNDVMIRITRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_RHILW       MKALVKSKPEVLWMENVPVPEVGPNDVLIRVRKSAICGTDVHIWNWDQWAQKVPMVVGHEFSGEIAEIGS
TDH_RHIL3       MKALVKAKPEVLWMENVPVPEVGPNDVLIRVKKSAICGTDVHIWNWDQWAQKVPMVVGHEFSGEIAEIGS
TDH_BURVG       MKALALERAPGLTLTRVKRPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
DOIAD_STRRI     MKALVFEAPERALLTHRDIPDPAPGEALVRIAYNSVCGSDLSFYKGVWHGSTYPVVPGHEWSGTVVDVNG
TDH_BURP8       MKALALERAPGLTLTRVKKPEVGHNDVMIRITRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_BURM1       MKALALERAPGLTLTRVKRPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_FRATN       ------KQPGIWMIDDAPIPEYGYNDVLIKIKKTAICGTDLHIYKWSQNTIPVPMITGHEFAGEVVAKGD
TDH_BURS3       MKALALERGPGLTLTRVKRPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_FRATW       ------KQPGIWIINDAPIPEYGYNDVLIKIKKTAICGTDLHIYKWSQNTIPVPMITGHEFAGEVVAKGD
TDH_FRATT       ------KQPGIWIINDAPIPEYGYNDVLIKIKKTAICGTDLHIYKWSQNTIPVPMITGHEFAGEVVAKGD
TDH_FRATO       ------KQPGIWMINDAPIPEYGYNDVLIKIKKTAICGTDLHIYKWSQNTIPVPMITGHEFAGEVVAKGD
TDH_FRATM       ------KQPGIWIINDAPIPEYGYNDVLIKIKKTAICGTDLHIYKWSQNTIPVPMITGHEFAGEVVAKGD
TDH_FRATH       ------KQPGIWMINDAPIPEYGYNDVLIKIKKTAICGTDLHIYKWSQNTIPVPMITGHEFAGEVVAKGD
TDH_FRATF       ------KQPGIWMINDAPIPEYGYNDVLIKIKKTAICGTDLHIYKWSQNTIPVPMITGHEFAGEVVAKGD
TDH_FRAT1       ------KQPGIWIINDAPIPEYGYNDVLIKIKKTAICGTDLHIYKWSQNTIPVPMITGHEFAGEVVAKGD
TDH_BURXL       MKALALERAPGLTLTDVKKPEVGHNDVMIRITRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_BURPS       MKALALERGPGLTLTRVKKPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_BURP6       MKALALERGPGLTLTRVKKPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_BURP1       MKALALERGPGLTLTRVKKPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_BURP0       MKALALERGPGLTLTRVKKPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_BURMS       MKALALERGPGLTLTRVKKPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_BURMA       MKALALERGPGLTLTRVKKPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_BURM9       MKALALERGPGLTLTRVKKPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_BURM7       MKALALERGPGLTLTRVKKPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_BURCJ       MKALALERGPGLTLTRVKRPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_BURCH       MKALALERGPGLTLTRVKRPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_BURCC       MKALALERGPGLTLTRVKRPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_BURCA       MKALALERGPGLTLTRVKRPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_SHESH       -------------------PEMGHNDLLIKIRKTAICGTDIHIYNWDEWSQKVPMVVGHEYVGEVIDMGI
TDH_SACEN       -------------LELTELPDPTPGDIVVQVFRTGICGTDLHIDSWDEWAARTPLVIGHEFAGEVVAVGS
TDH_BURTA       MKALALERGPGLTLTRVKKPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_RHISN       MKALVKTKPEVLWMERVPVPEVGPNDVLIRVKKSAICGTDVHIWNWDQWAQKVPMVVGHEFMGEIAEVGS
TDH_COLP3       -------------------PKLGHNDLLIKIKKTAICGTDIHIYNWDEWAQKTPMVVGHEYAGEVVGIGQ
TDH_AGRRK       MKALVKSKPEVLWMEHVPVPEVGPNDVLIRVRKSAICGTDVHIWNWDQWAQKVPMVVGHEFCGEIAEIGS
TDH_SINMW       MRALVKTRPEVLWMERVPVPEVGPNDVLIRVRKSAICGTDVHIWNWDQWAQKVPMVVGHEFMGEIVEVGP
TDH_SHEWM       -------------------PEMGHNDLLIKIRKTAICGTDVHIYNWDENTIPVPMVVGHEYVGEVVDIGQ
TDH_RHIME       MKALVKTKPEVLWMERVPVPEIGPNDVLIRVRKSAICGTDVHIWNWDQWAEKVPMVVGHEFMGEVVEVGP
TDH_RHIE6       MKALVKSKAEVLWMEDVPVPEVGPNDVLIRVKKSAICGTDVHIWNWDQWAQKVPMVVGHEFSGEIAEIGS
TDH_FRAP2       ------KEPGIWMIDDAPMPEYGYNDVLIKIKKTAICGTDLHIYKWSQATIPVPMITGHEFAGEVVAKGN
DHSO_PONAB      --SLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWRIGNFIVKKPMVLGHEASGTVEKVGS
DHSO_BOMMO      ----VLHGANDVRIEKIPVPEINDDEVLIKIDCVGICGSDVKLYSGADVIDK-PIVIGHEGAGTVVKVGD
TDH_BURCM       MKALALERGPGLTLTRVKRPEVGHNDVLIKIHRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
TDH_BURA4       MKALALERGPGLTLTRVKRPEVGHNDVLIKIHRTAICGTDIHIWKWDDWAQKVPMHVGHEYVGEIVEMGQ
DHSO_HUMAN      --SLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWRIGNFIVKKPMVLGHEASGTVEKVGS
TDH_THETN       -------------IVKKEIPKIGPDEVLIKVKATSICGTDVHIYVW-NEWAKSPKTMGHEFVGEVVEIGE
TDH_SHEFN       -------------------PEMGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMIAGHEYVGEVVDVGQ
TDH_BACLD       ----LIKKPGEASFELVPIPKIDKHEVLIKVKAASICGTDVHIYNWDESRVKPPYVFGHEFSGEVVQVGE
TDH_PYRHO       ------------------VPKPGPGEVLIKVLATSICGTDLHIYEW-NEWAKPPQIMGHXXXXXXXXXXX
TDH_IDILO       -------------------PECGYNDLLIKIKKTAICGTDVHIYKWDDWSQKVPMVVGHEYVGEVAAMGD
TDH_RHILO       MKALVKAKAEPIWMEEVPVPEIGPNDVLIKIRKTAICGTDVHIYNWDQWAQKVPMVTGHEFVGTVADFGA
TDH_PECCP       -------------------PELGHNDIMIKIRKSAICGTDVHIYNWDEWSQKVPMVVGHEYVGEIVAIGQ
TDH_PROMH       ------------------VPELGHNDVMIKIRKTAICGTDVHIYNWDEWSQKVPMVVGHEYIGEIVAIGQ
DOIAD_STRLV     MKALMFEAPERAVLIQRDLPEPAPGEALVRLAYNSVCGSDLSFYKGVWHGSTYPVVPGHEWSGTVVDV-N
TDH_SYMTH       ------------TLQEVPIPTIGPRDVLVKVRAASICGTDYHIYTW-DPWSKPPLTIGHELAGEVVAVGR
DHSO_MACFA      --SLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWRIGNFIVKKPMVLGHEASGTVEKVGS
TDH_STRAW       MKALVKEKAEPLWLMDVPEPEIGPGDVLIKVLRTGICGTDLHI-RSWDGWAQQPLVLGHEFVGEVVETGR
TDH_ANADF       ------------------VPEVGVHDVRIRVRKSAICGTDVHIYNWDEWSQRVPMIVGHEYXXXXXXXXX
TDH_PYRFU       ------------------VPKPGPGEVLIKILATSICGTDLHIYEW-NEWAQTPQIMXXXXXXXXXXXXX
TDH_STRGG       MKALVKQKAEPLWLMDVPEPEYGPTDVLIKVLRTGICGTDLHI-RAYDGWAQQPLILGHEFVGEVAAIGS
DHSO_SHEEP      --SLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQGRDFVVKKPMVLGHEASGTVVKVGS
TDH_PYRAB       ------------------VPKPGPGEVLIKVIATSICGTDLHIYEW-NEWAKPPQIMXXXXXXXXXXXXX
TDH_MARMS       ------------------VPHPDCGDVVIKISKTAICGTDMHIYQWDDNTIPVPMTVGHEFVGVITEVGP
DHSO_RAT        --SLVVHGPGDIRLENYPIPELGPNDVLLKMHSVGICGSDVHYWRIGDFVVKKPMVLGHEAAGTVTKVGP
DHSO_MOUSE      --SLVVHGPGDIRLENYPIPELGPNDVLLKMHSVGICGSDVHYWRIGDFVVKKPMVLGHEAAGTVTKVGE
TDH_PYRKO       ------------------VPKPGPGEVLIKVLATSICGTDLHIYEW-NEWAKPPQIMXXXXXXXXXXXXX
DHSO_BOVIN      --SLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWRIGDFVVKKPMVLGHEASGTVVKVGS
TDH_STRMK       MKALVKEAAKGIWLEEVPVPTPGPNEVLIKLEKTAICGTDLHIYEWSQRTIKPGLTIGHEFVGRVAALGS
TDH_ESCF3       ------------------VPEPELGDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_LEGPH       MKSLVAKKEPGIWMQDIPVPEYGVNDVLIKIKRTAICGTDIHIYSWDEATIPVPMTVGHEFYGEIVEVGK
TDH_LEGPC       MKSLVAKKEPGIWMQDVPVPEYGVNDVLIKIKRTAICGTDIHIYSWDEATIPVPMTVGHEFYGEIVEVGK
TDH_ENTS8       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_LEGPA       MKSLVAKKEPGIWMQDIPVPEYGVNDVLIKIKRTAICGTDIHIYSWDEATIPVPMTVGHEFYGEIVEVGK
TDH_KLEP7       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_KLEP3       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_LEGPL       MKSLVAKKEPGIWMQDIPVPEYGVNDVLIKIKRTAICGTDIHIYSWDEATIPVPMTVGHEFYGEIVEVGK
TDH_SHEAM       -------------------PEMGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
XYLD_MORMO      MKALVLEKAGKIAIQDQSNEVLGDDDVEIKIHTVGICGSDVHYYQHGRPFVDEPMVLGHEASGVITAAGK
TDH_ECOLI       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECODH       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECOBW       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
DHSO1_YEAST     --AVVLEKVGDIAIEQRPIPTKDPHYVKLAIKATGICGSDIHYYRSGGIILKAPMVLGHESSGQVVEVGD
TDH_SALTY       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDDWSQKVPMXXXXXXXXXXXXXXQ
TDH_SALSV       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDDWSQKVPMXXXXXXXXXXXXXXQ
TDH_SALPK       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDDWSQKVPMXXXXXXXXXXXXXXQ
TDH_SALPC       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDDWSQKVPMXXXXXXXXXXXXXXQ
TDH_SALPB       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDDWSQKVPMXXXXXXXXXXXXXXQ
TDH_SALPA       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDDWSQKVPMXXXXXXXXXXXXXXQ
TDH_SALNS       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDDWSQKVPMXXXXXXXXXXXXXXQ
TDH_SALHS       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDDWSQKVPMXXXXXXXXXXXXXXQ
TDH_SALEP       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDDWSQKVPMXXXXXXXXXXXXXXQ
TDH_SALDC       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDDWSQKVPMXXXXXXXXXXXXXXQ
TDH_SALCH       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDDWSQKVPMXXXXXXXXXXXXXXQ
TDH_SALA4       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDDWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECOLU       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_CITK8       ------------------VPEVGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_STRCO       ------------------VPEPTSGDVLIKVLRTGICGTDLHI-RAWDGWAQQPLVVGHEFVGEVVDTGR
TDH_SHIFL       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_SHIF8       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_SHIBS       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_SHIB3       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_SALTI       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_SALAR       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECOUT       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECOSM       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECOSE       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECOLC       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECOL6       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECOL5       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECOK1       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECOHS       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECO8A       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECO81       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECO7I       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECO5E       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECO57       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECO55       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECO45       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ECO27       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
DHSO2_YEAST     --AVVLEKVGDIAIEQRPIPTKDPHYVKLAIKATGICGSDIHYYRSGGIILKAPMVLGHESSGQVVEVGD
TDH_XANC5       MKALVKREANKIWLEQVPVPTPGPNEVLIKLEKTAICGTDLHIYLWDEWSQRTIRTIGHEFVGRVAELGS
TDH_SHISS       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_PSYIN       IKALAKLKPEVIWMTTVDKPEPGHNDLLIKIHKTAICGTDIHIYNWDENTIPVPXXXXXXXXXXXXXXXQ
TDH_ENT38       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ALTMD       MKSLVKAKAEKIWLQDTPKPEVGHNDLLIKIRKTAICGTDMHIYNWDENTIXXXXXXXXXXXXXXXXXXQ
GATD_ECOLI      MKSVVNDTDGIVRVAESVIPEKHQDEVRVKIASSGLCGSDPRIFK--NGAHYYPITLGHEFSGYIDAVGS
GATD_ECO57      MKSVVNDTDGIVRVAESVIPEKHQDEVRVKIASSGLCGSDPRIFK--NGAHYYPITLGHEFSGYIDAVGS
XYL2_YEAST      -EAIVLERPGKITLTNVSIPKISPNEVIIQIKATGICGSDIHYYT-HGRIANYPMVLGHESSGIVALIGE
TDH_SALG2       ------------------VPEPEVGDLLIKIRKTAICGTDVHIYNWDDWSQKVPMXXXXXXXXXXXXXXQ
TDH_VIBCM       ------------------MPELGHNDLLIKIKKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_VIBCH       ------------------MPELGHNDLLIKIKKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_VIBC3       ------------------MPELGHNDLLIKIKKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_XANOR       MKALVKRETNKIWLEQVPVPTPGPNEVLIKLEKTAICGTDLHIYEWSQRTIKPGLTIGHEFVGRVAELGS
TDH_XANOM       MKALVKRETNKIWLEQVPVPTPGPNEVLIKLEKTAICGTDLHIYEWSQRTIKPGLTIGHEFVGRVAELGS
TDH_XANAC       MKALVKREANKIWLEQVPVPTPGPNEVLIKLEKTAICGTDLHIYEWSQRTIEPGLTIGHEFVGRVAELGS
TDH_SHELP       -------------------PEVGHNDLLIKIRKTAICGTDVHIYNWDENTIPVPMXXXXXXXXXXXXXXQ
XYLD_AGRT5      MKALVLEEKGKLSLRDFDIPGGAPKDVRIRTHTVGICGSDVHYYT-HGKIGHFPMVLGHEASGTVIETGS
TDH_ECO24       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ANASK       MKALVKAKREEGIWMQHDVPVPEVGDVMIKVTKSAICGTDVHIYNWDEWSQKVPMVVGHEYVGRVEKVGA
TDH_SHIDS       ------------------VPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_ANAD2       MKALVKAKREEGIWMQHDVPVPEVGDVMIRVTKSAICGTDVHIYNWDEWSQKVPMVVGHEYVGRVEKVGA
IDND_ECOLI      -QSCVVAGKKTVAVTEQTIDWNNNGTL-VQITRGGICGSDLHYYQEGNFMIKAPMVLGHEVIGKV--IHS
TDH_XANCP       MKALVKEASKGIWLEQVPVPTPGPNEVLIKLEKTAICGTDLHIYLWDEWSQRTITTIGHEFVGRVAELGS
TDH_XANCB       MKALVKEASKGIWLEQVPVPTPGPNEVLIKLEKTAICGTDLHIYLWDEWSQRTITTIGHEFVGRVAELGS
TDH_XANC8       MKALVKEASKGIWLEQVPVPTPGPNEVLIKLEKTAICGTDLHIYLWDEWSQRTITTIGHEFVGRVAELGS
TDH_VIBVU       -------------------------DLLIKIKKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_PROAC       MKALVKTRPEP-GLELVEVPDPVPNDVIVKVMRTGICGTDVHIDKWDGWAAKTPLVLGHEFCGEIVELGS
TDH_VIBVY       -------------------------DLLIKIKKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_SHEHH       -------------------PEVGHNDLLIKIRKTAICGTDVHIYNWDENTIPVPXXXXXXXXXXXXXXXQ
TDH_PSEA6       MKSLALKSEKGIWLHDSEMPTVGHNDILIKIRKTAICGTDMHIYNWDENTIPVPMXXXXXXXXXXXXXXX
TDH_SHEPA       -------------------PEVGHNDLLIKIRKTAICGTDVHIYNWDENTIPVPXXXXXXXXXXXXXXXQ
TDH_VIBF1       -------------------PEMGHNDLLIRIKKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_SOLUE       ------------------IPEPAIGDVLIRVLRTGICGTDVHIYKWDEETIHVPMAIGHEFVGRIEAVGS
TDH_VIBFM       -------------------PEMGHNDLLIRIKKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
ADH1_ZYMMO      MKAAVITKDHTIEVKDTKLRPLKYGEALLEMEYCGVCHTDLHVKNGDFG-DETGRITGHEGIGIVKQVGE
TDH_VIBSL       -------------------PEMGHNDLLIRIKKTAICGTDVHIYNWDENTIPVPMXXXXXXXXXXXXXXQ
TDH_PARUW       -------------------------EVLIKTIKTSICGTDVHIYKWDAWAQKVPLVIGHEFIGEIAEFGK
DOIAD_MICEC     -------------------PEAPPGWAVVKVHYCCLCGSDLWLYRGKWHGNRYPIVPGHEWAGVVDSAPE
YDJL_ECOLI      ------------------VPQPGPEDVVIEIKAAAICGADMKHYNVDSGSDEFNSIRGHEFAGCIAQVGE
TDH_ALISL       -------------------PEMGHNDILIRIKKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
TDH_PHOPR       -------------------PEMGHNDLLIRIKKTAICGTDVHIYNWDEWSQKVPMXXXXXXXXXXXXXXQ
ADH_SULTO       MRLVEIGKP--LKLEDIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRDLGVKLPVTLGHEIAGRIEEVGD
ADH2_BACST      --AVVNEFKKALEIKEVERPKLEEGEVLVKIEACGVCHTDLHAAHGDWPIKKLPLIPGHEGVGIVVEVAK
XYLD_RHILO      MRALVLEKKGELSLREIALPDVGPDDVKIAIHTVGVCGSDVHYYT-HGAIGSYPMVLGHEAAGTVVETGA
ADHP_ECOLI      MKAAVVTKDHHVDVTYKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFG-DKTGVILGHEGIGVVAEVGP
YPHC_ECOLI      --------PGNSTVDLREVAVPTPGQVLIKMKSSGICGSDVHIYHQHRATAAAPDINGHEPCGQIVAMGQ
TDH_ANADE       MKALVKAKREEGIWMQHDVPVPEVGDVMIRVTKSAICGTDVHIYNWDEWSQKVPMVVGHXXXXXXXXXXX
YBDR_ECOLI      MKALTYHGPHHVQVEN--VPDPGADDIILRITATAICGSDLHLYRGKIPQVKHGDIFGHEFMGEVVETGK
XYLD_RHIME      -KALVLEKKGQLSLRDIPVRRDSPTDVLIGIRTVGVCGSDVHYYTHGKPFVNEPMILGHEAAGVVLEVGS
BDHA_BACSU      MKAARWHNQKDIRIEHIEEPKTEPGKVKIKVKWCGICGSDLHEYLGGPIFIPVPVTMGHEFSXXXXXXXX
ADH_STAAW       MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNAD--FGDVTGVLGHEGIGKVIEVAE
ADH_STAAS       MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNAD--FGDVTGVLGHEGIGKVIEVAE
ADH_STAAR       MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNAD--FGDVTGVLGHEGIGKVIEVAE
ADH_STAAN       MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNAD--FGDVTGVLGHEGIGKVIEVAE
ADH_STAAM       MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNAD--FGDVTGVLGHEGIGKVIEVAE
ADH_STAAC       MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNAD--FGDVTGVLGHEGIGKVIEVAE
ADH_STAAB       MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNAD--FGDVTGVLGHEGIGKVIEVAE
ADH_STAA8       MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNAD--FGDVTGVLGHEGIGKVIEVAE
ADH_STAA3       MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNAD--FGDVTGVLGHEGIGKVIEVAE
ADH_SULSR       ----LVEIGKPLVLKDIDIPKPKGAQVLIKVEAAGVCHSDVHMRQGRDLGVKLPVTLGHEIAGKIEEMGD
ADH1_KLUMA      ---IFYEHGGELQYKDIPVPKPKPNELLINVKYSGVCHTDLHAWQGDWPLTKLPLVGGHEGAGIVVAMGE
XYL2_PICST      --SLVLNKIDDISFETYDAPEISPTDVLVQVKKTGICGSDIHFY-AHGRIGNFPMVLGHESAGTVVQVGK
ADH1_BACST      MKAAVVEQKKPLQVKEVEKPKISYGEVLVRIKACGVCHTDLHAAHGDWPVKKLPLXXXXXXXXXXXXXXX
ADH3_BACST      MKAAVVEQKEPLKIKEVEKPTISYGEVLVRIKACGVCHTDLHAAHGDWPVKKLPLXXXXXXXXXXXXXXX
ADH_RALEU       MKAAVFVEPGRIELADKPIPDIGPNDALVRITTTTICGTDVHILKGEYPVAK-GLTVGHEPVGIIEKLGS
ADH_STAEQ       MKAAVVTKDHRVSIEEKRLRELKPGEALVKTEYCGVCHTDLHVKNAD--FGDVTGVLGHEGIGRVIEVAD
ADH_STAES       MKAAVVTKDHRVSIEEKRLRELRPGEALVKTEYCGVCHTDLHVKNAD--FGDVTGVLGHEGIGRVIKIAD
ADH5_YEAST      -KAIVFETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQKFPLIGGHEGAGVVVKLGS
ADH5_SACPS      -KAIVFETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQKFPLIGGHEGAGVVVKLGS
ADH6_PERMA      -KAAVLWKPGALTMEEIDVAPPKGKEVRVKMVAAGICGTDIKSLDNKKLAPFCPIIMGHEGTGIVESVGE
ADHL_GADMO      --AVAWEAGKPLSMEEVEVAPPQAGEVRIKIVATGICHTDAYTLSGSDPEGVFPSVLGHEGAGIVESVGE
TDH_SILPO       MKALEKSKPEELWMVQAPVPEIGPDDVLIKIKKTGICGTDIHIWNWDEWAAPVPMITGHEFAGEIVELGR
ADH_SULSO       ----LVEIGKPLSLQEIGVPKPKGPQVLIKVEAAGVCHSDVHMRQGRDLGVKLPVTLGHEIAGKIEEVGD
ADHB_BACSU      ----------------------------IKVTSTAICGSDLHLIHGFIPNMQEDYVIGHEPMGIVEEVGS
FADH_METMR      -------------VRVDTVPDPIPTDAIVKITATAICGSDLHLYDGYMPTMESGDILGHEPMXXXXXXXX
FADH_AMYME      ------------------IPDPGPSEVTALIATCAVCHTDL-TYREGGINDEFPFLLGHEAAGTVESVGE
BDH1_YEAST      ---------------TNDIPRPTDDEVIIDVSWCGICGSDLHEYLDGPIFAALPLAMGHEMSGIXXXXXX
YHG1_SCHPO      MKACVWDGP--LNVKIAEVPKPTPKDVIVKTTACTICGSDSHIFSGEMPGIEKGAILGHESCGIVAEKGD
ADHA_RHIME      --AVVREFGKPLVIEEXXXXXXXXXXXLIKYEATGVCHTDLHAAKGDWPVRPNPPFIGHEGVGYVAKLGA
ADHP_RABIT      --AIAWEAGKPLSIEEVEVAPPKAHEVRVQINAAGLCRSDTHVINPKFEGAFLPVILGHEGAGIVESVGP
FADH_CANMA      --AVAWEAAKPLSIEDVTVAPPKRHEVRIKLYDTGVCHTDAYTLSGVDPEGAFPVILGHEGAGIVESIGE
CADH3_ARATH     -------------------------DVTVKILFCGVCHSDLHTIKNHWGFSRYPIIPGHEIVGIATKVGK
ADH4_KLULA      ---IFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLVKLPLVGGHEGAGIVVAKGE
ADHX_SPAAU      --AVAWEPGKPLSIEEVEVAPPNAHEVRIKLFATGVCHTDAYTLSGSDPEGLFPVILGHEGAGTVESVGE
ADHX_MYXGL      --AVAWEAKKPLSLEEIEVAPPKAHEVRMKVLATAVCHTDAYTLSGVDPEGSFPVVLGHEGAGIVESVGE
YYCR_BACSU      --------------------------VILKVITTNICGSDQHMVRGRTT-APEGLVLGHEITGEVIETGR
ADH1_EMENI      ------------------VPKPGPDQILVKIRYSGVCHTDLHAMMGHWPIVKMPLVGGHEGAGIVVAKGE
CADH6_ARATH     -------------------------EVRVKVLYCGICHSDLHCLKNEWHSSIYPLVPGHEIIGEVSEIGN
FADH_YEAST      --AVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGD
ADHX_HORSE      --AVAWEAGKPVSIEEVEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGSFPVILGHEGAGIVESVGE
ADH1B_PAPHA     -----VKKP--FSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSG-NLVSPLPAILGHEAAGIVESVGE
ADH1B_PANTR     -----VKKP--FSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSG-NLVTPLPAILGHEAAGIVESVGE
ADHL7_ARATH     -----------LVMEEIMVAPPQPFEVRIRIICTALCHSDVTFWKLQVPPACFPRILGHEAIGVVESVGE
ADHL6_ARATH     -----------LVMEEVEVSPPQPLEIRIKVVCTSLCRSDLSAWESQSLL---PRIFGHEAAGIVESIGE
ADH4_STRCA      --AIAWEAGKPLSVEEIEVSPPKDHEVRVKIVATGVCRTDEHAINPSFKEGVFPVILGHEGAGIVESIGQ
ADH1S_HORSE     --AVLWEQKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSG-TLVAPLPVIAGHEAAGIVESIGE
CADH2_ARATH     -------------------------DVTVKILFCGVCHSDLHTIKNHWGFSRYPIIPGHEIVGIATKVGK
ADH1B_HUMAN     -----VKKP--FSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSG-NLVTPLPVILGHEAAGIVESVGE
DHSO_SCHPO      -KAFVLRKKMDTAIEDR------PGQVKVAIKATGICGSDVHYWKGIGDFIKKPMILGHESAXXXXXXXX
ADHC_MYCTU      -------EPLTKTTITRR--DPGPHDVAIDIKFAGICHSDIHTVKAEWGQPNYPVVPGHEIAGVVTAVGS
ADHC_MYCBO      -------EPLTKTTITRR--DPGPHDVAIDIKFAGICHSDIHTVKAEWGQPNYPVVPGHEIAGVVTAVGS
ADH7_RAT        ------------SIEDIEVAPPKAKEVRVKILATGICGTDDHVIKG-TMVSKFPVIVGHEAVGIVESVGE
ADHX_PEA        -KAAVAWEPNKLTIEDVEVAPPQANEVRIQILFTALCHTDAYTLGGKDPEGLFPCILGHEAAGIVESVGE
ADHB_MYCTU      ------------SVEEIEIGDPRKDEVKIQMEAAGMCRSDHHLVTGDIPMAGFPVLGGHEGAGIVTEVGP
ADHB_MYCBO      ------------SVEEIEIGDPRKDEVKIQMEAAGMCRSDHHLVTGDIPMAGFPVLGGHEGAGIVTEVGP
ADH1A_HUMAN     --AVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSG-TMVTPLPVILGHEAAGIVESVGE
ADH1_ALLMI      -----IKKP--FSIEEIEVAPPKAHEVRIKILATGICRSDDHVTAGLLTMP-LPMILGHEAAGVVESTGE
ADHX_ARATH      -KAAVAYEPNKLVIEDVQVAPPQAGEVRIKILYTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGE
ADHH_GADMO      --AVAWEAGKPLSLEEVEVAPPRAGEVRIKVVATGVCHTDAYTLSGSDPEGAFPVILGHEGAGLVESVGE
ADH3_YEAST      ---IFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLVKLPLVGGHEGAGVVVKLGS
ADHX_MAIZE      -KAAVAYEPNKLVIEDVQVAPPQAGEVRVKILFTALCHTDHYTWSGKDPEGLFPCILGHEAAGIVESVGE
ADH2_CAEEL      --ALIFEKGGPLEVRQVSVPQPQENELLVKIEYSGICHSDLHTWEGDFEYASIPLIGGHEGAGTVVTIGS
MTDH_MEDSA      -------------------------DVSVKILYCGVCHSDLHTLKNDWGFTTYPVVPGHEIVGVVTKVGI
ADHX_ORYSJ      --AVAWEANRPMTIEDVQVAPPQAGEVRVKILFTALCHTDHYTWSGKDPEGLFPCILGHEAAGIVESVGE
ADHX_ORYSI      --AVAWEANKPMTIEDVQVAPPQAGEVRVKILFTALCHTDHYTWSGKDPEGLFPCILGHEAAGIVESVGE
ADHX_DROME      --AVAWEAKKPLVIEDIEVAPPKAHEVRIKITATGVCHTDAFTLSGADPEGLFPVVLGHEGAGIVESVGE
ADHQ_RABIT      --AIAWEAGKPLSIEEVEVAPPKAHEVRVQIIAASVCRSDTYVINPAFKEGLLPVILGHECAGIVESVGP
XYLB_PSEPU      --AIVRQKNGPFLLEHVALNEPAEDQVLVRLVATGLCHTDLVCRDQHYP-VPLPMVFGHEGAGVVERVGS
ADH8_RANPE      --AVAWEPHKPLSLETITVAPPKAHEVRIKILASGICGSDSSVLKEIIP-SKFPVILGHEAVGVVESIGA
ADH1_PEA        --AVAWEAGKPLVIEEVEVAPPQAGEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGE
CADH1_ARATH     -------------------------DVSLTITHCGVCYADVIWSRNQHGDSKYPLVPGHEIAGIVTKVGP
BDH2_YEAST      ---------------TNHLKEPAPDELVIDIEWCGICGTDLHEYTSHNPL---PQAMGHEMAGTVLEVGP
ADH7_HUMAN      --AVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKG-TMVSKFPVIVGHEATGIVESIGE
ADH_SCHPO       --------PENVKFEEVPVAEPGQDEVLVNIKYTGVCHTDLHALQGDWPLAKMPLIXXXXXXXXXXXXXX
ADHX_OCTVU      MAAIAWEAKKPLSIEEVEVAPPKSGEVRIKILHSGVCHTDAYTLEGIDPEGIFPVILGHEGAGIVESIGE
ADH1E_HORSE     --AVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSG-TLVTPLPVIAGHEAAGIVESIGE
ADH3_HORVU      --AVAWEAGKPLSIEEVEVAPPQAMEVRVKILYTALCHTDVYFWEAKGQTPVFPRILGHEAGGIVESVGE
FRMA_SYNY3      --AVAFEVGKPLQIVEIDVAPPQQGEVLVKITHTGVCHTDAFTLSGDDPEGLFPVVLXXXXXXXXXXXXX
CADH7_ORYSJ     -------------------------DVAIKVLYCGICHSDLHTIKNEWRNAVYPVVAGHEITGVVTEVGK
ADHX_BOVIN      --AVAWEAGKPLSIEEVEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGNYPVILGHEGAGIVESVGE
ADH1_GEOAT      --AVLWEKNKPFSIEEVEVAPPKAYEVRIKIVATGICRSDDHVVNG-SIITPLPAILGHEAGGIVESIGE
ADH1_GEOKN      --AVLWEKNKPFSIEEVEVVPPKAYEVRIKIVATGICRSDDHVVNG-SIITPLPAILGHEAGGIVESIGE
YAHK_ECOLI      --------------------EPGPNDVKIEIAYCGVCHSDLHQVRSEWAGTVYPCVPGHEIVGRVVAVGD
ADHX_HUMAN      --AVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGAGIVESVGE
ADH6_PONAB      -KAAILWKPGAFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEGAGIVESIGE
ADH1_TRIRP      --AVAWEAGKPLVIEEVEVAPPQAGEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGE
ADH1_CHICK      --AVLWEANKPFSLEEVEVAPPKAHEVRIKIVATGICRSDDHVVTGALAMP-FPIILGHEAAGVIESVGE
ADHX_UROHA      --AVAWEAGKPLSIEEIEVAPPKAHEVRVKIIATAVCHTDAYTLSGADPEGSFPVILGHEGAGIVESVGE
ADH3_EMENI      -------------------------EILVKMRYSGVCHTDLHAMKGDWPLSKMPLIGGHEGAGVVVAKGE
CADH8_ARATH     -------------------------DVRFKVLFCGICHSDLHMVKNEWGMSTYPLVPGHEIVGVVTEVGA
FADH_PARDE      --AVALEAGKPLEVMEVNLEGPKAGEVMVEIKATGICHTDEFTLSGADPEGLFPSILXXXXXXXXXXXXX
FADH1_SCHPO     -----------LSIEDIQVAPPKAHEVRVKVDWSAVCHTDAYTLSGVDPEGAFPIVLGHEGAGIVESIGE
ADH6_YEAST      -------------------------DIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGP
ADH1_GEOBU      --AVLWEKNKPFSIEEVEVAPPKAYEVRIKIVATGICRSDDHVVNG-SIITPLPAILGHEAGGIVESIGE
ADHX_RABIT      --AVAWEAGKPLSIEEIEVAPPKAHEVRIKIFATAVCHTDAYTLSGADPEGCFPVILGHEGAGIVESVGE
ADHX_MOUSE      --AVAWEAGKPLSIEEIEVAPPKAHEVRIKILATAVCHTDAYTLSGADPEGCFPVILGHEGAGIVESVGE
CADH9_ARATH     -------------------------DVTVKILFCGVCHTDLHTIKNDWGYSYYPVVPGHEIVGIATKVGK
CADH7_ARATH     -------------------------DVRFKVLFCGICHTDLSMAKNEWGLTTYPLVPGHEIVGVVTEVGA
ADHX_RAT        --AVAWEAGKPLSIEEIEVAPPQAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGAGIVESVGE
ADH2_ORYSJ      --AVAWEAGKPLSIEEVEVAPPQAMEVRVKILYTALCHTDVYFWEAKGQTPVFPRILGHEAGGIVESVGE
ADH2_ORYSI      --AVAWEAGKPLSIEEVEVAPPQAMEVRVKILYTALCHTDVYFWEAKGQTPVFPRILGHEAGGIVESVGE
ADH1A_PONAB     --AVLWELKKPFSIEEVEVAPPKAQEVRIKMVAVGICGTDDHVVSG-TMVTPLPAILGHEAAGIVESVGE
FADH2_SCHPO     -----------LSIENVQVFPPRVHEVRIKIVNSGVCHTDAYTLSGKDPEGLFPVILGHEGAGIVESVGP
CADH3_ORYSJ     -------------------------DVAIKILFCGICHSDLHCIKNEWKHSIYPLVPGHEIAGVVTEVGK
ADH_SULAC       MKAMLLHKGEPLRLEDMDVPKVGVGQVLVKVDYAGVCHTDLSVRSGSSSKPTLPLVIGHEIAXXXXXXXX
ADH4_RAT        --AIAWKTDSPLCIEEIEVSPPKAHEVRIKVIATCVCPTDIN---ATNPKKKFPVVLGHECAGIVESVGP
ADH1_COTJA      --AVLWEANKPFSLEEVEVAPPKAHEVRIKIVATGICRSDDHVVTGALAMP-FPVILGHEAAGVVESVGE
CADH_PINTA      ---------------TYNLRKKGPEDVIVKVIYCGICHSDLVQMRNEMGMSHYPMVPGHEVVGIVTEIGS
CADH_PINRA      ---------------TYNLRKKGPEDVIVKVIYCGICHSDLVQMRNEMGMSHYPMVPGHEVVGIVTEIGS
ADHL5_ARATH     -KAAVSRKPGALVIEEIHVDPPQAYEVRIKIICTSLCHTDVSFSKDSGPLARFPRILGHEAVGVIESIGE
ADH1_CAEEL      -------------LEVRQVPVPSPAEILVKIEYSGICHSDLHVWLGDKDMSVCPLVGGHEGAGSVVQIGK
FRMA_ECOSM      ---------------------PKKGEVLIKVTHTGVCHTDAFTLSGDDPEGVFPXXXXXXXXXXXXXXXX
CADH5_ORYSJ     -----------LTISRRST---GDDDVVIKILYCGICHSDLHSIKNEWKNATYPLVPGHEIAGVVTEAGK
FRMA_ECOUT      ---------------------PKKGEVLIKVTHTGVCHTDAFTLSGDDPEGVFPXXXXXXXXXXXXXXXX
FRMA_ECOL5      ---------------------PKKGEVLIKVTHTGVCHTDAFTLSGDDPEGVFPXXXXXXXXXXXXXXXX
FRMA_ECOK1      ---------------------PKKGEVLIKVTHTGVCHTDAFTLSGDDPEGVFPXXXXXXXXXXXXXXXX
ADH6_HUMAN      -KAAILWKPGAFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEGAGIVESIGE
ADH1_ASPFN      ------QKGGPLIYKQIPVPKPGPDEILVKVRYSGVCHTDLHALKGDWPLVKMPLXXXXXXXXXXXXXXD
FRMA_SHISS      ---------------------PKKGEVLIKVTHTGVCHTDAFTLSGDDPEGVFPXXXXXXXXXXXXXXXX
FRMA_ECOLC      ---------------------PKKGEVLIKVTHTGVCHTDAFTLSGDDPEGVFPXXXXXXXXXXXXXXXX
FRMA_ECOHS      ---------------------PKKGEVLIKVTHTGVCHTDAFTLSGDDPEGVFPXXXXXXXXXXXXXXXX
FRMA_ECO57      ---------------------PKKGEVLIKVTHTGVCHTDAFTLSGDDPEGVFPXXXXXXXXXXXXXXXX
FRMA_ECO24      ---------------------PKKGEVLIKVTHTGVCHTDAFTLSGDDPEGVFPXXXXXXXXXXXXXXXX
ADH1_MOUSE      --AVLWELHKPFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHVVSG-TLVTPLPAVLGHEGAGIVESVGE
ADH1G_HUMAN     --AVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSG-NLVTPLPVILGHEAAGIVESVGE
ADHL1_ARATH     -----------LVIEDIHVDPPQAYEVRIKILCTSLCHTDLTFWKSFGPISRFPRILGHEAVGVVESIGE
FRMA_ECOL6      ---------------------PKKGEVLIKVTHTGVCHTDAFTLSGDDPEGVFPXXXXXXXXXXXXXXXX
ADH2_HORVU      --AVAWEAGKPLSMEEVEDAPPQAMEVRDKILYTALCHTDVYFWEANGQTPVFPRILGHEAGGIVESVGE
ADH1_RAT        -KAAVLWEPHKFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHAVSG-SLFTPLPAVLGHEGAGIVESIGE
YL498_MIMIV     -----VGKPVELLVFDRK--KPTNNEVSIEIYYTGICHSDWHFIVGEWK-ADFPLIPGHELIGRVIDIGP
CADH6_ORYSJ     -------------------------DVTIKVKYCGMCHTDLHFIHNDWGITMYPVVPGHEITGVVTKVGT
YJGB_ECOLI      -----------------------PQDVEVQVDYCGICHSDLSMIDNEWGFSQYPLVAGHEVIGRVVALGS
FRMA_ECOLI      ---------------------PKKGEVLIKVTHTGVCHTDAFTLSGDDPEGVFPXXXXXXXXXXXXXXXX
ADH2_MAIZE      --AVTWEAGKPLSIEEVEVAPPQAMEVRIKILYTALCHTDVYFWEAKGQTPVFPRILGHEAGGIVESVGE
ADH2_EMENI      -KAVIYDNPGTVSTKVVELDVPEPGEVLINLTHSGVCHSDFGIMTNTLPFPTQPXXXXXXXXXXXXXXXX
ADH1_RABIT      -----LNKP--FSIEEVEVAPPKAHEVRIKMVATGICRSDDHAVTG-SIAVPLPVILGHEAAGIVESIGE
MTDH1_STYHU     -------------------------DVTLKILYCGVCHSDLHTVKNDWGFTTYPVVPGHEIAGIVTKVGS
ADH_MYCPN       -----IEKPR---------PVCGPNDAIIRPLAVAPCTSDVHTVWEGGIGERHNMVLGHEGCGVVDEVGS
ADH1_ARATH      --AVAWEAGKPLVIEEVEVAPPQKHEVRIKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGE
MTDH_PETCR      -------------------------DVRFKVLYCGVCHSDLHMVKNEWGMTTYPIVPGHEIVGRVTEVGS
MTDH_FRAAN      -------------------------DVTFKVLYCGICHSDLHMVKNEWGFSTYPLVPGHEIVGEVTEVGS
DHSO_PIG        --SLVVHGPGDLRLENYPIPEPGPNXVLLKMHSVGICGSDVHYWRIGNFVVKKPMVLGHEASGTXVKVGS
ADH_MALDO       --AVAWEAGKPLVIEEVEVAPPQANEVRIKILFTSLCHTDVYFWKGQNPL--FPRIYGHEAGGIVESVGE
ADH1_HORVU      --AVAWEAGKPLTMEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQIPMFPRIFGHEAGGIVESVGE
ADH1_GADCA      --AVAWEANKPLVIEEIEVDVPHANEIRIKIIATGVCHTDLHLFEGKHKDG-FPVVLGHEGAGIVESVGP
ADH1B_UROHA     --AVVWEPKKPFSIVEIEVAPPKAHEVRIKILASGICRSDDHVLSGALK-VNFPIILXXXXXXXXXXXXX
FRMA_HAEIN      ---------------------PRKGEVLIRNTHTGVCHTDAFTLSGSDPEGVFPXXXXXXXXXXXXXXXX
ADHX_DICDI      --AVAWEAKKPLVIEDIEVQPPQKGEVRIKILYTGVCHTDSYTLSGSDPEGIFPCILXXXXXXXXXXXXX
ADHL2_ARATH     -KAAILRKAGELVIEEIQVDPPQAYEVRIKILCTSLCHTDVTFWKDSGPLARFPRILGHEAVGVVESIGE
ADH4_HUMAN      --AIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLAFPVIVGHEAAGIVESIGP
ADH1_PENAM      --AVAWEAGKPLSIEEVEVAPPQAMEVRVKILYTSLCHTDVYFWEAKGQTPVFPRIFGHEAGGIIESVGE
MTDH_MESCR      -------------------------DVTFKVLYCGICHSDLHYIKNEWGNAVYPAIPGHEIVGVVTEVGN
MTDH3_STYHU     -------------------------DVALEVLYCGICHTDLHMAKNDFGNSIYPYVPGHEVIGIVAEVGS
ADHL3_ARATH     -KAAVVWGPKVLVIQEICVDPPQKMEVRVKILYSSICHTDLGCWNGTNEAERFPRILGHEAVGIVESVGE
ADH1_PERMA      -KAAVLWEPHKFSIEDIEVAPPKAHEVRIKMVATGVCRSDDHVV-SRSLASPLPAVLGHEGAGIVESVGE
CADH4_ORYSJ     -------------------------DVSLRITHCGVCYADVIWTRNMFNDSIYPLVPGHEIAGVVTEVGA
FADH_PSEPU      --------------------------VILKVVSTNICGSDQHMVRGRTT-AQVGLVLGHEITGEVIEKGR
FADH_PSEAE      --------------------------VILRVVSTNICGSDQHMVRGRTT-APEGLVLGHEITGEVVEIGR
ADH4_MOUSE      -----------LCIEEIEVSPPKACEVRIQVIATCVCPTDINATDPKKK-ALFPVVLGHECAGIVESVGP
ADH1_MAIZE      --AVAWEAGKPLSIEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQTPVFPRIFGHEAGGIIESVGE
ADH3_KLULA      ---IFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLTKLPLXXXXXXXXXXXXXXX
ADH1_ORYSJ      --AVAWEAAKPLVIEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQTPVFPRIFGHEAGGIVESVGE
ADH1_ORYSI      --AVAWEAAKPLVIEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQTPVFPRIFGHEAGGIVESVGE
YBJB_SCHPO      -------KPGCLGIEIQSVPIPQPGELLVKIEAAAINPSDLMNATGGFPYTVYPRIVGRDYAGTVISGAS
ADHI_RHOS4      --AVAVEAGKPLEIMEVNLEGPKAGEVMVEIKATGICHTDEFTLSGADPEGMFPAILXXXXXXXXXXXXX
ADH1A_MACMU     --AVLWEVMKPFSIEDVEVAPPKAYEVRIKMVTVGICGTDDHVVSG-TMVTPLPVILGHEAAXXXXXXXX
ADH_FRAAN       --AVAWEAGKPLVIEEVEVAPPQANVVRVKILYTSLCHTDVYFWKGQNPL--FPRIYGHEAGGIVESVGE
ADH3_SOLTU      --AVAWEAGKPLVMEEVDVAPPQKMEVRLKILYTSLCHTDVYFWKGQNPV--FPRILGHEAAGIVESVGE
ADH2_SOLTU      --AVAWEAGKPLVMEEVDVAPPQKMEVRLKILYTSLCHTDVYFWKGQNPV--FPRILGHEAAGIVESVGE
ADH2_SOLLC      --AVAWEAGKPLVMEEVDVAPPQKMEVRLKILYTSLCHTDVYFWKGQNPV--FPRILGHEAAGIVESVGE
ADH1_SOLTU      --AVAWEAGKPLVMEEVDVAPPQKMEVRLKILYTSLCHTDVYFWKGQNPV--FPRILGHEAAGIVESVGE
ADH1_PICST      -KAVVFESNGPLLYKDIPVPTPKPNEILINVKYSGVCHTDLHAWKGDWPLTKLPLXXXXXXXXXXXXXXS
ADH1_NEUCR      ---VVEKKGGPVVFKQIPVQKPGPDEVLINVKYSGVCHTDLHAMKGDWPLAKMPXXXXXXXXXXXXXXXX
ADH7_YEAST      -------------------------DVDVEIEACGICGSDFHIAVGNWGPVPENQILGHEIIGRVVKVGS
ADH1_PETHY      --AVAWEAGKPLVIEEVEVAPPQKMEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGE
ADH2_KLULA      ---IFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLTKLPLXXXXXXXXXXXXXXX
QOR_PIG         -----------------AIPIPKDNQVLIKVHACGVNPVDTYIRSGHNMKPLLPYTPGLDVAGIVEAVGE
FRMA_PASPI      ---------------------PKKGEVLVKISHTGVCHTDAYTLSGDDPEGLFPXXXXXXXXXXXXXXXX
ADH2_YEAST      ------------------VPKPKPNELLINVKYSGVCHTDLHAWHGDWPLTKLPLXXXXXXXXXXXXXXX
ADH2_CANAL      ----VIFETNGGKLEYKDIPVPKPNELLINVKYSGVCHTDLHAWKGDWPLAKLPXXXXXXXXXXXXXXXX
QOR_HUMAN       -----------------AVPIPKDHQVLIKVHACGVNPVETYIRSGYSRKPLLPYTPGSDVAGVIEAVGD
CAD8A_ORYSJ     -------------------------DVTIKVLYCGICHTDLHTIKNEWGNAMYPVVPGHEIXXXXXXXXX
FDEH_PSEPU      -------------VETWEVPDPAPXXXXXXXXXXXXXXSDVHIVSGEAGAMPFPIILGHEGIGRIEKLGT
QOR_CAVPO       --------PEVLKVQSDAVPIPKDHQVLIKVHACGINPVETYIRSGYTRIPLLPYTPGTDVAGVVESIGN
ADH2_PICST      ------------------VPKPKPNELLINVKYSGVCHTDLHAWKGDWPLTKLPXXXXXXXXXXXXXXXX
VAT1L_MOUSE     ---------NKLRLSRKAMPEPQDGELKIRVKACGLNFIDLMVRQGNNP-PKTPLVPGFECSGIVEALGD
ADHA_BACSU      ------------TIERRGL---RPHDVLIDIKFSGICHSDIHSAFDEWGGGIFPMVPGHEIXXXXXXXXX
ADH1_CANAL      ------------------VPTPKPNELLIHVKYSGVCHTDLHARKGDWPLAKLPLXXXXXXXXXXXXXXX
CADH1_ORYSJ     -------------------------DVSLRITHCGVCYADVAWTRNILNNSMYPLVPGHEIAGVVTEVGA
ADH1A_UROHA     -----IKKP--LSIEQIEVAPPKAHEVRIKILATGICRSDDHVISGAFKM-PLPMVLXXXXXXXXXXXXX
VAT1L_HUMAN     ---------NKLRLFRKAMPEPQDGELKIRVKACGLNFIDLMVRQGNNP-PKTPLVPGFECSGIVEALGD
ADH1_KLULA      ---IFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLTKLPLXXXXXXXXXXXXXXX
ADH1G_PAPHA     -----VKKP--FSIEEVEVAPPKAHEVRIKMVAVGICRSDDHVVSG-TLVTPLPAILGHEAAXXXXXXXX
QOR_BOVIN       --------PEVLKLQSDAVPIPKDHQVLIKVQACGVNPVDTYIRSGHNIKPLLPYTPGFDVAGIIEAVGE
CAD8C_ORYSJ     -------------------------DVTIKVLYCGICHTDLHIVKNDWGNAMYPVVPGHEIXXXXXXXXX
QOR_PONAB       --------PEVLKLQSDAVPIPKDHQALIKVHACGVNPVETYIRSGYSRKPLLPYTPGSDVAGVIEAVGG
MTDH_APIGR      -------------------------DVRLKVLFCGVCHSDHHMIHNNWGFTTYPIVPGHEIXXXXXXXXX
CADH9_ORYSJ     -------------------------DVVVKILFCGICHSDLSTIKNEWGNAKYPVVPGHXXXXXXXXXXX
CAD8D_ORYSJ     -------------------------DVTIKVLYCGICHTDLHIIKNEWGNAMYPVVPGHEIXXXXXXXXX
CAD8B_ORYSJ     -------------------------DVTIKVLYCGICHTDLHVVKNDWGNAMYPVVPGHEIXXXXXXXXX
ADH1_YEAST      ------------------VPKPKANELLINVKYSGVCHTDLHAWHGDWPLVKLPLXXXXXXXXXXXXXXX
TERPD_PSESP     -----------------------------------VCHTDLAIKDGVLPFP-LPAVLGHEGSGIVEAVGP
CADH7_PICAB     ---------------TYTLRNKGPEDVIVRVIYCGICHSDLVQMHNEMGMSNYPMVPGHEVVGVVTEIGS
CADH2_PICAB     ---------------TYTLRNKGPEDVIVRVIYCGICHSDLVQMHNEMGMSNYPMVPGHEVVGVVTEIGS
YOGA_BACSU      MKAVIHNKAGLLGLSVQDVPSTKPGEVKVKLKSAGLNHRDLFLMKNKSEQDPH-MILGSDGAXXXXXXXX
ZDH1_STAAR      MKMIGFEKPNLFKVYEQRKPTPENDDILVKVNSISVNPVDTK--QRQMEVTQAPRVLGFDAIGTVEAIGP
ADH1_RANPE      -----------LSIEEIEVAPPKRHEVRVKIVATGICRSDDHVISGALSDMKFPVILXXXXXXXXXXXXX
ADH1_APTAU      --AVLWEPKKPFSIEEVEVAPPKAHEVRIKILATGICRSDDHVITGARPF---PIILGHXXXXXXXXXXX
CADH_EUCBO      ---------------TYSLRNTGPEDLYIKVLSCGICHSDIHQIKNDLGMSHYPMXXXXXXXXXXXXXXX
ZDH1_STAAC      MKMIGFEKPNLFKVYEQRKPTPENDDILVKVNSISVNPVDTK--QRQMEVTQAPRVLGFDAIGTVEAIGP
QOR_LAMGU       --------PEVLKLQSDAVPIPEEHQVLIKVQACGVNPVDTYIRSGYSRKPRLPYTPGLDVAGLIEAVGE
GEDH1_OCIBA     -------------------------DVQFRVLYCGVCHSDLHMVKNEWGVTHYPIVPGHEIVGIVTEVGS
CADH_EUCGL      ---------------TYSLRNTGPEDLYIKVLSCGICHSDIHQIKNDLGMSHYPMXXXXXXXXXXXXXXX
CADH1_EUCGU     ---------------TYSLRNTGPEDLYIKVLSCGICHSDIHQIKNDLGMSHYPMXXXXXXXXXXXXXXX
ZDH1_STAAW      MKMIGFEKPNLFKVYEQRKPTPENDDILVKVNSISVNPVDTK--QRQMEVTQAPRVLGFDAIGTVEAIGP
ZDH1_STAAS      MKMIGFEKPNLFKVYEQRKPTPENDDILVKVNSISVNPVDTK--QRQMEVTQAPRVLGFDAIGTVEAIGP
ZDH1_STAAN      MKMIGFEKPNLFKVYEQRKPTPENDDILVKVNSISVNPVDTK--QRQMKVTQAPRVLGFDAIGTVEAIGP
ZDH1_STAAM      MKMIGFEKPNLFKVYEQRKPTPENDDILVKVNSISVNPVDTK--QRQMKVTQAPRVLGFDAIGTVEAIGP
CADH2_EUCGU     ---------------TYSLRNTGPEDLYIKVLSCGVCHSDIHQIKNDLGMSHYPMXXXXXXXXXXXXXXX
ADH6_RAT        -KATVLWKPGALAIEEIEVAPPKAKEVRIKMVATGVCGTDIKHLDTQELSKFCPMIMXXXXXXXXXXXXX
QORL2_MOUSE     --ALCTELKQPLTIQEVAPRPVGPQEVRVDVHFCGVNFADILACRGYQEKPPLPFTPGMEFSGAVLETGT
CADH1_ARACO     ---------------TYTLRETGPEDVFIKIIYCGICHTDIHQIKNDLGASNYPMXXXXXXXXXXXXXXS
ADH1_STRCA      --AVLWEPKKPFSIEEVEVAPPKAHEVRVKIIATGICRSDDHVISG-VLVMPFPIILGHXXXXXXXXXXX
ADH1_ENTHI      ----------------KKIPECGPLDALVRPLALAPCTSDTHTVWAGAIGDRHDMILGHEAVGQIVKVGS
QOR_LEIAM       -------RSSTSVVEAH-LPEEVPGMVRVSVKYAGVNASDLNFTNGYFKNVQPPFDCGFEAAGTVVQIGA
QORL2_RAT       --AVCTELKQPLTIQEVAPRPIGPQEVRVDVHFCGINFADNLVCRGYQEKPPLPFTPGMEFSGVVLEAGA
ZDH1_STAES      ------------------IPHPSGHELLVKVQSISVNPVDTK--QRTMPVDKVPRVLGFDAVGVIEKIGD
ZDH1_STAEQ      ------------------IPHPSGHELLVKVQSISVNPVDTK--QRTMPVDKAPRVLGFDAVGVIEKIGD
QOR_MOUSE       --------PEVLKLQSDVVPVPQSHQVLIKVHACGVNPVETYIRSGYSRKPALPYTPGSDVAGIIESVGD
ZADH2_HUMAN     ------------------VPLPGDGDLLVRNRFVGVNASDINYSAGYDPSVKPPFDIGFEGIGEVVALGL
QOR_RAT         --------PEVLKLQSDVVPAPQSHQVLIKVHACGVNPVETYIRSGYSRKPALPYTPGSDVAGIIESVGD
FADH_PICPA      --AVAWEAGKDLSIEEIEVLPPRAHEVRVKVEFTGVCHTDAYTLSGADAEGSFPVVFXXXXXXXXXXXXX
ZADH2_BOVIN     ------------------VPLPGDGDLLVRNRFVGVNASDINYSAGYDPSVKTPFDAGFEGVGEVVALG-
YGD6_SCHPO      -----------------------PGEVLVKLKAASLNYRDLIITKGXXXXXXXXXXXGSDGAGIIEKVGE
QOR_SALTY       --------------------EPAEHEIQVENKAIGINFIDTYIRSGLYPPPSLPAGLGTEAAGVVSKVGN
ADHX_CAEEL      -----------LSIETIQVAPPKAHEVRVKILYTAVCHTDAYTLDGHDPEGLFPVVLXXXXXXXXXXXXX
ADH1_NAJNA      --AIAWELNKPLSIEQIEVAPPKAHEVRIKILATGVCRSDEHVISGAFRM-PLPMVLXXXXXXXXXXXXX
YGGP_ECOLI      ------------------LPEITDNELLVSVISDSVCLSTSEHKRVPDDLENHPVITGHECAGVIVEVGK
TARJ_BACSU      -----------------------------------ICAADQRYYTGSRGKEKLPMALIHEGIGKV--MFD
ADH7_MOUSE      ------------SIEEIEVAPPKAKEVRVKILATGICRTDDHIIKG-SMVSKFPVIXXXXXXXXXXXXXX
ZADH2_MOUSE     ------------------VPLPGDGDLLVRNRFVGINASDINYSAGYDPSLKPPFDIGFEGIGEVVALGL
VAT1_DANRE      -------------------PALKSGEVMVRVKMCGLNFADLMARQGYDRLPSPPVTPGMECSGVIEAVGE
YHFP_BACSU      ------------TISTEDLPKDG---VLIKVAYSGINYKDGLAGKGGNIVREYPLILG------IDAAGT
ADH2_KLUMA      ---IFYENGGQLYYKDIPVPKPKSNELLINVKYSGVCHTDLHAWKGDWPLTKLPLXXXXXXXXXXXXXXD
CADH_POPDE      ---------------TYSLRDTGPEDVFIKVISCGVCHTDIHQIKNDLGMSHYPMXXXXXXXXXXXXXXS
ADHL4_ARATH     -----------LVMEDVKVDPPQRLEVRIRILFTSICHTDLSAWKGENEAQRYPRILGHXXXXXXXXXXX
MAO1_SHEWM      ----------------------------------------------------------------------
VAT1_TORCA      ----------------KGVPTLKSDEILVRVQACGLNFSDLLVRQG--AFGKH-HSLGTECAGVVEAIGD
PKS7_DICDI      ---------------------------------------------------------GYEFSGIITRVGN
DHG_THEAC       -KAIVTDAPKGVKYTTIDMPEPEHYDAKLSPVYIGICGTDRGEVAGYNPEGENFLVLGHEALLRVDDARD
PKS5_DICDI      -------------------------QVEVKTIATGINNKDYLVYSGEGSVNSNTPQFGYEFSGIITRVGN
RT4I1_DICDI     ------------------VPKPIKSQVLIKIHSTSINPLDNVMRKGYASSIKLPIILGRECSGEIVEIGD
PKS9_DICDI      ---------------------------------------------------------GYEFSGIITRVGN
PKS8_DICDI      ---------------------------------------------------------GYEFSGIITRVGN
MECR_DROME      ------EPQEVLQLVEDKLPDPKDNQVLVKILAAPINPADINTIQGKYPVKKFPAVGGNECVAEVICVGD


                         .         .         *         .         .         .         .:140
query           NVNRDRIGERVSVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEYAVAPARNAHRIPDNIADHHA
RSPB_ECOLI      GVESARVGERVAVDPVVSCGHCYPCSIGKPNVCTTLAVLGVHADGGFSEYAVVPAKNAWKIPEAVADQYA
YJMD_BACSU      NVQSLKPGDHVVIEPISYCGSCYACRKGRPNVCAKLSVFGVHEDGGMREYIVLPERQLHAVSKDLPWEEA
Y053_HAEIN      GMSXXXXXXXXXXXPYVCCGQCYPCSIGRTNCCESLKVIGVHIDGGMQEVIRHPAHLLTKVPDNLPIHQL
YDJJ_ECOLI      RVRKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPNGALTHYLCHPESFTYKLPDNMDTMEG
DHSO_BACSU      SVDQFKVGDRVAVEPGVTCGRCEACKEGRYNLCPDVQFLATPPDGAFVQYIKMRQDFVFLIPDSLSYEEA
IDND_VITVI      EVKNLVAGDRVALEPGISCNRCSLCRNGQYNLCREMKFFGPPTNGSLANQVVHPSNLCFKLPDNVSLEEG
DOIAD_STRFR     PRGADLVGRNVVGDLTCSCGTCAHCAAGTPTLCEDLGELGFTRDGACAEYMTVPVANXXXXXXXXXXXXA
TDH_THET8       GVRRPQVGDHVSLESHIVCHACPACRTGNYHVCLNTQILGVDRDGGFAEYVVVPAENAWVNPKDLPFEVA
TDH_THET2       GVKRPQVGDHVSLESHVVCHACPACRTGNYHVCLNTKILGVDRDGGFAEYVVVPAENAWVNPKDLPFEVA
TDH_COXBU       AASALAVGDRVSGEGHITCGDCRNCRAGKRHLCRYTVGVGVNRPGAFAEYLVIPAKNAYKIPAKISDDIA
TDH_COXBR       AASALAVGDRVSGEGHITCGDCRNCRAGKRHLCRYTVGVGVNRPGAFAEYLVIPAKNAYKIPAKISDDIA
TDH_COXBN       AASALAVGDRVSGEGHITCGDCRNCRAGKRHLCRYTVGVGVNRPGAFAEYLVIPAKNAYKIPAKISDDIA
TDH_COXB2       AASALAVGDRVSGEGHITCGDCRNCRAGKRHLCRYTVGVGVNRPGAFAEYLVIPAKNAYKIPAKISDDIA
TDH_ERWCT       EVNGFHIGDRVSGEGHITCGYCRNCRAGRRHLCRNAIGVGVNRPGSFAEYLVIPAYNAFRIPDNISDELA
DHSO_BACHD      GVTGFNVGDRVTSETTYSCGKCSYCTSGDYNLCSHRKGLGNQQDGSFAKYVIARQESLHHLPAGVDDRSA
TDH_VIBPA       EVRGFEIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNREGAFAEYLVIPAFNAFKIPDEISDDLA
TDH_BACSU       NVSSVKVGEYVSAETHIVCGECVPCLTGKSHVCTNTAIIGVDTAGCFAEYVKVPADNIWRNPADMDPSIA
TDH_AERS4       EVRGFAVGDRVSGEGHITCGHCRNCRAGRTHLCRNTIGVGVNRPGSFAEYLVIPAFNAFKLPDNIPDELA
TDH_EDWI9       EVRGFRIGDRVSGEGHITCGHCRNCRAGRTHLCRNTIGVGVNRQGAFAEYLVIPAFNAFKIPDNIPDALA
TDH_YERPY       EVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELA
TDH_YERPS       EVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELA
TDH_YERPP       EVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELA
TDH_YERPN       EVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELA
TDH_YERPG       EVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELA
TDH_YERPE       EVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELA
TDH_YERPB       EVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELA
TDH_YERPA       EVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELA
TDH_YERP3       EVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELA
TDH_PHOLL       EVKGFKIGDRVSGEGHITCGYCRNCRGGRTHLCRNTIGVGVNRAGCFAQYLVIPAFNAFKIPDNISDELA
TDH_YERE8       EVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELA
TDH_THEON       GVDTINVGDYISAETHIVCGKCYACKHNRYHVCQNTKIFGVDMDGVFAEYAIVPAQNAWKNPKDMPPEYA
DOIAD_STRSD     GPGAELVGRDVVGDLTXXXXXXXXXXXXTPVLCENLQELGFTRDGACAEYMTIPTGNLHVLPEGLSLRAA
TDH_MESSB       AVTEYRIGQRVSGEGHIVCGHCRNCRAGRGHLCRNTLGVGVHRPGAFAEYISLPQHNVVAIPDDVPDEIA
TDH_AERHH       EVRGFAVGDRVSGEGHITCGHCRNCRAGRTHLCRNTIGVGVNRPGAFAEYLVIPAFNAFKLPDNVPDELA
TDH_SHEB8       EVRGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDISDDLA
TDH_SHESM       EVRGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDISDDLA
TDH_SHESA       EVRGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDISDDLA
TDH_SHEB9       EVRGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDISDDLA
TDH_SHEB5       EVRGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDISDDLA
TDH_SHEB2       EVRGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDISDDLA
TDH_SHESW       EVRGFNIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDISDDLA
TDH_DEIDV       EVRGFNVGDRVSGEGHVTCGHCRNCRAGRRHLCRNTLGVGVNRPGSFAEYLVLPAFNAFKLPDDIPDDVA
DOIAD_STRRY     GA-ADLVGQNVVGDLTVACGSCRHCTVGKPTLCADLQELGFTRDGACAEYMTVPTGNLHRLPEGLSLREA
TDH_SHESR       EVRGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDISDDLA
TDH_SERP5       EVKGFTVGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELA
TDH_SHEON       EVRGFNIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDISDDLA
DOIAD_STRKN     ANGHDQVGKNVVGDLTXXXXXXXXXXXXTPVLCENLQELGFTKDGACAEYMTIPVDNLRPLPDALSLRSA
TDH_BACA2       HVTNVKTGDYVSAETHFVCGTCVPCLTGKHHVCTHTKILGVDTAGSFAEYVKVPARNVWKNPADMDPAVA
TDH_SHEPC       EVRGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDISDDLA
TDH_CHRVO       EVQGFKIGQRVSGEGHITCGYCRNCRAGRRHLCRNTTGVGVNREGAFAEYLVIPAFNAFPIPDDISDDLA
YJJN_ECOLI      NIADLKNGQQVAVIPYVACQQCPACKSGRTNCCEKISVIGVHQDGGFSEYLSVPVANI--LPDGIDPQAA
TDH_DEIRA       EVRGFEIGDRVSGEGHVTCGHCRNCRAGRRHLCRNTQGVGVNRPGSFAEYLVLPAFNAFKLPDDIPDDVA
TDH_RHIEC       AVTRYHVGERVSGEGHIVCGKCRNCRAGRGHLCRNTLGVGVNRPGSFGEFVCIPESNVVPIPDDISDEIA
TDH_PSEHT       EVRGFKVGDRVSGEGHITCGHCRNCRAGRVHLCRNTTGVGVNREGAFAEYLVIPAFNAFKIPDNISDELA
TDH_BURPP       EVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLVIPAFNAFKIPPEISDDLA
TDH_RHILW       AVTRYHVGERVSGEGHIVCGKCRNCRAGRGHLCRNTLGVGVNRPGSFGEFVCIPESNVVAIPEDISDEIA
TDH_RHIL3       AVTRYHVGERVSGEGHIVCGKCRNCRAGRGHLCRNTLGVGVNRPGSFGEFVCIPESNVVPIPDDISDEIA
TDH_BURVG       EVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
DOIAD_STRRI     PLGAELIGTNVVGDLTVSCGTCAHCTARTPTLCEDLGELGFTRDGACAEYMTIPVGNLRRLPDTLPLRAA
TDH_BURP8       EVRGFSIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLVIPAFNAFKIPPEISDDLA
TDH_BURM1       EVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_FRATN       GVTSVDIGDRVSGEGHLVCGQCRNCRAGKRHLCRKTIGIGVNVQGAFAEYLVMPAVNVFKIPDSISDDIA
TDH_BURS3       EVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_FRATW       GVTSVDIGDRVSGEGHLVCGQCRNCRAGKRHLCRKTIGIGVNVQGAFAEYLVMPAVNVFKIPDSISDDIA
TDH_FRATT       GVTSVDIGDRVSGEGHLVCGQCRNCRAGKRHLCRKTIGIGVNVQGAFAEYLVMPAVNVFKIPDSISDDIA
TDH_FRATO       GVTSVDIGDRVSGEGHLVCGQCRNCRAGKRHLCRKTIGIGVNVQGAFAEYLVMPAVNVFKIPDSISDDIA
TDH_FRATM       GVTSVDIGDRVSGEGHLVCGQCRNCRAGKRHLCRKTIGIGVNVQGAFAEYLVMPAVNVFKIPDSISDDIA
TDH_FRATH       GVTSVDIGDRVSGEGHLVCGQCRNCRAGKRHLCRKTIGIGVNVQGAFAEYLVMPAVNVFKIPDSISDDIA
TDH_FRATF       GVTSVDIGDRVSGEGHLVCGQCRNCRAGKRHLCRKTIGIGVNVQGAFAEYLVMPAVNVFKIPDSISDDIA
TDH_FRAT1       GVTSVDIGDRVSGEGHLVCGQCRNCRAGKRHLCRKTIGIGVNVQGAFAEYLVMPAVNVFKIPDSISDDIA
TDH_BURXL       EVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLVIPAFNAFKIPPEISDDLA
TDH_BURPS       EVRGFSIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_BURP6       EVRGFSIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_BURP1       EVRGFSIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_BURP0       EVRGFSIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_BURMS       EVRGFSIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_BURMA       EVRGFSIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_BURM9       EVRGFSIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_BURM7       EVRGFSIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_BURCJ       EVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_BURCH       EVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_BURCC       EVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_BURCA       EVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_SHESH       EVRGFDVGDRVSGEGHITCGHCRNCRGGRTHLCRNTSGVGVNRDGAFAEYLVIPAFNAFKIPDDISDDLA
TDH_SACEN       AVTQAQVGDFVSGEGHLVCGTCRNCRAGRRHLCANTRGLGVHHNGAFAEYAVLPEQNVWVHREHVDPDVA
TDH_BURTA       EVRGFSIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_RHISN       AVTKHHVGERVSGEGHIVCGKCRNCRAGRGHLCRNTLGVGVNRPGSFAEFVCLPEYNVVTIPDDVPDEIA
TDH_COLP3       EVKGFTLGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRAGSFAEYLVIPAYNAFKLPDEISDDLA
TDH_AGRRK       AVTKYHVGERVSGEGHIVCGKCRNCRAGRGHLCRNTLGVGVNRPGSFGEFVCIPESNVVPIPDDIPDEVA
TDH_SINMW       AVTKHHVGERVSGEGHIVCGKCRNCRAGRGHLCRNTLGVGVNRPGSFAEFVCLPEYNVVSIPDDVPDEIA
TDH_SHEWM       EVRGFSIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNRDGAFAEYLVIPAFNAFKIPDDISDDLA
TDH_RHIME       AVSKHHVGERVSGEGHIVCGKCRNCRAGRGHLCRNTLGVGVNRPGSFAEFVCLPEYNVVSIPDDVPDEIA
TDH_RHIE6       AVTRYHVGERVSGEGHIVCGKCRNCRAGRGHLCRNTLGVGVNRPGSFGEFVCIPESNVVPIPDDISDEIA
TDH_FRAP2       GVTSVDVGDRVSGEGHLVCGQCRNCRAGKRHLCRKTIGIGVNVQGAFAEYLVMPAVNVFKIPDSISDDIA
DHSO_PONAB      LVKHLKPGDRVAIEPGAPRENDEFCKIGRYNLSPSIFFCATPDDGNLCRFYKHNAAFCYKLPDNVTFEEG
DHSO_BOMMO      KVSSLRVGDRVAIEPTQPCRSCELCKRGKYNLCVERYCSSMGAPGNLCRYYKHVADFCHKLPDNLTMEEG
TDH_BURCM       EVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
TDH_BURA4       EVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLA
DHSO_HUMAN      SVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPDDGNLCRFYKHNAAFCYKLPDNVTFEEG
TDH_THETN       NVTSVKVGDLVSAETHIVCGKCRACRTGNAHICENTLILGVDTDGAFAEYIKVPESNVWINDKNIPLEIL
TDH_SHEFN       EVRGFSIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNRDGAFAEYLVLPAFNAFKIPADIPDDLA
TDH_BACLD       NVTTVKEGEYVSAETHIVCGKCLPCLTGKEHVCKKTLILGVDTDGCFAEYVKMPAANIWKNPAGMPEDLA
TDH_PYRHO       XXXXXXXXDYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYA
TDH_IDILO       GVRGFEIGDRVSGEGHITCGHCRNCRAGRRHLCRNTYGVGVNRPGAFAEYLALPAENAFKLPDDVTDEMA
TDH_RHILO       AVTEYKVGQRVSGEGHIVCGHCRNCRAGRGHLCRNTLGVGVNRPGAFGEYLAIPQHNVVPIPDDVPDEIA
TDH_PECCP       EVNGFHIGDRVSGEGHITCGYCRNCRAGRRHLCRNAIGVGVNRPGSFAEYLVIPAYNAFRIPDNISDELA
TDH_PROMH       EVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNIPDELA
DOIAD_STRLV     GADSXXXXXXXXXXXTCSCGTCRHCAEGKPTLCGDLQELGFTRDGACAEYMTIPAANLHRLPPGTSLRAA
TDH_SYMTH       EVTACKVGDYVSAETHIVCNRCPRCHMGEYHLCENTKILGVDTDGAFAEYVAVPEQNIWVNDKDIPFELQ
DHSO_MACFA      LVKHLKPGDRVAIEPGVPRENDEFCKSGRYNLSPSIFFCATPDDGNLCRFYKHNAAFCYKLPDNVTFEEG
TDH_STRAW       DVVDIKAGDRVSGEGHLVCGKCRNCQAGRRHLCRATVGLGVGRDGAFAEYVALPAANVHRVPVDL--DVA
TDH_ANADF       XXXXFHPGDRVSGEGHVTCGFCRNCRAGRRHLCRHTIGVGVNRPGSFAEYVVIPADNVYRIPDDIPDEVA
TDH_PYRFU       XXXXXXXXDYVSVETHIVCGKCYACKRGQYHVCQNTKIFGVDTDGVFAEYAVVPAQNVWKNPKNIPPEYA
TDH_STRGG       DVADIATGDLVSGEGHLVCGKCRNCLAGRRHLCRSTVGLGVGRDGAFAEYVVLPASNVHRVPVDL--DIA
DHSO_SHEEP      LVRHLQPGDRVAIQPGAPRQTDEFCKIGRYNLSPTIFFCATPDDGNLCRFYKHNANFCYKLPDNVTFEEG
TDH_PYRAB       XXXXXXXXDYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVDTDGVFAEYAVVPAQNVWKNPKSIPPEYA
TDH_MARMS       EVSGFKIGDRVSGEGHITCGHCRNCRAGRRHLCRKTLGVGVNRTGAFAEYLVIPASNAFKIPNNISDDMA
DHSO_RAT        MVKHLKPGDRVAIEPGVPREIDEFCKIGRYNLTPSIFFCATPDDGNLCRFYKHSADFCYKLPDSVTFEEG
DHSO_MOUSE      LVKHLKPGDRVAIEPGVPREVDEYCKIGRYNLTPTIFFCATPDDGNLCRFYKHNADFCYKLPDSVTFEEG
TDH_PYRKO       XXXDLQVGDYISVETHIVCGKCYACKHNRYHVCQNTKIFGVDMDGVFAHYAIVPAKNAWKNPKDMPPEYA
DHSO_BOVIN      LVRHLQPGDRVAIEPGAPRETDEFCKIGRYNLSPTIFFCATPDDGNLCRFYKHNANFCYKLPDNVTFEEG
TDH_STRMK       AVTGYEIGQRVSAEGHIVCGHCRNCRGGRPHLCPNTVGIGVNVNGAFAEYMVMPASNLWPIPDQIPSELA
TDH_ESCF3       EVKGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_LEGPH       EVQGLKVGQRVSGEGHITCGFCRNCRAGKRHLCRNTLGVGVNRPGCFAEYLALPATNVIALPDNITEEQA
TDH_LEGPC       EVQGLKVGQRVSGEGHITCGFCRNCRAGKRHLCRNTLGVGVNRPGCFAEYLALPATNVIALPDNITEEQA
TDH_ENTS8       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_LEGPA       EVQGLKVGQRVSGEGHITCGFCRNCRAGKRHLCRNTLGVGVNRPGCFAEYLALPATNVIALPDNITEEQA
TDH_KLEP7       EVRGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_KLEP3       EVRGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_LEGPL       EVQGLKVGQRVSGEGHITCGFCRNCRAGKRHLCRNTLGVGVNRPGCFAEYLALPATNVIALPDNITEEQA
TDH_SHEAM       EVRGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTTGVGVNREGSFAEYLVIPAFNAFKIPDDISDDLA
XYLD_MORMO      NVKHLKVGDRVCMEPGIPDLQSPQSRAGIYNLDPAVRFWATPPDGCLRESVIHPAAFTFKLPDNVSFAQG
TDH_ECOLI       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECODH       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECOBW       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
DHSO1_YEAST     AVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPDGTLVKYYLSPEDFLVKLPEGVSYEEG
TDH_SALTY       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SALSV       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SALPK       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SALPC       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SALPB       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SALPA       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SALNS       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SALHS       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SALEP       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SALDC       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SALCH       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SALA4       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECOLU       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_CITK8       EVKGFRIGDRVSGEGHITCGHCRNCRGGRTHLCRNTLGVGVNRPGCFAEYLVLPAFNAFKIPDNISDDLA
TDH_STRCO       DVTDIKAGDRVSGEGHLVCGKCRNCLAGRRHLCRATVGLGVGRDGAFAEYVALPASNVHRVPVDL--DVA
TDH_SHIFL       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SHIF8       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SHIBS       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SHIB3       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SALTI       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_SALAR       EVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECOUT       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECOSM       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECOSE       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECOLC       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECOL6       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECOL5       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECOK1       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECOHS       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECO8A       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECO81       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECO7I       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECO5E       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECO57       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECO55       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECO45       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ECO27       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
DHSO2_YEAST     AVTRVKVGDRVAIEPGVPSRYSDETKEGSYNLCPHMAFAATPPDGTLVKYYLSPEDFLVKLPEGVSYEEG
TDH_XANC5       AVTGYQVGQRVSAEGHIVCGHCRNCRGGRPHLCPNTVGIGVNVNGAFAEYMVMPASNLWLIPDQIPSELA
TDH_SHISS       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_PSYIN       EVRGFSVGDRVSGEGHITCGHCRNCRAGRTHLCRNTIGVGVNRTGAFAEYLVIPAFNAFKIPAGISDDLA
TDH_ENT38       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ALTMD       EVKGFEVGDRVSGEGHITCGHCRNCRAGRVHLCRNTEGVGVNRPGAFAEYLVIPAFNAFKIPDNISDDLA
GATD_ECOLI      GVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDG
GATD_ECO57      GVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDG
XYL2_YEAST      NVKTLKVGDRVALEPGIPDRFSPEMKEGRYNLDPNLKFAATPPDGTLTKYYKTMKDFVYKLPDDVSFEEG
TDH_SALG2       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRPGCFAEYLVIPALNAFKIPDNISDDLA
TDH_VIBCM       EVRGFQIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRTGCFSEYLVIPAFNAFKIPDGISDDLA
TDH_VIBCH       EVRGFQIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRTGCFSEYLVIPAFNAFKIPDGISDDLA
TDH_VIBC3       EVRGFQIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRTGCFSEYLVIPAFNAFKIPDGISDDLA
TDH_XANOR       AVTGYQVGQRVSAEGHIVCGHCRNCRGGRPHLCPNTMGIGVNVNGAFAEYMVMPASNLWPIPDQIPSELA
TDH_XANOM       AVTGYQVGQRVSAEGHIVCGHCRNCRGGRPHLCPNTMGIGVNVNGAFAEYMVMPASNLWPIPDQIPSELA
TDH_XANAC       AVTGYQIGQRVSAEGHIVCGHCRNCRGGRPHLCPNTVGIGVNVNGAFAEYMVMPASNLWPIPDQIPSELA
TDH_SHELP       EVRGFQIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNREGAFAEYLVIPAFNAFKIPDDISDDLA
XYLD_AGRT5      DVTHLKIGDRVCMEPGIPDPTSRASKLGIYNVDPAVATPPIH--GCLTPEVIHPAAFTYKLPDNVSFAEG
TDH_ECO24       EVKGFMIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLA
TDH_ANASK       EVEAFRPGERVSGEGHVTCGFCRNCRAGRRHLCRHTVGVGVNRPGSFAEYVVIPADNVYRXXXXXXXXXX
TDH_SHIDS       EVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPGNISDDLA
TDH_ANAD2       EVEAFRPGERVSGEGHVTCGFCRNCRAGRRHLCRHTVGVGVNRPGSFAEYVVIPADNVYRXXXXXXXXXX
IDND_ECOLI      DSSELHEGQTVAINPSKPCGHCKYCIEHNENQCTDMRFFGSHVDGGFTRYKMVETSQCVPYPAKADEKVM
TDH_XANCP       AVTGYQVGQRVSAEGHIVCGHCRNCRGGRPHLCPNTVGIGVNVNGAFAEYMVMPASNLWPIPDQIPSELA
TDH_XANCB       AVTGYQVGQRVSAEGHIVCGHCRNCRGGRPHLCPNTVGIGVNVNGAFAEYMVMPASNLWPIPDQIPSELA
TDH_XANC8       AVTGYQVGQRVSAEGHIVCGHCRNCRGGRPHLCPNTVGIGVNVNGAFAEYMVMPASNLWPIPDQIPSELA
TDH_VIBVU       EVRGFEIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRTGCFSEYLVIPAFNAFKIPANISDDLA
TDH_PROAC       EVNDLEVGQFVSGEGHYVCGRCRACLAGKRHLCRNTQGIGYAVNGAYCQYFVMPAGNVHHIPDLDPDVAA
TDH_VIBVY       EVRGFEIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRTGCFSEYLVIPAFNAFKIPANISDDLA
TDH_SHEHH       EVRGFTIGDRVSGEGHITCGHCRNCRGGRTHLCRNTSGVGVNREGAFAEYLVIPAFNAFKIPDDISDDLA
TDH_PSEA6       XXXXFAIGDRVSGEGHITCGHCRNCRAGRRHLCRNTSGVGVNRAGAFAEYLSIPAFNAFKIPDNISDDLA
TDH_SHEPA       EVRGFTIGDRVSGEGHITCGHCRNCRGGRTHLCRNTSGVGVNREGAFAEYLVIPAFNAFKIPDDISDDLA
TDH_VIBF1       EVRGFEIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRTGAFSEYLVIPAFNAFKIPAGISDDLA
TDH_SOLUE       NVADFFPGDIVSGEGHVVCGRCRNCFAGRRHLCAKTMGVGVNRPGAFAEYIALPMTNIWRHHEGIDLDVA
TDH_VIBFM       EVRGFEIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRTGAFSEYLVIPAFNAFKIPAGISDDLA
ADH1_ZYMMO      GVTSLKVGDRASVAWFFKCGHCEYCVSGNETLCRNVENAGYTVDGAMAEECIVVADYSVKVPDGLDPAVA
TDH_VIBSL       EVRGFEIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRTGAFSEFLVIPAFNAFKIPAEISDDLA
TDH_PARUW       NVKGFKIGERVCGEGHIVCNQCPNCRMGRKHVCMHTKGLGYHISGCFAEYFVLPAENVFSLPPSISDDLG
DOIAD_MICEC     GYE-SWVGRPVTGDLIVGCQGCGPCRDGLPVMCENLIEIGFTVDGGCAGYVAVPITNLYLLPEGMDLAAA
YDJL_ECOLI      KVKDWKVGQRVSDNSGHVCGVCPACEQGDFLCCTEKVNLGLDNNGGFSKYCLVPGEKIHRIPDGVDYEDA
TDH_ALISL       EVRGFEIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRTGAFSEFLVIPAFNAFKIPAGISDDLA
TDH_PHOPR       EVRGFTIGDRVSGEGHITCGHCRNCRGGRTHLCRNTTGVGVNRDGAFAEFLVIPAFNAFKIPAGISDDLA
ADH_SULTO       EVVGYSKGDLVAVNPWEGEGNCYYCRIGEEHLCDSPRWLGINYDGAYAEYVLVP---HYKYLYKLRRLSA
ADH2_BACST      GVKSIKVGDRVGIPWLYSCGECEYCLTGQETLCPHQLNGGYSVDGGYAEYCKAPADYVAKIPDNL---DP
XYLD_RHILO      NVETFKAGDRVCMEP------------GVPNLSSRATKLGIYNHGVLAPYAVHPAAFTYKLPDNVSFAEG
ADHP_ECOLI      GVTSLKPGDRASVAWFYECGHCEYCNSGNETLCRSVKNAGYSVDGGMAEECIVVADYAVKVPDGLDSAAA
YPHC_ECOLI      GCRHFKEGDRVLVYHISGCGFCPNCRRGFPISCTGKAAYGWQRDGGHAEYLLAEEKDLILLPDALSYEDG
TDH_ANADE       XXXXFRPGERVSGEGHVTCGFCRNCRAGRRHLCRHTVGVGVNRPGSFAEYVVIPADNVYRXXXXXXXXXX
YBDR_ECOLI      DVKNLQKGDRVVIPFVIACGDCFFCALNKKQIPAPAALFGYSHPGGQAEYVRVPKGNVFKVPPLLSDDKA
XYLD_RHIME      QVRHLKKGDRVCMEPGIPDLSSRSSKLGIYNVDPSVATPPVH--GCLTPEVVHPAAFTYRLPDHVSFAEG
BDHA_BACSU      XXXNYKVGDRVVVEPIFATGH-----QGAYNLDEQMXXXXXXXXXXXSEYVSVDEELLFKLPDELSYEQG
ADH_STAAW       DVESLKIGDRVSIAWMFSCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAA
ADH_STAAS       DVESLKIGDRVSIAWMFSCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAA
ADH_STAAR       DVESLKIGDRVSIAWMFSCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAA
ADH_STAAN       DVESLKIGDRVSIAWMFSCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAA
ADH_STAAM       DVESLKIGDRVSIAWMFSCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAA
ADH_STAAC       DVESLKIGDRVSIAWMFSCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAA
ADH_STAAB       DVESLKIGDRVSIAWMFSCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAA
ADH_STAA8       DVESLKIGDRVSIAWMFSCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAA
ADH_STAA3       DVESLKIGDRVSIAWMFSCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAA
ADH_SULSR       EVVGYSKGDLVAVNPWQGEGNCYYCRIGEEHLCDSPRWLGINFDGAYAEYVLNP---HYKYMYKLRRLNA
ADH1_KLUMA      NVTGWEIGDYAGIKWLNSCMSCEECELSNEPNCPKADLSGYTHDGSFQQYATADAVQAARIPKNVAEVAP
XYL2_PICST      GVTSLKVGDNVAIEPGIPSRFSDEYKSGHYNLCPHMAFAATNPPGTLCKYFKSPEDFLVKLPDHVSLELG
ADH1_BACST      XXTHLKVGDRVGIPWLYSCGHCDYCLSGQETLCERQQNAGYSVDGGYAEYCRAAADYVVKIPDNLSFEEA
ADH3_BACST      XXTHLKVGDRVGIPWLYSCGHCDYCLSGQETLCEHQKNAGYSVDGGYAEYCRAAADYVVKIPDNLSFEEA
ADH_RALEU       AVTGYREGQRVIAGAICPNFNSYAAQDGVASQDGSYLMCGCHGDGTQAEYVLVPDAQANPIPDGLTDEQV
ADH_STAEQ       NVDSLKVGDRVSIAWMYACGNCEYCTTGRETLCRDVLNAGYTVDGAMAEEVIVDANYAVKVPENLDPAAA
ADH_STAES       NVDSLKVGDRVSIAWMYACGNCEYCTTGRETLCRDVLNAGYTVDGAMAEEVIVDANYAVKVPENLDPAAA
ADH5_YEAST      NVKGWKVGDFAGIKWLNTCMSCEYCEVGNESQCPYLDGTGFTHDGTFQEYATADAVQAAHIPPNV-----
ADH5_SACPS      NVKGWKVGDFAGIKWLNTCMSCEYCEVGNESQCPYLDGTGFTHDGTFQEYATADAVQAAHIPPNV-----
ADH6_PERMA      GVSTVKTGDKVIILCLPQCGECNTCLNSKNNICKEVRLSGTHTTGTFSEYIVIKEISVAKVDEDALLEKA
ADHL_GADMO      GVTKFKSGDAVIPLYVPQCGECKFCKNPKTNLCQKIVLFHFMGSSTFSEYTVVAEISLAKVHEK-APLDK
TDH_SILPO       DVTGLSIGQRVSGEGHLIGTESRQSRAGKFHLDPGTRGIGVNVQGAFAQYLRLPAFNVVPLPEDIPDEIG
ADH_SULSO       EVVGYSKGDLVAVNPWQGEGNCYYCRIGEEHLCDSPRWLGINFDGAYAEYVIVP----------------
ADHB_BACSU      GVTKLKKGDRVIIPFNIACGECFFCKNQLESQCDQXXXXXXXXXXXXAEYLRVPFANHFKIPESCEEPDS
FADH_METMR      XXTSLKTGDRVVVPFTISCGHCFCCDTSNPNADMARKAMGSHMLGGFAEYLRVPYADVGKITSDLPDDKV
FADH_AMYME      GVDSVQPGDYVVLNWRAVCGQCRACKRGRPQYCFSTFALGI---GAFADKTLVHAGQCTKV-DPAADPAV
BDH1_YEAST      XXXXXXXXXXXXXDAASSCAHCWPCQRGSENLCTGFVGLGVI-SGGFAEQVVVSQHHIIPVPKEIPLDVA
YHG1_SCHPO      EVNNLEIGDRVVIAFDLACGQCSFCKRHEYAACDTTVNYGSHHSAIFAEYIRVPFANCCKLPDDIPDSEG
ADHA_RHIME      EVTRLKEGDRVGVPWLTACGCCTPCRTGWETLCGSQQNTGYSVDGTFAQYGLADPDFVGRLPARLEFGPA
ADHP_RABIT      GVTNVKPGDKVIPLYIPHCKKCKFCLSPLTNFCNPLIEQELMEDSAFSQYTVVKDVNLAKIDDD-ANLER
FADH_CANMA      GVTNVKVGDHVIALYTPECGECKFCKSGKTNLCGKIRATGVMPD-GTSRFTCKGKEILHFMGCSTFSQYT
CADH3_ARATH     NVTKFKEGDRVGVGVIISCQSCESCNQDLENYCPKVVFTGTRNQGGYSDVIVVDHRFVLSIPDGLPSDSG
ADH4_KLULA      NVKNFEIGDYAGIKWLNSCMSCELCEQGYESNCLQADLSGYTHDGSFQQYATADAVQAAQIPTDLAEIAP
ADHX_SPAAU      GVTKFKPGDTVIPLYVPQCGECKFCKNPKTNLCQKIRITGLLPDSTFSEYTVVADISLAKVNEKAPMDKV
ADHX_MYXGL      GVTKFKPGDSVIPLYIPQCGECKFCLNPKTNLCQKIRVTGMMPDGTFSEYAVVADISLCRVPDRVCLLGC
YYCR_BACSU      DVEFIKKGDIVSVPFNIACGRCVMCKTQKTHVC-----LNVNPDGGQSEYVMVPYADFQLLVFPDKEQAL
ADH1_EMENI      LVHEFEIGDQAGIKWLNSCGECEFCRQSDDPLCARAQLSGYTVDGTFQQYALGKASHASKIPAGV-----
CADH6_ARATH     KVSKFNLGDKVGVGCIVSCRTCESCREDQENYCTKAIATGVHHDGGYSDHIVVDERYAVKIPHTL-----
FADH_YEAST      DVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATGVMPDGTFSEYTV------------VADVSV
ADHX_HORSE      GVTKLKAGDTVIPLYIPQCGECKFCLNPQTNLCQKIRTTGLMPDGTFSEYTVVADISVAKI-DPLAPLDK
ADH1B_PAPHA     GVTTVKPGDKVIPLFTPQCGKCRVCKSPEGNYCVKNDLRGTLQDGTFSQYTVVDENAVAKI-DAASPLEK
ADH1B_PANTR     GVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLRGTLQDGTFSQYTVVDENAVAKI-DAASPLEK
ADHL7_ARATH     NVKEVVEGDTVLPTFMPDCGDCVDCKSHKSNLCSKFTLFHFLNVSSFSEYTVLDVANVVKIDSSIPPSRA
ADHL6_ARATH     GVTEFEKGDHVLAVFTGECGSCRHCISGKSNMCQ---VLGMERKGSFSEYTVVHSGCAVKV-DPLAPLHK
ADH4_STRCA      GVSKFKPGDKVIPLYMPQCGHCKFCLNPKTNLCTPISDQEVMSDGTFSEYTVVSESSLAKIDDKVCLIGC
ADH1S_HORSE     GVTTVRPGDKVIPLFIPQCGKCSVCKHPEGNLCLKNLSMGTMQDGTFSQYTVVDEISVAKI-DAASPLEK
CADH2_ARATH     NVTKFKEGDRVGVGVIISCQSCESCNQDLENYCPKVVFTGTSRNGGYSDVIVVDHRFVLSIPDGLPSDSG
ADH1B_HUMAN     GVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLRGTLQDGTFSQYTVVDENAVAKI-DAASPLEK
DHSO_SCHPO      XXSSLKPGDPVAVEPGCVCRLCDYCRSGRYNLCPHMEFAATPPDGTLRTYYITTEDFCTKLPKQISVEEG
ADHC_MYCTU      EVTKYRQGDRVGVGCFVSCRECNSCTRGIEQYCNSIGKDGQPTQGGYSEAIVVDENYVLRIPD-------
ADHC_MYCBO      EVTKYRQGDRVGVGCFVSCRECNSCTRGIEQYCNSIGKDGQPTQGGYSEAIVVDENYVLRIPD-------
ADH7_RAT        EVTTVRPGDKVIPLFLPQCRECNPCRNPEGNLCSDLTGRGVLADGTFTEYTVLDESSVAKIDAEAPPEKA
ADHX_PEA        GVTDVKPGDHVIPSYQAECGECKFCKSPKTNLCTGVGVMMADRTSTFSQYTVVHDVSVAKIPDAPLDKVC
ADHB_MYCTU      GVDDFAPGDHVVLAFIPSCGKCPSCQAGMRNLCAGLLAGESVTDGSFRIQAVYPMTLLGTFSPYMVVHRS
ADHB_MYCBO      GVDDFAPGDHVVLAFIPSCGKCPSCQAGMRNLCAGLLAGESVTDGSFRIQAVYPMTLLGTFSPYMVVHRS
ADH1A_HUMAN     GVTTVKPGDKVIPLAIPQCGKCRICKNPESNYCLKNDVQGTLQDGTFSQYTVVDENAVAKI-DAASPLEK
ADH1_ALLMI      GVTSLKPGDKVIPLFVPQCGECMPCLKSNGNLCSGLMADGTSRTSTFTEYTVVHETAVARI-DAAAPLEK
ADHX_ARATH      GVTEVQAGDHVIPCYQAECRECKFCKSGKTNLCRSATGVGIMMNDRKSRFSVNGKPIYHFMGTSTFSQYT
ADHH_GADMO      GVTKFKAGDTVIPLYVPQCGECKFCKNPKTNLCQKIRV--------------------------------
ADH3_YEAST      NVKGWKVGDLAGIKWLNSCMTCEFCESGHESNCPDADLSGYTHDGSFQQFATADAIQAAKI---------
ADHX_MAIZE      GVTDVQPGDHVIPCYQAECKECKFCKSGKTNLCRSATGVGVMMNDMKSRFSVNGKPIYHFMGTSTFSQYT
ADH2_CAEEL      KVKGWNIGDRAGIKLIANCLNCEYCKTGHEPLCDHIQNYGIDRHGTFQEYLTIRDIDAIKVSNNLAAAAP
MTDH_MEDSA      NVKKFRVGDNVGVGVIVSCQTCENCNQDLEQYCPKPVFTGTRTYGGYSDFVVVHQRYVVQFPDNL-----
ADHX_ORYSJ      GVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCRAATGVGVMMNDRKSRFSINGKPIYHFMGTSTFSQYT
ADHX_ORYSI      GVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCRAATGVGVMMNDRKSRFSINGKPIYHFMGTSTFSQYT
ADHX_DROME      GVTNFKAGDHVIALYIPQCNECKFCKSGKTNLCQKI----------------------------------
ADHQ_RABIT      GVNNFKPGDKVIPLYVPHCRKCKFCQSPLTNFCTKFSFLGI---SAFSQYTVVKDINLAKIDDD-ANLKR
XYLB_PSEPU      AVKKVQPGDHV-VLTFYTCGSCDACLSGDPTSCANSFVTGIHDHQGFATYALSYERNTVKVTKDVP---L
ADH8_RANPE      GVTCVKPGDKVIPLFVPQCGSCRACKSSNSNFC-------------------------------------
ADH1_PEA        GVTHLKPGDHALPVFTGECGECPHCKSEESNMCDLLVMLNVHHFVGFSEYTVVHAGCVAKIPDAPLDKVC
CADH1_ARATH     NVQRFKVGDHVGVGTYVSCRECEYCNEGQEVNCAKGVFTGIDHDGGYSSHIVVHERYCYKIPVDYPLESA
BDH2_YEAST      GVKNLKVGDKVVVEPTGTCRDCAACKKGYYNICSYLGLCGAGQSGGFAERVVMNESHCYKVPDFVPLDVA
ADH7_HUMAN      GVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCSDITGRGVLADGTFTEYTVVDESSVAKIDDAAPPEKV
ADH_SCHPO       XXTRLKIGDRVGVKWMSSCGNCEYCMKAEETICPHIQLSGYTVDGTFQHYCIANATHATIIPESVPLEVA
ADHX_OCTVU      GVTSVKPGDTVIPLYVPQCYECKFCLNPKTNLCQKIRVTGVMPDG-------------------------
ADH1E_HORSE     GVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKSMPRGTMQDGTFSQYTVVDEISVAKI-DAASPLEK
ADH3_HORVU      GVTELVPGDHVLPVFTGECKDCAHCKSEESNLC-DLLRINVDRDGTFSEYTVIHVGCLAKIPEAPLDKVC
FRMA_SYNY3      XXXXXQLGDHVIPLYTAECGKCLFCRSGKTNLCVAVRATGVMPDGTFSEYTVVAEVSLAKINPEANHEHV
CADH7_ORYSJ     NVARFKAGDEVGVGCMVTCGGCESCRDGCENYCSGGVVFSVDRDGGYSDAVVVSQR--------------
ADHX_BOVIN      GVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRV--------------------------------
ADH1_GEOAT      GVTTVKPGDKVIPLFVPQCGKCRACKHPESNLCT------------------------------------
ADH1_GEOKN      GVTTVKPGDKVIPLFVPQCGKCRACKHPESNLCT------------------------------------
YAHK_ECOLI      QVEKYAPGDLVGVGCIVSCKHCEECEDGLENYCDHMTGTPGHTLGGYSQQIVVHERYVLRI---------
ADHX_HUMAN      GVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTGLMPDGTFSEYTVVADISVAKI-DPLAPLDK
ADH6_PONAB      GVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCTQLMSDGTSRTSTFCEYTVIKEISVAKI-DAVAPLEK
ADH1_TRIRP      GVTHLKPGDHALPVFTGECGECPHCKSEESNMCN---LLRINTDRGFSEYTVVHAGCVAKIPDAPLDKVC
ADH1_CHICK      KVTSLKPGDAVIPLFVPQCGECRSCLSTKGNLCTGLMADGTTRTSTFTEYTVVHETAAAKI-DSAAPLEK
ADHX_UROHA      GVTKFKPGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTGVMPDG-------------------------
ADH3_EMENI      LVKDEKIGDRAGIKWLNSCLSCEMCMQADEPLCPHASLSGYTVDGTFQQYTIGKAALASKIPDNVPLDAA
CADH8_ARATH     KVTKFKTGEKVGVGCLVSCGSCDSCTEGMENYC-------------------------------------
FADH_PARDE      XXTSVKPGNHVIPLYTPECRQCASCLSGKTNLCTAIRATGLMPDGTFSNYTVLPEIAVAKVRED-APFDK
FADH1_SCHPO     GVINVRPGDHVILLYTPECKECKFCRSGKTNLCSKI----------------------------------
ADH6_YEAST      KSNSGKVGQRVGVGQVFSCLECDRCKNDNEPYCTKFVTTGYVSQGGYANYVRVHEHFVVPIPENIPSHLA
ADH1_GEOBU      GVTTVKPGDKVIPLFVPQCGKCRACKHPESNLC-------------------------------------
ADHX_RABIT      GVTNLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTGLMPDGTFSEYTVVADISVAKI-DPSAPLDK
ADHX_MOUSE      GVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRV--------------------------------
CADH9_ARATH     NVTKFKEGDRVGVGVISSCQSCESCDQDLENYCPQMSFTGTKNYGGYSENIVVDQRFVLRFPENL-----
CADH7_ARATH     KVKKFNAGDKVGVGYMASCRSCDSCNDGDENYCPKMILTSGAKNGGYSDHMVCAEDFIIRIPDNL-----
ADHX_RAT        GVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRV--------------------------------
ADH2_ORYSJ      GVTELAPGDHVLPVFTGECKECDHCKSEESNMCDLLVMIGDGKSSTFSEYTVIHVGCLAKIPEAPLDKVC
ADH2_ORYSI      GVTELAPGDHVLPVFTGECKECDHCKSEESNMCDLLVMIGDGKSSTFSEYTVIHVGCLAKIPEAPLDKVC
ADH1A_PONAB     GVTTVKPGDKVIPLAVPQCGKCRICKNPESNYC-------------------------------------
FADH2_SCHPO     QVTTVQVGDPVIALYTPECKTCKFCKSGKTNLC-------------------------------------
CADH3_ORYSJ     NVTRFKAGDRVGVGCMVSCRSCESCNNGFENHCPEGVFTSVDKDGGYSSMVVVHERFVVMFPE-------
ADH_SULAC       XXXXFKKSDKVLIDPWIGDGSCHYCKIGEDQYCDNPKWLGINVNGGYGEYVLVP----------------
ADH4_RAT        GVTNFKPGDKVIPFFAPQCKKCKLCLSPLTNLCGKLHFMGV---SSFSQYTVVSEANLARVDDEANLERV
ADH1_COTJA      KVTLLKPGDAVIPLFVPQCGECRSCLSTKGNLCTGLMADGTTRTSTFTEYTVVHETAAAKI-DSAAPLEK
CADH_PINTA      EVKKFKVGEHVGVGCIVSCRSCGNCNQSMEQYCSKRIWTGTPTQGGFASSMVVDQMFVVRIPENL-----
CADH_PINRA      EVKKFKVGEHVGVGCIVSCRSCGNCNQSMEQYCSKRIWTGTPTQGGFASSMVVDQMFVVRIPENL-----
ADHL5_ARATH     HVNGFQQGDVVLPVFHPHCEECRDCKSSKSNWCARFALSNTRRYGSFSEYTVVDIAHLVKIPDIPVDKAA
ADH1_CAEEL      NVTGWQLGDKAGVKLMFNCLNCEFCKKGHEPLCHHIQNYGFDRSGTFQEYLTIRGVDAAKI---------
FRMA_ECOSM      XXTSVKPGDHVIPLYTAECGECEFCRSGKTNLCVAVRETGLMPDGTFSEYTVVAEVSLAKINPEANHEHV
CADH5_ORYSJ     NVTKFKGGDKVGVGCMVSCHSCDSCNQGLENHCPGVIFTSVDKDGGYSSMVVVHERFVVRFPE-------
FRMA_ECOUT      XXTSVKPGDHVIPLYTAECGECEFCRSGKTNLCVAVRETGLMPDGTFSEYTVVAEVSLAKINPEANHEHV
FRMA_ECOL5      XXTSVKPGDHVIPLYTAECGECEFCRSGKTNLCVAVRETGLMPDGTFSEYTVVAEVSLAKINPEANHEHV
FRMA_ECOK1      XXTSVKPGDHVIPLYTAECGECEFCRSGKTNLCVAVRETGLMPDGTFSEYTVVAEVSLAKINPEANHEHV
ADH6_HUMAN      GVSTVKPGDKVITLFLPQCGECTSCLNSEGNFC-------------------------------------
ADH1_ASPFN      LVTEFEIGDHAGLKWLNSCLACEFCKQADEPLCPNASLSGYTVDGTFQQYAIGKATHASKLPKNVLDAVA
FRMA_SHISS      XXTSVKPGDHVIPLYTAECGECEFCRSGKTNLCVAVRETGLMPDGTFSEYTVVAEVSLAKINPEANHEHV
FRMA_ECOLC      XXTSVKPGDHVIPLYTAECGECEFCRSGKTNLCVAVRETGLMPDGTFSEYTVVAEVSLAKINPEANHEHV
FRMA_ECOHS      XXTSVKPGDHVIPLYTAECGECEFCRSGKTNLCVAVRETGLMPDGTFSEYTVVAEVSLAKINPEANHEHV
FRMA_ECO57      XXTSVKPGDHVIPLYTAECGECEFCRSGKTNLCVAVRETGLMPDGTFSEYTVVAEVSLAKINPEANHEHV
FRMA_ECO24      XXTSVKPGDHVIPLYTAECGECEFCRSGKTNLCVAVRETGLMPDGTFSEYTVVAEVSLAKINPEANHEHV
ADH1_MOUSE      GVTCVKPGDKVI--PLFSCGECRICKHPESNFCSRLMPRGTLREG--TSRFSCKGKQIHNFISTSTFSQY
ADH1G_HUMAN     GVTTVKPGDKVIPLFTPQCGKCRICKNPESNYC-------------------------------------
ADHL1_ARATH     NVDGFKQGDVVL--PVFHCEECKDCKSSKTNWCDRYAISNTRRYGSFSEYTVVDIAHLVKIPEIPVDKAA
FRMA_ECOL6      XXTSVKPGDHVIPLYTEXCGECEFCRSGKTNLCVAVRETGLMPDGTFSEYTVVAEVSLAKINPEANHEHV
ADH2_HORVU      GVTELVPGDHVLPVFTGECKECAHCMSEESNLCDLLVDRGVMIDDGFSEYTVIHVGCVAKIPEAPLDKVC
ADH1_RAT        GVTCVKPGDKVI--PLFSCGKCRICKHPESNLC-------------------------------------
YL498_MIMIV     NVDKYSIGDIVCVSPVISCGHCKMCT--------------------------------------------
CADH6_ORYSJ     NVAGFKVGDRVGVGCIASCLDCEHCRRSEENYCVALTYNGIFWDGGYSGMLVAHKRFVVRI---------
YJGB_ECOLI      AAQDKQVGQRVGIGTARSCGHCDACISGNQINCEQGAVPTIMNRGGFAEKLRADWQWVIPLPENI-----
FRMA_ECOLI      XXTSVKPGDHVIPLYTAECGECEFCRSGKTNLCVAVRETGLMPDGTFSEYTVVAEVSLAKINPEANHEHV
ADH2_MAIZE      GVTDVAPGDHVLPVFTGECKECAHCKSEESNMCDLLVMIGDGKSSTFSEYTVIHVGCLAKIPEAPLDKVC
ADH2_EMENI      XXXXXKIGDRVGVKWISSCGQCPPCQDGADGLCFNQKVSGYYTPGTFQQYVLGPAQYVTPIPDGLAEAAP
ADH1_RABIT      GVTTVKPGDKVIPLFTPQCGKCRICKHPESNFCKGMLLDGTSRTSTFSQYTVVDEIAVAKI-DAAAPLEK
MTDH1_STYHU     NVTKFKEGDRVGVGVIVDSXXXXXXXXXKPVFTYNSPYKGTRTQGGYSDFVVVHQRFVLQFPDNL-----
ADH_MYCPN       EVKSFKVGDRVLVAAITPEWNSVNAQAGYPMHSGGMLKFSNVKDGMFAEYHVNDAENLALMPEGMDLADA
ADH1_ARATH      GVTDLQPGDHVLPIFTGECGECRHCHSEESNMCDLLRINGMIHDGTFSEYTVVHSGQVAKIPDAPLDKVC
MTDH_PETCR      KVEKFKVGDAVGVGCLVSCLSCENCDDDSENNCAKQVVDGSITYGGYADSMVADQHFVLRWPENL-----
MTDH_FRAAN      KVQKFKVGDRVGVGCIVSCRSCENCTDHLENYCPKQIL--------------------------------
DHSO_PIG        LVTHLKPGDRXAXEP-------------------------------------------------------
ADH_MALDO       GVTDLKAGDHVLPVFTGECKDCAHCKSEESNMCDLLRIRGVMLSDGKSRFSI------------------
ADH1_HORVU      GVTDVAPGDHVLPVFTGECKECPHCKSAESNMCDLLRIRGVMIGDGKSRFSIGGKPIYHFVGTSTFSEYT
ADH1_GADCA      GVTEFQPGEKVIPLFISQCGECRFCQSPKTNQC-------------------------------------
ADH1B_UROHA     XXTSMKPGDKVIPIFLPQCGECNSCRHPRGNVCTGLLYDGTSRTGTFTEYTVAPEDSVVKI-DASAPLEK
FRMA_HAEIN      XXXXXKPGDHVIPLYTAECGECEFCRSGKTNLCVSVRDTGLMPDSTFSEYSVVAEVSLAKINPE-ANHEQ
ADHX_DICDI      XXTSVKVGDHVIPLYIPECGTCKFCTSNKTNLCSKIRITGQMPDGTFSQYTVLPEISCCVVEDAPLDKVC
ADHL2_ARATH     KVDGFKQGDVVLPVFHPQCEECKECISPKSNWCT------------------------------------
ADH4_HUMAN      GVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKIPVYHFFGTSTFSQYTVVSDINLAKIDDD-ANLER
ADH1_PENAM      GVTDVAPGDHVLPVFTGECKECPHCKSAESNMCDLLTVRGVMIGDGKSRFSINGKPIYHFVGTSTFSEYT
MTDH_MESCR      KVQNFKVGDKVGVGCMVSCRSCESCENHLENYCPKMIXXXXXXXXXXXXIMVVEEHFAVRIPDNMA----
MTDH3_STYHU     KVEKYKVGDKVGVGYFVSCRSCQNCIDNLENYCPKHILTGTTTYGGYSDSMVVDEHFVTRIPEGL-----
ADHL3_ARATH     GVKDVKEGDYVIPTFNGECGECKVCKREESNLC-------------------------------------
ADH1_PERMA      GVTSVKPGDKVIPLFTPQCGKCRICKHPEYNLC-------------------------------------
CADH4_ORYSJ     DVKGFKVGDHVGVGVYVSCQDCENCNSSLENHCSKCVVTGTVTKGGYSSHILVHQRYCFKIP---ADYPL
FADH_PSEPU      DVENLQIGDLVSVPFNVACGRCRSCKEMHTGVCLTVVDMG-DWTGGQAEYLLVPYANLLKLPDR--DKAM
FADH_PSEAE      GVETMKIGDLVSVPFNVACGHCRTCKEQHTGVCLTV----------------------------------
ADH4_MOUSE      GVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCGKLHFMGV---SSFSQYTVVSEANLARVDDE-ANLER
ADH1_MAIZE      GVTDVAPGDHVLPVFTGECKECAHCKSAESNMCDLLRIRGVMIADGKSRFSINGKPIYHFVGTSTFSEYT
ADH3_KLULA      XXKGWNIGDFAGIKWLNSCMSCEYCELSNESNCPDADLSGYTHDGSFQQYATADAVQAARIPTDLAEVAP
ADH1_ORYSJ      GVTDLAPGDHVLPVFTGECKECAHCKSAESNMCDLLRIRGVMIGDGKSRFSINGKPIYHFVGTSTFSEYT
ADH1_ORYSI      GVTDLAPGDHVLPVFTGECKECAHCKSAESNMCDLLRIRGVMIGDGKSRFSINGKPIYHFVGTSTFSEYT
YBJB_SCHPO      HL----VGTRV--------------------FGTSGSELSFTKDGTHAEYCIIPEKAAVRMPSNLSFTEA
ADHI_RHOS4      XXTSVKPGDHVIPLYTPECRQCPSCLSQKTNLCTAIQGQGLMPDGTFSNYTVLPEIAVAKVPD--APFDK
ADH1A_MACMU     XXXXXXXXDKVIPLALPQCGKCRICKTPERNYCLKNDVRGTLQDGTFSQYTVVDENAVAKI-DAASPMEK
ADH_FRAAN       GVTDLKAGDHVLPVFTGECKECDHCKSEESNMCDLLRIRGVMLNDGKSRFSI------------------
ADH3_SOLTU      GVTELAPGDHVLPVFTGECKDCAHCKSEESNMCSLLRIRGVMINDGQSRFSI------------------
ADH2_SOLTU      GVTELAPGDHVLPVFTGECKDCAHCKSEESNMCSLLRIRGVMINDGQSRFSI------------------
ADH2_SOLLC      GVTDLAPGDHVLPVFTGECKDCAHCKSEESNMCSLLRIRGVMLNDGKSRFSI------------------
ADH1_SOLTU      GVTELGPGDHVLPVFTGECKDCAHCKSEESNMCSLLRIRGVMINDGQSRFSI------------------
ADH1_PICST      NVTGWELGDYAGIKWLNSCLNCEFCQHSDEPNCAKADLSGYTHDGSFQQYATADAVQAARLPTDLAQAAP
ADH1_NEUCR      XXTEVEVGDHAGIKWLNSCLACSFCMQADEPLCPHALLSGYTVDGSFQQYAIAKAAHVAKIPKDLETTAP
ADH7_YEAST      KCHTGKIGDRVGVGQALACFECERCKSDNEQYCTNDHVLGYISQGGFASHVRLHEHFAIQIPENI-----
ADH1_PETHY      GVTDLKPGDHVLPVFTGECQQCRHCKSEESNMCDLL----------------------------------
ADH2_KLULA      XXKGWNIGDFAGIKWLNSCMSCEYCELSNESNCPDADLSGYTHDGSFQQYATADAVQAARIPTDLAEVAP
QOR_PIG         HVSSFKKGDRVFTVSTLS--------------------------GGYAEYALAADDTVYMLPEKLKQGAA
FRMA_PASPI      XXTSVKPGDHVIPLYTAECGECDFCTSGKTNLCVAVRETGVMPDATFSEYTVVAEVSLAKIPQANAEQVC
ADH2_YEAST      XXKGWKIGDYAGIKWLNSCMACEYCELGNESNCPHADLSGYTHDGSFQEYATADAVQAAHIP--------
ADH2_CANAL      XXKGWKVGDYAGVKWLNSCLNCEYCQSGAEPNCAEADLSGYTHDGSFQQYATADAVQAARIP--------
QOR_HUMAN       NASAFKKGDRVFTSSTIS--------------------------GGYAEYALAADHTVYKLPEKLKQGAA
CAD8A_ORYSJ     XXTRFKAGDTVGVGYFVSCRACDSCGKGDENYCPTMVITGATTQGGFSDVMVVRQDYVLRVPASL-----
FDEH_PSEPU      GVTTDKQGDMVYWAPIALCHRCHSCTVLDETPWDNSTFFEHAQKGSYADFACLPNGMAYRLPDH-AQPEA
QOR_CAVPO       DVSAFKKGDRVFTTSTIS--------------------------GGYAEYALASDHTVYRLPEKLRQGAA
ADH2_PICST      XXTGWEIGDYAGIKWINSCLQCEYCVTAHESNCPDADLSGYTHDGSFQQYATADAIQAARIP--------
VAT1L_MOUSE     SVKGYEIGDRV-----------------------------------------------------------
ADHA_BACSU      XXXXXXXGDRVGVGCFVSCGECEYCLNAEEQFCTKGVVQGNPTYGGYSQKIVVTDRFVVRIPDRL-----
ADH1_CANAL      XXKGWKIGDFAGIKWLNSCMSCEFCQQGAEPNCGEADLSGYTHDGSFEQYATADAVQAAKIPTDLANVAP
CADH1_ORYSJ     DVKSFKVGDHVGVGTYVSCRDCENCNSSLENYCSQHVXXXXXXXXXYSTHIVVHERYCFKIPDGYPLEKA
ADH1A_UROHA     XXTCVKPGDKVIPLFVPQCGKCSSCRSTRGNLCTSSAATGLMPDGSFTEYTVVHENSVVKI-DAAAPLEK
VAT1L_HUMAN     SVKGYEIGDRV-----------------------------------------------------------
ADH1_KLULA      XXKGWKIGDFAGIKWLNSCMSCEYCELSNESNCPEADLSGYTHDGSFQQYATADAVQAAKIPTDLAEVAP
ADH1G_PAPHA     XXXXXKPGDKVIPLFTPQCGKCRVCKNPESNYCFKNDLRGTMQDGTFSQYTVVDENAVAKI-----DAAS
QOR_BOVIN       SVSAFKKGDRVFTTRTIS--------------------------GGYAEYALAADHTVYTLPEKLKQGAA
CAD8C_ORYSJ     XXXKFKAGDTVGVGYVASCRGCECCGNGYENYCAKMVTTGVDHDGGFSDAIVVNEHYVLRVP--------
QOR_PONAB       NASAFKKGDRVFTSSTIS--------------------------GGYAEYALAADHTVYKLPEKLKQGAA
MTDH_APIGR      XXXXXXXXDNVGIGCLVSCRSCESCCDNRESHCESIYFDGTMTHGGYSDTMVADEHFILRWPKNLLDSGA
CADH9_ORYSJ     XXXRFAAGDTVGVGYIASCRACANCRDGFENYCAGLVPSGATVHGGFSELAVVNQRYVVRIP--------
CAD8D_ORYSJ     XXXKFKAGDTVGVGYFVSCRACDSCGKGYENYCPTMVITGATTQGGFS----------------------
CAD8B_ORYSJ     XXXKFKAGDTVGVGFFVSCRTCDSCGKGYENYCPTMVITGAATQGGFSDAIV------------------
ADH1_YEAST      XXKGWKIGDYAGIKWLNSCMACEYCELGNESNCPHADLSGYTHDGSFQQYATADAVQAAHIP--------
TERPD_PSESP     GVKHLKPGDAV-VMTFASCGHCASCEHERPSYC-------------------------------------
CADH7_PICAB     EVKKFKVGEHVGVGCIVXXXXXXXXXXXMEQYCSKRIWTGTPTQGGFASSMVVDQMFVVRIPENL-----
CADH2_PICAB     EVKKFKVGEHVGVGCIVXXXXXXXXXXXMEQYCSKRIWTGTPTQGGFASSMVVDQMFVVRIPENL-----
YOGA_BACSU      XVKNVTVQTEVVIFPTLNWDLT-------ENVPPVPEILGGPSDGTLAEYVIIPSQNAIKKPAYLSWEEA
ZDH1_STAAR      NVTLFSPGDVVFY-------------AGSPN-----------RQGSNATYQLVSEAIVAKAPHNISANEA
ADH1_RANPE      XXTKFKPGDKVIPLFVPQCGECRCCKNPESNLCTSRFTCSIHNTSTFTEYTVLDEIAVAKIHEDAPLEKV
ADH1_APTAU      XXXXXKPGDKVIPLFVPQCGECSACLSTKGNLCS------------------------------------
CADH_EUCBO      XXTKYRVGDRVGTGIVVGCRSCGPCNSDQEQYCNKKITDGKPTQGGFAGEIVVGQRFVVKIPDGLSEQDA
ZDH1_STAAC      DVTLFSPGDVVFY-------------AGSPN-----------RQGSNATYQLVSEAIVAKAPHNISANEA
QOR_LAMGU       RVSAFKKGDRVFTTSTVS--------------------------GGYAEYALAADHTVYKLPGELQKGAA
GEDH1_OCIBA     XXXXXXXXXXXXXXXXXSCRQCDQCSNDLENYCYKQILTGTIARGGYSDIMVADEHFIIRWPEN------
CADH_EUCGL      XXTKYRVGDRVGTGIVVGCRSCSPCNSDQEQYCNKKITDGKPTQGGFAGEIVVGERFVVKIPDGLESEQA
CADH1_EUCGU     XXTKYRVGDRVGTGIVVGCRSCSPCNSDQEQYCNKKITDGKPTQGGFAGEIVVGERFVVKIPDGLESEQA
ZDH1_STAAW      DVTLFSPGDVVFY-------------AGSPN-----------RQGSNATYQLVSEAIVAKAPHNISANEA
ZDH1_STAAS      DVTLFSPGDVVFY-------------AGSPN-----------RQGSNATYQLVSEAIVAKAPHNISANEA
ZDH1_STAAN      DVTLFSPGDVVFY-------------AGSPN-----------RQGSNATYQLVSEAIVAKAPHNISANEA
ZDH1_STAAM      DVTLFSPGDVVFY-------------AGSPN-----------RQGSNATYQLVSEAIVAKAPHNISANEA
CADH2_EUCGU     XXTKYRVGDRVGTGIVVGCRSCSPCNSDQEQYCNKKITDGKPTQGGFAGEIVVGERFVVKIPDGLESEQA
ADH6_RAT        XXXXXRTGDKVILLCIPQCGECKTCLNSKNNICTEIRLSKTHLAGSFSEYTVLKEISVAKI-DEGAPLEK
QORL2_MOUSE     DVSTVKKGDR---------------------------VIGVSSFHAMAEQCITDQKTLWRIPENVSLQDA
CADH1_ARACO     DVTKFKVGDCVGDGTIVGCKTCRPCKADVEQYCNKKITDGKPTQGGFSGHMVVDQKFVVKIPDGMAPEQA
ADH1_STRCA      XXXXXKPGDKVIPLFVPQCGECSVCLSTKGNLC-------------------------------------
ADH1_ENTHI      LVKRLKVGDKVIVPAITPDWGEEESQRGYPMHSGGMLKFSNFKDGVFSEHVNEADANLALLPRDIKPEDA
QOR_LEIAM       GVANVKVGDHVVLMQ-------YGC---------------------FAEFLDAPAERCIPVPELKPEYSV
QORL2_RAT       DVSTVKKGDR---------------------------VIGVSNFHSMAEQCITDQKTLWRIPENVSLQDA
ZDH1_STAES      QVSMFQEGDVVFYS-------------GSPN-----------QNGSNEEYQLIEEYLVAKAPTNLKSEQA
ZDH1_STAEQ      QVSMFQEGDVVFYS-------------GSPN-----------QNGSNEEYQLIEEYLVAKAPTNLKSEQA
QOR_MOUSE       KVSAFKKGDRV--------------------FCYSTV------SGGYAEFALAADDTIYPLPENFRQGAA
ZADH2_HUMAN     SASRYTVGQAVAY----------------------------MAPGSFAEYTVVPASIATPVPSVKPEYLT
QOR_RAT         GVSAFKKGDRV--------------------FCFSTV------SGGYAEFALSADNTTYPLPETLRQGAA
FADH_PICPA      XXXXXXXXXXXXLLYTPECRECKFCLSGKTNLCGKIRATGLLPDGSFSQYTVVADISVVKVQDEAPKDKT
ZADH2_BOVIN     ----------LSASAAFMVGQA----------------VAYMAPGSFAEYTVVPARVAIPVPGLKPEYLT
YGD6_SCHPO      DVEGFEKGDSVV------CNFFTNYLDGTPTDFATHSALGGTRDGCFQKYAVLPAHALVHAPKNLSFEEI
QOR_SALTY       GVEHIRVGDR--------------------------VVYAQSTLGAYSSVHNVTADKAAILPDAISFEQA
ADHX_CAEEL      XXXXFAPGDHVVPLYVPQCKECEYCKNPKTNLCQKI----------------------------------
ADH1_NAJNA      XXTCVKPGDKVIPLFAPQCGKCRACQSPKGNLCTS-----------------------------------
YGGP_ECOLI      NLGKYKKGQRFVLQPAMSAGYSYEYFGGN---ATYMIIPEIAINLG----CVLPYHGSYFAAASLAEPMC
TARJ_BACSU      PTGTFKVGTRVVMVPNTPVEEH---EVIAENYLRSSRFRSSGYDGFMQDYMFMAPDRLVELPDSINPHVA
ADH7_MOUSE      XXXXXRPGDKVIPLFLPQCRECNACLNPEGNLCSDLTGCGVLADGTFTEYTVLDESSVAKVDGAAPPEKA
ZADH2_MOUSE     SASRYTVGQAVAY----------------------------MAPGSFAEYTVVPASIAIPMPSVKPEYLT
VAT1_DANRE      EVTDRKVGDKVLV---------------------------LNRSGMWQEVVVVASTHTFLMPEGMSFEEA
YHFP_BACSU      VVS--------SNDPRFAEGD---------EVIATSYELGVSRDGGLSEYASVPGDWLVPLPQNLSLKEA
ADH2_KLUMA      NVKGWKIGDLAGIXXXXXXXXXXXXXXXXPDADLS----GYTHDGSFQQYATADAVQAAHIP--------
CADH_POPDE      DVTRFKXXXXXXXXXXXSCKNCHPCKSEIEQYCNKKITDGKPTQGGFAESMVVHQKFVVRIPDGMSPEQA
ADHL4_ARATH     XXXXXXXXDHVLPIFTGECGDCRVCKRDGANLC-------------------------------------
MAO1_SHEWM      --------------------------------------------------------------DDIQGTAA
VAT1_TORCA      LVIDRKVGDKI-------------------------IMLNI--DGGWTELVVTTVNRTFLMPDGMSFQEA
PKS7_DICDI      NVKDYKVGDNV---------------FGLSNSCTS-----SHIVTNFKNIQLKPSKISHIEASSIIDYLA
DHG_THEAC       N-GYIKKGDLV-VPLVRRPGKCINCRIGRQDNCS------------------------------------
PKS5_DICDI      NVKDYKVGDNV---------------FGLSNSCTSSNIIVNH-----ERIQIKPSNISHIEAASIIDYLT
RT4I1_DICDI     SVWDYEIGDQVSASPPFSMGHCEYITVDESEI--------------------------------------
PKS9_DICDI      NVKDYKVGDNV---------------FGLSNSCTS-----SHIVTNYKKIQIKPSNLSHNEASSIIDYLT
PKS8_DICDI      NVKDYKVGDNV---------------FGLSNSCTS-----SHIVTNFKNIQLKPSNISHNEASSIIDYLT
MECR_DROME      KVKGFEAGQHV-----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VMVEPFTIAANVTGQVNPTEQDVALIYGAGPMGLTTVQALKGVYQVKTVIVVDRIEERLAMAKQSGADWT
RSPB_ECOLI      VMIEPFTIAANVTGHGQPTENDTVLVYGAGPIGLTIVQVLKGVYNVKNVIVADRIDERLEKAKESGADWA
YJMD_BACSU      VMAEPYTIGAQAVWRGQVEKGDTVLIQGAGPIGICVLKMAK--LAGAAVMMTDLNNERLAFAKENGADAV
Y053_HAEIN      PLAEPLTIALHALHRT--TLKSGEHIVXXXXXXXXXXXXXXXVQYGAIPILVDILEQRLEYAKSLGIEHI
YDJJ_ECOLI      ALVEPAAVGMHAAMLADVKPGKKIIILGAGCIGLMTLQACKCLGATE-IAVVDVLEKRLAMAEQLGATVV
DHSO_BACSU      ALIEPFSVGIHAAARTKLQPGSTIAIMGMGPVGL-MXXXXXXXXXXGTIIVTDLEPLRLEAAKKMGATHI
IDND_VITVI      AMCEPLSVGIHACRRANVGPETNVLIMGSGPIGLVTMLAAR-AFGAPRIVLVDVDDQRLAIAKDLGADTN
DOIAD_STRFR     CQVEPLAVALNAVDRLGVTPGEKVAVMGAGGIGLLLVQAVRLRGGTVTAVAEPVPERRXXXXXXXXXXXX
TDH_THET8       AILEPFGNAVHTVYAGSGVSGKSVLITGAGPIGLMAAMVVR-ASGAGPILVSDPNPYRLAFARPY-ADRL
TDH_THET2       AILEPFGNAVHTVYAGSGVSGKSVLITGAGPIGLMAAMVAR-ASGAGPILVSDPNPYRLAFARPY-ADRL
TDH_COXBU       AILDPFGNAAHSALEFDLVGEDV-LITGAGPVGLMSAAIARHV-GARHVVITDVNDYRLALAEKVGVTAA
TDH_COXBR       AILDPFGNAAHSALEFDLVGEDV-LITGAGPVGLMSAAIARHV-GARHVVITDVNDYRLALAEKVGVTAA
TDH_COXBN       AILDPFGNAAHSALEFDLVGEDV-LITGAGPVGLMSAAIARHV-GARHVVITDVNDYRLALAEKVGVTAA
TDH_COXB2       AILDPFGNAAHSALEFDLVGEDV-LITGAGPVGLMSAAIARHV-GARHVVITDVNDYRLALAEKVGVTAA
TDH_ERWCT       AIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGMMAAAVCRHV-GARNVVITDVNAYRLELASKMGATRA
DHSO_BACHD      AMTEPLACTHHAIAKTSINKGDLVVVTGPGPIGLLAAQVAKSHGGTVIITGLSNDQVRLKKAKEVGIDYA
TDH_VIBPA       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_BACSU       SIQEPLGNAVHTVLESQPAGGTTAVI-GCGPIGL-MXXXXXXXXXXXXXXXIDKNEYRLRLAKQMGATCT
TDH_AERS4       AIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELARKMGATRA
TDH_EDWI9       AIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVCRHV-GARHVVITDVNDYRLDLARKMGVTRA
TDH_YERPY       AIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVCKHV-GARHVVITDVNEYRLDLARKMGVTRA
TDH_YERPS       AIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVCKHV-GARHVVITDVNEYRLDLARKMGVTRA
TDH_YERPP       AIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVCKHV-GARHVVIADVNEYRLDLARKMGVTRA
TDH_YERPN       AIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVCKHV-GARHVVIADVNEYRLDLARKMGVTRA
TDH_YERPG       AIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVCKHV-GARHVVIADVNEYRLDLARKMGVTRA
TDH_YERPE       AIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVCKHV-GARHVVIADVNEYRLDLARKMGVTRA
TDH_YERPB       AIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVCKHV-GARHVVITDVNEYRLDLARKMGVTRA
TDH_YERPA       AIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVCKHV-GARHVVIADVNEYRLDLARKMGVTRA
TDH_YERP3       AIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVCKHV-GARHVVITDVNEYRLDLARKMGVTRA
TDH_PHOLL       AIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVCKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_YERE8       AIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVCKHV-GARHVVITDVNEYRLDLARKMGVTRA
TDH_THEON       TLQEPLGNAVD-TVLAGPIAGRSTLITGAGPLGLLGIAVAKGAY---PVIVSEPSEFRRELAKKVGADYV
DOIAD_STRSD     CQVEPVAVALHAVSTVGVEPGERVAVLGAGGIGLMLMQVARQRGGVITT-VGEPVAERRAVAAQLGARTV
TDH_MESSB       AIFDPLGNAVHTALSFDLVGEDV-LVTGAGPIGIMGALVAQCV-GARKVVITDINPGRLALAKKLGVRHV
TDH_AERHH       AIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELARKMGATRA
TDH_SHEB8       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELARKMGATRA
TDH_SHESM       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELARKMGATRA
TDH_SHESA       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELARKMGATRA
TDH_SHEB9       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELARKMGATRA
TDH_SHEB5       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELARKMGATRA
TDH_SHEB2       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELARKMGATRA
TDH_SHESW       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELARKMGATRA
TDH_DEIDV       AIFDPFGNAVHTALSFDLVGEDV-LVTGAGPIGVMAAAVARHV-GARNVVITDINDYRLDLARKMGVTRA
DOIAD_STRRY     TQVEPLAVALNAVDRLAVTAGEKVXXXXXXXXXXXXXXXVR-LRGAEVTVLAEPVTERRQAAHALGVPHT
TDH_SHESR       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELARKMGATRA
TDH_SERP5       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVCKHV-GARHVVITDVNEYRLDLARKMGVTRA
TDH_SHEON       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELARKMGATRA
DOIAD_STRKN     CQVEPLAVALNAVSIAGVAPGDRVAVMGAGGIGLMLMQVARHLGGEVTV-VSEPVAERRAVAGQLGATEL
TDH_BACA2       SVQEPLGNAVHTVLESSQLAGGSAAIIGCGPIGL-MXXXXXXXXXXXXXXXIDKNDYRLALAKKLGATIT
TDH_SHEPC       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELARKMGATRA
TDH_CHRVO       SIFDPFGNAVHTALSFNLVGEDV-LITGAGPIGIMAVAIAKHV-GARHVVITDVNDYRLELAKKMGATRA
YJJN_ECOLI      ALIEPFAISAHAVAAIAPGEQXXXXXXXXXXXXXXXXXXVADTSPARREHVATRLELPLLDPSAEDFDAQ
TDH_DEIRA       AIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGCMAAAVARHV-GARNVVITDVNDYRLDLARQMGVTRA
TDH_RHIEC       AIFDPFGNAVHTALSFDLVGEDV-LVTGAGPIGIMGALVAKR-SGARKVVITDINPHRLDLARKLGIDHV
TDH_PSEHT       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVAKHV-GARHVVISDVNEYRLELARKMGATRA
TDH_BURPP       AIFDPFGNATHTALSFNLVGEDV-LITGAGPIGIMAVAIAKHV-GARNVVITDVNDYRLELARKMGATRA
TDH_RHILW       AIFDPFGNAVHTALSFDLVGEDV-LVTGAGPIGIMGALVAKR-SGARKVVITDINPHRLALARKLGIDHV
TDH_RHIL3       AIFDPFGNAVHTALSFDLVGEDV-LVTGAGPIGIMGALVAKR-SGARKVVITDINPHRLELARKLGIDHV
TDH_BURVG       SIFDPFGNATHTALSFNLVGEDV-LITGAGPIGIMAVAIAKHV-GARNVVITDINDYRLELARKMGATRA
DOIAD_STRRI     CQVEPLAVALNAVDRLGVTEKXXXXXXXXXXXXXXXXXRLRG---GSVTAVAEPVPERRXXXXXXXXXXX
TDH_BURP8       AIFDPFGNATHTALSFNLVGEDV-LITGAGPIGIMAVAIAKHV-GARNVVITDVNDYRLELARKMGATRA
TDH_BURM1       SIFDPFGNATHTALSFNLVGEDV-LITGAGPIGIMAVAIAKHV-GARNVVITDINDYRLELARKMGATRA
TDH_FRATN       STFDPMGNAIHTALSFNLTGEDV-LITGAGPIGLMAVKIAR-FCGARRIVITDINEYRLQMARDFGATVA
TDH_BURS3       SIFDPFGNATHTALSFNLVGEDV-LITGAGPIGIMAVAIAKHV-GARNVVITDINDYRLELARKMGATRA
TDH_FRATW       STFDPMGNAIHTALSFNLTGEDV-LITGAGPIGLMAVKIAR-FCGARRIVITDINEYRLQMARDFGATVA
TDH_FRATT       STFDPMGNAIHTALSFNLTGEDV-LITGAGPIGLMAVKIAR-FCGARRIVITDINEYRLQMARDFGATVA
TDH_FRATO       STFDPMGNAIHTALSFNLTGEDV-LITGAGPIGLMAVKIAR-FCGARRIVITDINEYRLQMARDFGATVA
TDH_FRATM       STFDPMGNAIHTALSFNLTGEDV-LITGAGPIGLMVVKIAR-FCGARRIVITDINEYRLQMARDFGATVA
TDH_FRATH       STFDPMGNAIHTALSFNLTGEDV-LITGAGPIGLMAVKIAR-FCGARRIVITDINEYRLQMARDFGATVA
TDH_FRATF       STFDPMGNAIHTALSFNLTGEDV-LITGAGPIGLMAVKIAR-FCGARRIVITDINEYRLQMARDFGATVA
TDH_FRAT1       STFDPMGNAIHTALSFNLTGEDV-LITGAGPIGLMAVKIAR-FCGARRIVITDINEYRLQMARDFGATVA
TDH_BURXL       AIFDPFGNATHTALSFNLVGEDV-LITGAGPIGIMAVAIAKHV-GARNVVITDVNDYRLELARKMGATRA
TDH_BURPS       AIFDPFGNATHTALSFNLVGEDV-LITGAGPIGVMAVAIAKHV-GARNVVITDINDYRLELARKMGATRA
TDH_BURP6       AIFDPFGNATHTALSFNLVGEDV-LITGAGPIGVMAVAIAKHV-GARNVVITDINDYRLELARKMGATRA
TDH_BURP1       AIFDPFGNATHTALSFNLVGEDV-LITGAGPIGVMAVAIAKHV-GARNVVITDINDYRLELARKMGATRA
TDH_BURP0       AIFDPFGNATHTALSFNLVGEDV-LITGAGPIGVMAVAIAKHV-GARNVVITDINDYRLELARKMGATRA
TDH_BURMS       AIFDPFGNATHTALSFNLVGEDV-LITGAGPIGVMAVAIAKHV-GARNVVITDINDYRLELARKMGATRA
TDH_BURMA       AIFDPFGNATHTALSFNLVGEDV-LITGAGPIGVMAVAIAKHV-GARNVVITDINDYRLELARKMGATRA
TDH_BURM9       AIFDPFGNATHTALSFNLVGEDV-LITGAGPIGVMAVAIAKHV-GARNVVITDINDYRLELARKMGATRA
TDH_BURM7       AIFDPFGNATHTALSFNLVGEDV-LITGAGPIGVMAVAIAKHV-GARNVVITDINDYRLELARKMGATRA
TDH_BURCJ       SIFDPFGNATHTALSFNLVGEDV-LITGAGPIGIMAVAIAKHV-GARNVVITDINDYRLELARKMGATRA
TDH_BURCH       SIFDPFGNATHTALSFNLVGEDV-LITGAGPIGIMAVAIAKHV-GARNVVITDINDYRLELARKMGATRA
TDH_BURCC       SIFDPFGNATHTALSFNLVGEDV-LITGAGPIGIMAVAIAKHV-GARNVVITDINDYRLELARKMGATRA
TDH_BURCA       SIFDPFGNATHTALSFNLVGEDV-LITGAGPIGIMAVAIAKHV-GARNVVITDINDYRLELARKMGATRA
TDH_SHESH       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELANKMGATRA
TDH_SACEN       AIFDPFGNAVH-TALTFPVVGEDVLITGAGPIGLMAACVARHA-GARNVVITDVSEHRLELARRVGVDLA
TDH_BURTA       AIFDPFGNATHTALSFNLVGEDV-LITGAGPIGVMAVAIAKHV-GARNVVITDINDYRLDLARRMGATRA
TDH_RHISN       AIFDPFGNAVHTALSFDLVGEDV-LVTGAGPIGIMGALVAKR-SGARKVVITDINPVRLDLARKLGIDHV
TDH_COLP3       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVAKHV-GARHVVITDINEYRLDLARKMGATRA
TDH_AGRRK       AIFDPFGNAVHTALSFDLVGEDV-LVTGAGPIGIMGAMVAKR-SGARKVVITDINPNRLALAHKLGIDHV
TDH_SINMW       AIFDPFGNAVHTALSFDLVGEDV-LVTGAGPIGIMGALVAKRC-GARKVVITDINPVRLDLARKVGIDYV
TDH_SHEWM       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELAQKMGATRA
TDH_RHIME       AIFDPFGNAVHTALSFDLVGEDV-LVTGAGPIGIMGAMVAKRC-GARKVVITDINPVRLDLARKLGIDHV
TDH_RHIE6       AIFDPFGNAVHTALSFDLVGEDV-LVTGAGPIGIMGALVAKR-SGARKVVITDINPHRLDLARKLGIDHV
TDH_FRAP2       STFDPMGNAIHTALSFNLTGEDV-LITGAGPIGLMAVKIAR-FCGARRIVITDINKYRLQMARDFGATVA
DHSO_PONAB      AMIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQ-VVVTDLSATRLSKAKEIGADLV
DHSO_BOMMO      AAVQPLAIVIHACNRAKITLGSKIVILGAGPIGILCAMSAKAMGASK-IILTDVVQSRLDAALELGADNV
TDH_BURCM       SIFDPFGNATHTALSFNLVGEDV-LITGAGPIGVMAAAIAKHV-GARNVVITDINDYRLELARKMGATRA
TDH_BURA4       SIFDPFGNATHTALSFNLVGEDV-LITGAGPIGVMAAAIAKHV-GARNVVITDINDYRLELARKMGATRA
DHSO_HUMAN      ALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQ-VVVTDLSATRLSKAKEIGADLV
TDH_THETN       SIQEPLGNAVHTVFSGDVVGKSVAVI-GCGPIGMMAIPLLKRT-GAAAIFAIEPADYRRELAHKLGATRV
TDH_SHEFN       AIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCKHV-GARHVVITDVNEYRLDLARKMGATRA
TDH_BACLD       SIQEPLGNAVH-TVLTGMTAGVKVAVVGCGPIGL-MXXXXXXXXXXXXXXXIDKNEYRLDLALQMGATDI
TDH_PYRHO       TLQEPLGNAVD-TVLAGPISGKSVLITGAGPLGLLGIAVAKGAY---PVIVSEPSDFRRELAKKVGADYV
TDH_IDILO       AVFDPFGNAVHTALAFDLVGEDV-LITGAGPIGIMXXXXXXXXXXXXXXI-TDVNEYRLDLARKMGVTRA
TDH_RHILO       AIFDPLGNAVHTALSFDLVGEDV-LVTGAGPIGIMGALVAQCV-GARKVVITDINPVRLALAKKLGVQHV
TDH_PECCP       AIFDPFGNAVHTALSFDLVGEDV-LXXXXXXXXXXXXXVCRHV-GARNVVITDVNAYRLDLARKMGATRA
TDH_PROMH       AIFDPFGNAVHTALSFDLVGEDV-LVSXXXXXXXXXXXXCKHV-GARHVVITDVNEYRLDLAKKMGVTRA
DOIAD_STRLV     CQVEPLAVALNAVDRVVPGEKVXXXXXXXXXXXXXXXVRQRG---GEVTXXXXXXXXXXXXXXXLGVSAT
TDH_SYMTH       SIQEPLGNAVHTALNGDLTARSV-LITGCGPIGIMSVPVAK-MAGAEIVMAMDINEYRLQLAGQLGADVL
DHSO_MACFA      ALIEPLSVGIHACRRGGVTLGHRVLVCGAGPIGVVSLLVAKAMGAAQ-VVVTDLSAPRLSKAKEIGADLV
TDH_STRAW       AIFDPFGNAVHTALSFPLVGEDV-LITGAGPIGL-MXXXXXXXXXXRNVMITDVSEERLELARKIGVSLA
TDH_ANADF       AIFDPYGNATHTALSFELVGEDV-LVTGAGPIGVMAVSIARHV-GARHVVVTDVNDYRLGLARRMGATRA
TDH_PYRFU       TLQEPLGNAVD-TVLAGPIAGKSVLITGAGPLGLLGIAVAKGAY---PVIVSEPSEFRRNLAKKVGADYV
TDH_STRGG       AIFDPFGNAVHTALSFPLVGEDV-LITGAGPIGIMXXXXXXXXXXXXXXI-TDVSEARLALARKVGVSLA
DHSO_SHEEP      ALIEPLSVGIHACRRAGVTLGNKVLVCGAGPIGLVNLLAAKAMGAAQ-VVVTDLSASRLSKAKEVGADFI
TDH_PYRAB       TLQEPLGNAVD-TVLAGPISGKSVLITGAGPLGLLGIAVAKGAY---PVIVSEPSDFRRELAKKVGADYV
TDH_MARMS       AIFDPFGNATHTALSFDLIGEDV--LXXXXXXXXXXXXXXXXXXXXRNVVITDVNDFRLDLAKKMGATRT
DHSO_RAT        ALIEPLSVGIYACRRGSVSLGNKVLVCGAGPIGIVTLLVAKAM-GASQVVVIDLSASRLAKAKEVGADFT
DHSO_MOUSE      ALIEPLSVGIYACRRGSVSLGNKVLVCGAGPVGMVTLLVAKAMGAAQ-VVVTDLSASRLTKAKEVGADFT
TDH_PYRKO       ALQEPLGNAVD-TVLAGPIAGRSTLITGAGPLGLLGIAVAKGAY---PVIVSEPSEFRRKLAKKVGADYV
DHSO_BOVIN      ALIEPLSVGIHACRRAGVTLGNKVLVCGAGPIGLVSLLAAKAMGAAQ-VVVTDLSASRLSKAKEVGADFI
TDH_STRMK       AFFDPYGNAAHCALEFNVIGEDV-LITXXXXXXXXXXXXCKHI-GARNVVVTDVNDFRLKLAADMGATRV
TDH_ESCF3       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_LEGPH       AILDPFGNAAHCALAFDVVGEDV-LXXXXXXXXXXXXXXVRHI-GARHVVITDVNDHRLELARQMGVSRA
TDH_LEGPC       AILDPFGNAAHCALAFDVVGEDV-LXXXXXXXXXXXXXXVRHI-GARHVVITDVNDHRLELARQMGVSRA
TDH_ENTS8       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLSLARKMGVTRA
TDH_LEGPA       AILDPFGNAAHCALAFDVVGEDV-LXXXXXXXXXXXXXXVRHI-GARHVVITDVNDHRLELARQMGVSRA
TDH_KLEP7       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARNVVITDVNEYRLELARKMGVTRA
TDH_KLEP3       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARNVVITDVNEYRLELARKMGVTRA
TDH_LEGPL       AILDPFGNAAHCALAFDVVGEDV-LXXXXXXXXXXXXXXVRHI-GARHVVITDVNDHRLELARKMGVSRA
TDH_SHEAM       AIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELARKMGATRA
XYLD_MORMO      AMVEPLAIGMQSATKAGIKPGDIGLVIGAGTIGIITQSALAG--GCSDVIICDVFDEKLKVAKYQGLHAV
TDH_ECOLI       AIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECODH       AIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECOBW       AIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
DHSO1_YEAST     ACVEPLSVGVHSNKLAGVRFGTKVVVFGAGPVGLLT-GAVARAFGATDVIFVDVFDNKLQRAKDFGATNT
TDH_SALTY       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_SALSV       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_SALPK       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_SALPC       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_SALPB       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_SALPA       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_SALNS       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_SALHS       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_SALEP       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_SALDC       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_SALCH       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_SALA4       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_ECOLU       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGVTRA
TDH_CITK8       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARHVVITDVNEYRLELARKMGIIHT
TDH_STRCO       AIFDPFGNAVHTALSFPLVGEDV-LITGAGPIGLMXXXXXXXXXXXXXXI-TDVSEERLELARKVGATLA
TDH_SHIFL       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_SHIF8       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_SHIBS       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_SHIB3       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_SALTI       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_SALAR       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_ECOUT       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECOSM       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECOSE       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECOLC       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECOL6       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECOL5       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECOK1       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECOHS       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECO8A       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECO81       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECO7I       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECO5E       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECO57       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECO55       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECO45       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ECO27       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
DHSO2_YEAST     ACVEPLSVGVHSNKLAGVRFGTKVVVFGAGPVGLLT-GAVARAFGATDVIFVDVFDNKLQRAKDFGATNT
TDH_XANC5       AFFDPYGNAAHCALEFDVIGEDV-LITXXXXXXXXXXXXCKHI-GARNVVVTDVNDFRLKLAADMGATRV
TDH_SHISS       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_PSYIN       SIFDPFGNAVHSALSFDVVGEDV-LITGAGPIGIMAAAVAKHA-GARYVVITDINEYRLDLARKMGVTRA
TDH_ENT38       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLSLARKMGVTRA
TDH_ALTMD       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVAKHV-GARHVVVTDINPYRLELAKKMGATRT
GATD_ECOLI      AFIEPITVGLHAFHLAQGCENKNVXXXXXXXXXXXXXQCAVAL-GAKSVTAIDISSEKLALAKSFGAMQT
GATD_ECO57      AFIEPITVGLHAFHLAQGCENKNVXXXXXXXXXXXXXQCAVAL-GAKSVTAIDISSEKLALAKSFGAMQT
XYL2_YEAST      ALIEPLSVAIHANKLAKIKFGARCVVFGAGPIGLLAGK-VASVFGAADVVFVDLLENKLETARQFGATHI
TDH_SALG2       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGVMAAAVAKHV-GARHVVITDVNEYRLELARKMGVTRA
TDH_VIBCM       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVAKHV-GARHVVITDVNEYRLDLARKMGVTRA
TDH_VIBCH       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVAKHV-GARHVVITDVNEYRLDLARKMGVTRA
TDH_VIBC3       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVAKHV-GARHVVITDVNEYRLDLARKMGVTRA
TDH_XANOR       AFFDPYGNAAHCALEFDVIGEDV-LITXXXXXXXXXXXXCKHI-GARNVVVTDVNDFRLKLAADMGATRV
TDH_XANOM       AFFDPYGNAAHCALEFDVIGEDV-LITXXXXXXXXXXXXCKHI-GARNVVVTDVNDFRLKLAADMGATRV
TDH_XANAC       AFFDPYGNAAHCALEFDVIGEDV-LITXXXXXXXXXXXXCKHI-GARNVVVTDVNDFRLKLAADMGATRV
TDH_SHELP       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELAKKMGATRA
XYLD_AGRT5      AMVEPFAIGMQAALRARIQPGDIAVVTGAGPIGMMVXXXXXXXXXXK-VIVADLAQPKLDIIAAYDGIET
TDH_ECO24       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ANASK       XXXXXXGNATHTALSFDLVGEDV-LVTGAGPIGVMAAAIARHV-GARHVVVTDVNDYRLDLARRMGASRA
TDH_SHIDS       SIFDPFGNAVHTALSFDLVGEDV-LVSGAGPIGIMAAAVAKHV-GARNVVITDVNEYRLELARKMGITRA
TDH_ANAD2       XXXXXXGNATHTALSFDLVGEDV-LVTGAGPIGVMAAAIARHV-GARHVVVTDVNDYRLDLARRMGASRA
IDND_ECOLI      AFAEPLAVAIHAAHQAGELQGKRVFISGVGPIGCLIVSAVKTLGAAE-IVCADVSPRSLSLGKEMGADVL
TDH_XANCP       AFFDPYGNAAHCALEFDVIGEDV-LITXXXXXXXXXXXXCKHI-GARNVVVTDVNDFRLKLAADLGATRV
TDH_XANCB       AFFDPYGNAAHCALEFDVIGEDV-LITXXXXXXXXXXXXCKHI-GARNVVVTDVNDFRLKLAADLGATRV
TDH_XANC8       AFFDPYGNAAHCALEFDVIGEDV-LITXXXXXXXXXXXXCKHI-GARNVVVTDVNDFRLKLAADLGATRV
TDH_VIBVU       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVAKHV-GARHVVITDVNEYRLDLARKMGVTRA
TDH_PROAC       IF-DPFGNAVHTALQFPCLAEDV-LVSGAGPIGI--MAALVAQFQARNVVVTDLSDERLELAQQLGLKNA
TDH_VIBVY       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVAKHV-GARHVVITDVNEYRLDLARKMGVTRA
TDH_SHEHH       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELAQKMGATRA
TDH_PSEA6       AIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVAQHV-GARHVVITDVNEYRLDLARKMGASRA
TDH_SHEPA       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVCRHV-GARHVVITDVNEYRLELAEKMGATRA
TDH_VIBF1       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVAKHV-GARHVVITDVNEYRLDLAKKMGVTRA
TDH_SOLUE       AIFDPFGNAVHTALSFPVLGEDV-LITGAGPIGIMXXXXXXXXXXXYTVI-TDLNPYRLELAAKLGVTRA
TDH_VIBFM       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVAKHV-GARHVVITDVNEYRLDLAKKMGVTRA
ADH1_ZYMMO      SSITVTTYKAVKVSQIQPGQW--LAIYGLGGLGNLALQYAKNVFNAK-VIAIDVNDEQLAFAKELGADMV
TDH_VIBSL       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVAKHV-GARHVVITDVNEYRLDLARQMGVTRA
TDH_PARUW       AIFDPYGNAVHTTLAFNLIGEDVLIT--XXXXXXXXXXXXXXXXXXRHIVITDVNDYRLDLARTMGVSHA
DOIAD_MICEC     SQTEPLAVALHAVDRINPAERXXXXXXXXXXXXXXXSARATG---ATVTLATDLVAERRKIAEESGAAAA
YDJL_ECOLI      AVLDPICNAYKSIAQQSKPGQDVVVI-GTGPLGLFSVQRIMGAVNIVVVGLQEDVAVRFPVAKELGATAV
TDH_ALISL       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVAKHV-GARHVVITDVNEFRLDLARKMGVTRA
TDH_PHOPR       SIFDPFGNAVHTALSFDLVGEDV-LITGAGPIGIMAAAVAKHV-GARHVVITDVNEYRLDLARKMGVTRA
ADH_SULTO       VEAAPLTCSGVTTASLDPSKTLVVIGAGGG-LGTMAIQIAKAV-SGATIIGVDVREEALEAAKRAGADYV
ADH2_BACST      VEVAPILCAGVTTYKAGARPGEWVAIYGIGGLGHIALQYAKAM--GLNVVAVDISDEKSKLAKDLGADIA
XYLD_RHILO      AMVEPFAIGMQAASRARIVPGDVAVVVGCXXXXXXXXXXXXXXXCSK-VLISDFSAPKLKIAAQYAGIVP
ADHP_ECOLI      SSITVTTYKAVKLSKIRPGQW--IAIYGLGGLGNLALQYAKNVFNAK-VIAIDVNDEQLKLATEMGADLA
YPHC_ECOLI      AFISCGVGTAYLRGEVSGSDNXXXXXXXXXXXXXXXXXKGRG---AKRIIGVDMLPERLAMAKQLG---V
TDH_ANADE       XXXXXXGNATHTALSFDLVGEDV-LVTGAGPIGVMAAAIARHV-GARHVVVTDVNDYRLDLARRMGASRA
YBDR_ECOLI      LFLSDILPTAWQAAKNAQIQQGSSVVYGAGPVGLLTI-ACARLLGAEQIFVVDHHPYRLHFAADRYGAIP
XYLD_RHIME      AMVEPFAIGVQAALRAGIRPGDVGAVMGAGPIGMMTXXXXXXXXCSK-VYVADLAQPKLDVIGAYEGIET
BDHA_BACSU      ALVEPSAVALYAVRSSKLKAGDKAAVFGCGPIGLLVIEALKAA-GATDIYAVELSPERQQKAEELGAIIV
ADH_STAAW       SSITCAGVTTYKAVKVSNVKPGQWLVFGIGGLGNLALQYAKNVMGAK-IVAFDINDDKLAFAKELGADAI
ADH_STAAS       SSITCAGVTTYKAVKVSNVKPGQWLVFGIGGLGNLALQYAKNVMGAK-IVAFDINDDKLAFAKELGADAI
ADH_STAAR       SSITCAGVTTYKAVKVSNVKPGQWLVFGIGGLGNLALQYAKNVMGAK-IVAFDINDDKLAFAKELGADAI
ADH_STAAN       SSITCAGVTTYKAVKVSNVKPGQWLVFGIGGLGNLALQYAKNVMGAK-IVAFDINDDKLAFAKELGADAI
ADH_STAAM       SSITCAGVTTYKAVKVSNVKPGQWLVFGIGGLGNLALQYAKNVMGAK-IVAFDINDDKLAFAKELGADAI
ADH_STAAC       SSITCAGVTTYKAVKVSNVKPGQWLVFGIGGLGNLALQYAKNVMGAK-IVAFDINDDKLAFAKELGADAI
ADH_STAAB       SSITCAGVTTYKAVKVSNVKPGQWLVFGIGGLGNLALQYAKNVMGAK-IVAFDINDDKLAFAKELGADAI
ADH_STAA8       SSITCAGVTTYKAVKVSNVKPGQWLVFGIGGLGNLALQYAKNVMGAK-IVAFDINDDKLAFAKELGADAI
ADH_STAA3       SSITCAGVTTYKAVKVSNVKPGQWLVFGIGGLGNLALQYAKNVMGAK-IVAFDINDDKLAFAKELGADAI
ADH_SULSR       VEASPLTCSGITTASLDPT-KXXXXXXXXXXXXXXXXQIAKAVGGA-TIIGVDVREEAVETAKRAGADYV
ADH1_KLUMA      ILCAGVTVYKALKSAHIKAGDWVAISGACGGLGSLAIQYAKAMGY--RVLGIDAGDEKAKLFKELGGEYF
XYL2_PICST      ALVEPLSVGVHASKLGSVAFGDYXXXXXXXXXXXXXXXXXK-TFGAKGVIVVDIFDNKLKMAKDIGATHT
ADH1_BACST      APIFCAGVALKVTG-AKPGEW--VAIYGIGGLGHVAVQYAKAM--GLNVVAVDLGDEKLELAKQLGADLV
ADH3_BACST      APIFCAGVALKVTG-AKPGEW--VAIYGIGGLGHVAVQYAKAM--GLNVVAVDIGDEKLELAKELGADLV
ADH_RALEU       LMC-PDIMSTGFKGAENANIRHTVAVFAQGPIGLCATAGAR-LCGATTIIAIDGNDHRLEIARKMGADVV
ADH_STAEQ       SSITCAGVTTYKAVKVSGIEXXXXXXXXXXXXXXXXXQYAKNVMGAK-VVAFDINDDKLNFAKELGADAI
ADH_STAES       SSITCAGVTTYKAVKVSGIEXXXXXXXXXXXXXXXXXQYAKNVMGAK-VVAFDINDDKLNFAKELGADAI
ADH5_YEAST      ----------------------------------------------------------------------
ADH5_SACPS      ----------------------------------------------------------------------
ADH6_PERMA      CIITGFGAAIN-SAKVSP--GSTCAVFGLGGVGLSVIMGCKAAGAAR-IIAVDTNKDKFAKAKTVGAQQV
ADHL_GADMO      VCLLGCAISTGYGAALNTAKVETCAVFGLGALGLAVIMGCQAA-GASRIIAIDVNPDKFRIAKEFGATDL
TDH_SILPO       AILDPLGNAVHTALSFDLLGEDV-LITGAGPIGIMXXXXXXXXXXXXXXI-TDINADRLKLAQHVPRART
ADH_SULSO       ----------------------------------------------------------------------
ADHB_BACSU      VIADAMTTGFWSVDNAGVKKGDTVIVLGCGPVGLFAQKFLKG---AKRVIAVDYVNYRLQHAKRTNKVEI
FADH_METMR      LFLSPTGYMAAENAQIEP--GDTVAVWGCGPVAQFVIQSC-WMLGAGRVIAIDRVPERLTMAQEHGKAEI
FADH_AMYME      AGLLGCGVMAGLGAAVNTSRGDSVAVIGCGAVGDAVIAGAR-LAGANKIIAVDRDAKKLEWATELGATHT
BDH1_YEAST      ALVEPLSVTWHAVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASK-IVVSEIAERRIEMAKKLGVE-V
YHG1_SCHPO      LFMSDVSLHACTLGEVK--KGDTVAIWGMGPIGLYAGRWAQ-ILGASKVIGIEVVPERIELARQNGVDCA
ADHA_RHIME      APV----LCAGVTVYKGLKETEVVLVSGIGGLGHMAVQYAKAMGM--HVAAADIFPDKLALAEKLGADLV
ADHP_RABIT      VCLIGCGFSTGYGAAINTTPGSTCAVFGLGGVGLSAIMGCK-TAGASRIIAIDINSDKFAKAKALGATDC
FADH_CANMA      VVADISVVAINPKAEXNVQKGDNVAVFGGGIVGLSVIQAERGAAQIILVDISDKKEE-------------
CADH3_ARATH     LLCAGITVYSPMKYYGMTKESGKRLVNGLGGLGHIAVKIGKAFGLRVTVISRSSEKEREAIDRLGADSFL
ADH4_KLULA      ILCAGVTVKALKTADLKP-GQWVXXXXXXXXXXXXXVQYAKAM--GLRVLGIDGGDGKEELFKQCGGEVF
ADHX_SPAAU      CLISTGYGAALNTAKVEP--GSTCAVFGLGAVGLAVIMGCK-VAGATRIIGIDLNPAKFETAKEFGATEF
ADHX_MYXGL      GVSTGYGAPLN-TAKVEP--GSTCAIFGLGAVGLAAIMGCR-VAGASRIIAIDRNPDKFEKARIFGADCV
YYCR_BACSU      EKILDLTMLSDIHGAYTAGVQTGSTVYGAGPVGLAAAHSAQ-LLGASTVIVGDLNEDRLAQARSFGCE-T
ADH1_EMENI      ----------------------------------------------------------------------
CADH6_ARATH     ----------------------------------------------------------------------
FADH_YEAST      VAIDPCLLGCGVTKTANVQKGDTVAVFGCGTVGLSVIQGAK-----------------------------
ADHX_HORSE      VCLLGCGVSTGYGAAVNTAKVETCAIFGLGGVGLAVIMGCK-VAGASRIIGVDINKDKFAKAKEFGASEC
ADH1B_PAPHA     VCLIGCGFSTGYGSAVNVTPGSVCAVFGLGGVGLSAVMGCKAAGAAR-IIAVDINKDKFAKAKELGATEC
ADH1B_PANTR     VCLIGCGFSTGYGSAVNVTPGSTCAVFGLGGVGLSAVMGCKAAGAAR-IIAVDINKDKFAKAKELGATEC
ADHL7_ARATH     CLVSTGVGAAWETAKVE--KGSTVVIFGLGSIGLAVAEGAR-LCGASRIIGVDINPTKFQVGQKFGVSEV
ADHL6_ARATH     ICLLSCGVAAGLGAAWNVADGSSVVIFGLGTVGLSVAQGLRGAAQ---ILGVDINPAKAEQAKTFGVTDF
ADH4_STRCA      GFSTGYGAAIN-TAQVEP--GSTCAVFGLGGVGLSAVMGCKAAGASK-IFGIDINKDKFPLAKKLGATDC
ADH1S_HORSE     VCLVGCGFSTGYGSAVKVTQGSTCAVFGLGGVGLSVIMGCKAAGAAR-IIGVDINKDKFAKAKEVGATEC
CADH2_ARATH     LLCAGITVYSPMKYYGMTKESGKRLVNGLGGLGHIAVKIGKAFGLRVTVISRSSEKEREAIDRLGADSFL
ADH1B_HUMAN     VCLIGCGFSTGYGSAVNVTPGSTCAVFGLGGVGLSAVMGCKAAGAAR-IIAVDINKDKFAKAKELGATEC
DHSO_SCHPO      ALFEPMSVAVHAMTRGNLKCGSRVLVMGCGTVGLLMMAVAKA-YGAIDIVAVDASPSRVEFAQKGAKPFT
ADHC_MYCTU      ----------------------------------------------------------------------
ADHC_MYCBO      ----------------------------------------------------------------------
ADH7_RAT        CLIGGFSTAAVKTAKVSPGSTCAXXXXXXXXXXXXXXCKAAG---ASRIIGIDINKDKFQKALDVGADFT
ADHX_PEA        LLVPTGLGAVWNTAKVEP--GSIVAIFGLGTVGLAVAEGAKSA-GASRIIGIDIDSNKYDTAKNFGVTEF
ADHB_MYCTU      SVVKPFEVACLVTADVRPGD-DVAIV-GLGGVGMAALQGAVSA-GARYVFAVEPVEWKRDQALKFGATHV
ADHB_MYCBO      SVVKPFEVACLVTADVRPGD-DVAIV-GLGGVGMAALQGAVSA-GARYVFAVEPVEWKRDQALKFGATHV
ADH1A_HUMAN     VCLIGCGFSTGYGSAVNVTPGSTCAVFGLGGVGLSAIMGCKAAGAAR-IIAVDINKDKFAKAKELGATEC
ADH1_ALLMI      VCLIGCGFSTGYGAAVKDAKVETCAVFGLGGVGLSTIMGCKAA-GASRIIGIDINKDKFAKAKELGATEC
ADHX_ARATH      VVIDPTAPLDKVTAKVEPGSN--VAIFGLGTVGLAVAEGAK-TAGASRIIGIDIDSKKYETAKKFGVNEF
ADHH_GADMO      ----------------------------------------------------------------------
ADH3_YEAST      ----------------------------------------------------------------------
ADHX_MAIZE      V-VHDVSVA-----KINPAPLDKVCLLGCGPTGLGSVVAVFGLGTVSRVIGIDIDNKKFDVAKNFGVTEF
ADH2_CAEEL      VLCGGVTAYKSLKATNVKPGQIVVLTXXXXXXXXXXIQYAKAMGM--RVVAVDHISKE-DHCRNLGAEWF
MTDH_MEDSA      ----------------------------------------------------------------------
ADHX_ORYSJ      VVHDVSVAKINVWNTAKVEAGSIVAIFGLGTVGLAVAEGAKSA-GASRIIGIDIDSKKFDVAKNFGVTEF
ADHX_ORYSI      VVHDVSVAKINVWNTAKVEAGSIVAIFGLGTVGLAVAEGAKSA-GASRIIGIDIDSKKFDVAKNFGVTEF
ADHX_DROME      ----------------------------------------------------------------------
ADHQ_RABIT      VCLIGCGFSTGYGAAINDTPGSTCAVFGLGGVGLSAVIGCK-TAGASRIIAVDINSDKFAKAKALGATDC
XYLB_PSEPU      ELLGPLTGAGSVLNALNPPXXXXXXXXXXXXXXLSAVMAAV-VAGCTTIIAVDVKENRLELASELGATHI
ADH8_RANPE      ----------------------------------------------------------------------
ADH1_PEA        ILSCGICTGLGATINVAKPKPGSSVAIFXXXXXXXXXXXXXRISGASRIIGVDLVSSRFELAKKFGVNEF
CADH1_ARATH     LLCAGITVAPMMRHNMNQPGKSLGVI-GLGGLGHMAVKFGK-AFGLSVTVFSTSISKKEEALNLLGAENF
BDH2_YEAST      ALIQPLAV--------------------------------------------------------------
ADH7_HUMAN      CLIGGFSTAAVKTGKVKP--GSTCXXXXXXXXXXXXIMGCKSA-GASRIIGIDLNKDKFEKAMAVGATEC
ADH_SCHPO       API----MCAGITSKVGPGEW-ICIPGAGGGLGHLAVQYAKAM--AMRVVAIDTGDDKAELVKSFGAE--
ADHX_OCTVU      ----------------------------------------------------------------------
ADH1E_HORSE     VCLIGCGFSTGYGSAVKVTQGSTCAVFGLGGVGLSVIMGCKAAGAAR-IIGVDINKDKFAKAKEVGATEC
ADH3_HORVU      VLSCGLSTGLGATLNVKPKKGSTVAIFGLGAVGLAAMEGAR-MAGASRIIGVDLNPAKYEQAKKFGCTDF
FRMA_SYNY3      CLVTTGIGAVHNTAKVQP--GDSVAVFGLGGIGLAVVQ---GARQAKAIIAIDTNPAKFELAKQMGATDC
CADH7_ORYSJ     ----------------------------------------------------------------------
ADHX_BOVIN      ----------------------------------------------------------------------
ADH1_GEOAT      ----------------------------------------------------------------------
ADH1_GEOKN      ----------------------------------------------------------------------
YAHK_ECOLI      ----------------------------------------------------------------------
ADHX_HUMAN      VCLLGCGISTGYGAAVNTAKLEPGSXXXXXXXXXXXXXXIMGVAGASRIIGVDINKDKFARAKEFGATEC
ADH6_PONAB      VCLTGFGAAIN-TAKVTPGSTCAXXXXXXXXXXXXXXCKAAGATR---IIGVDVNKEKFKKARELGATEC
ADH1_TRIRP      ILSCGICTGLGATVNVAKPKPGSSVAIFXXXXXXXXXXXXXRMSGASRIIGVDLVSSRFELAKKFGVNEF
ADH1_CHICK      VCLIGFSTGYGAVLQTAKVEAGSTCAXXXXXXXXXXXXXXCKAAGASRIIAVDINKDKFAKAKELGATEC
ADHX_UROHA      ----------------------------------------------------------------------
ADH3_EMENI      ILCAGITVYKGLKESGARPGQTVAIVXXXXXXXXXXXXYAKAM-GLRT-IAIDSGDEKKAMCEQLGAE--
CADH8_ARATH     ----------------------------------------------------------------------
FADH_PARDE      ICYIGCGVTTGIGAVINTAKVEIAVVFGLGGIGLNVLQGLR-LAGADMIIGVDLNDDKKPMAEHFGMTHF
FADH1_SCHPO     ----------------------------------------------------------------------
ADH6_YEAST      ----------------------------------------------------------------------
ADH1_GEOBU      ----------------------------------------------------------------------
ADHX_RABIT      VCLLGCGISTGYGAALNTAKVEPGSTCXXXXXXXXXXXXIMGAAGASRIIAVDINKDKFARAKEFGATEC
ADHX_MOUSE      ----------------------------------------------------------------------
CADH9_ARATH     ----------------------------------------------------------------------
CADH7_ARATH     ----------------------------------------------------------------------
ADHX_RAT        ----------------------------------------------------------------------
ADH2_ORYSJ      ILSCGFSTGFGATVNVKPKKGQTVAIFGLGAVGLAAMEGAR-LSGASRIIGVDLNPAKFEQAKKFGCTDF
ADH2_ORYSI      ILSCGFSTGFGATVNVKPKKGQTVAIFGLGAVGLAAMEGAR-LSGASRIIGVDLNPAKFEQAKKFGCTDF
ADH1A_PONAB     ----------------------------------------------------------------------
FADH2_SCHPO     ----------------------------------------------------------------------
CADH3_ORYSJ     ----------------------------------------------------------------------
ADH_SULAC       ----------------------------------------------------------------------
ADH4_RAT        CLIGGFTSAAINTAKVTP--GSACAVFGLGCVGLSAVIGCK-IAGASRIIAIDINSEKFPKAKALGATDC
ADH1_COTJA      VCLIGFSTGYGAVLQTAKVEPGSTCAXXXXXXXXXXXXXXCKAAGASRIIAIDINKDKFAKAKELGATEC
CADH_PINTA      ----------------------------------------------------------------------
CADH_PINRA      ----------------------------------------------------------------------
ADHL5_ARATH     LLSCGVSTGIGAAWKVANVEKGSTXXXXXXXXXXXXXXXXXRLRGAGKIIGVDLNPEKFELGKKFGFTDF
ADH1_CAEEL      ----------------------------------------------------------------------
FRMA_ECOSM      CLVTTGIGAVHNTAKVQP--DDSVAVFGLGAIGLAVVQ---GARQAKAIIAIDTNPKKFDLARRFGATDC
CADH5_ORYSJ     ----------------------------------------------------------------------
FRMA_ECOUT      CLVTTGIGAVHNTAKVQP--GDSVAVFGLGAIGLAVVQ---GARQAKAIIAIDTNPKKFELARRFGATDC
FRMA_ECOL5      CLVTTGIGAVHNTAKVQP--GDSVAVFGLGAIGLAVVQ---GARQAKAIIAIDTNPKKFELARRFGATDC
FRMA_ECOK1      CLVTTGIGAVHNTAKVQP--GDSVAVFGLGAIGLAVVQ---GARQAKAIIAIDTNPKKFELARRFGATDC
ADH6_HUMAN      ----------------------------------------------------------------------
ADH1_ASPFN      VLCAGITVYKGLKESGVRPGQTVAIVXXXXXXXXXXXQYAKAM--GIRVVAIDGGEEKQAMCEQLGAE--
FRMA_SHISS      CLVTTGIGAVHNTAKVQP--GDSVAVFGLGAIGLAVVQ---GARQAKAIIAIDTNPKKFDLARRFGATDC
FRMA_ECOLC      CLVTTGIGAVHNTAKVQP--GDSVAVFGLGAIGLAVVQ---GARQAKAIIAIDTNPKKFDLARRFGATDC
FRMA_ECOHS      CLVTTGIGAVHNTAKVQP--GDSVAVFGLGAIGLAVVQ---GARQAKAIIAIDTNPKKFDLARRFGATDC
FRMA_ECO57      CLVTTGIGAVHNTAKVQP--GDSVAVFGLGAIGLAVVQ---GARQAKAIIAIDTNPKKFDLARRFGATDC
FRMA_ECO24      CLVTTGIGAVHNTAKVQP--GDSVAVFGLGAIGLAVVQ---GARQAKAIIAIDTNPKKFDLARRFGATDC
ADH1_MOUSE      TVVDDIAV-AKIDG-ASPLDK-VCLIYGAVKVAKVTPGSTCAVFXAARIIAVDINKDKFAKAKELGATEC
ADH1G_HUMAN     ----------------------------------------------------------------------
ADHL1_ARATH     LLSCGVSTGIGAAWKVANVEEGSTIAIFXXXXXXXXXXXXXRLRGAAKIIGIDTNSDKFELGKKFGFTDF
FRMA_ECOL6      CLVTTGIGAVHNTAKVQP--GDSVAVFGLGAIGLAVVQ---GARQAKAIIAIDTNPKKFELARRFGATDC
ADH2_HORVU      LLSCGISTGLGATLNVKPKKGMTVAIFGLGAVGLAAMEGAR-MSGASRIIGVDLNPAKHEQAKKFGCTDF
ADH1_RAT        ----------------------------------------------------------------------
YL498_MIMIV     ----------------------------------------------------------------------
CADH6_ORYSJ     ----------------------------------------------------------------------
YJGB_ECOLI      ----------------------------------------------------------------------
FRMA_ECOLI      CLVTTGIGAVHNTAKVQP--GDSVAVFGLGAIGLAVVQ---GARQAKAIIAIDTNPKKFDLARRFGATDC
ADH2_MAIZE      ILSCGISTGLGATLNVKPAKGSTVAIFGLGAVGLAAMEGAR-LAGASRIIGVDINPAKYEQAKKFGCTEF
ADH2_EMENI      LLCAGVTVYASLKRSKAQPGQWIVISGAGGGLGHLAVQAAKGM--GLRVIGVDH-GSKEELVKASGAE--
ADH1_RABIT      VCLIGCGFSTGYGSAVKVTPGSTCAVFGLGGVGLSVIMGCKAA-GASRIIAVDINKDKFPKAKEVGATEC
MTDH1_STYHU     ----------------------------------------------------------------------
ADH_MYCPN       CMLSDMIPTGFHANELADIQYGVALFFCAGPVGLMAIAALKGAGR---IIVVDSRPDIVEIAKAYGADFK
ADH1_ARATH      IVSCGLSTGLGATLNVAKPKKGQSXXXXXXXXXXXXXXXXXRIAGASRIIGVDFNSKRFDQAKEFGVTEC
MTDH_PETCR      ----------------------------------------------------------------------
MTDH_FRAAN      ----------------------------------------------------------------------
DHSO_PIG        ----------------------------------------------------------------------
ADH_MALDO       ----------------------------------------------------------------------
ADH1_HORVU      VM--------------------------------------------------------------------
ADH1_GADCA      ----------------------------------------------------------------------
ADH1B_UROHA     VCLIGCGFSTGYGAAINSAKGSTCAVFGLGGVGLSAVMGCKAA-GASRIIGIDINKEKFPKAKELGADMT
FRMA_HAEIN      VCLLGCGVTTGI-GAVHNTEGDSVAVFGLGAIGLAVVQ---GARQAKAIIAIDTNPAKFELAKQFGATDC
ADHX_DICDI      LLGCGITTAAKITAKVE--EGSTVAIFGLGAVGLSVAQGAVDC-GAKRIIGIDNNETKFGPGKDFGCTEF
ADHL2_ARATH     ----------------------------------------------------------------------
ADH4_HUMAN      VCLLGCGFSTGYGAAINVTPGSTCAVFGLGGVGLSAVMGCKAA-GASRIIGIDINSEKFVKAKALGATDC
ADH1_PENAM      VM--------------------------------------------------------------------
MTDH_MESCR      ----------------------------------------------------------------------
MTDH3_STYHU     ----------------------------------------------------------------------
ADHL3_ARATH     ----------------------------------------------------------------------
ADH1_PERMA      ----------------------------------------------------------------------
CADH4_ORYSJ     SKAAPLLCAGMIRHNMNQPGKSLGVI-GLGGLGHMAVKFGKAFGLKVTVFSTSESKREEAINLLGADNFV
FADH_PSEPU      EKIRDLTCLSDIL----PTGYHGAVTAGVGP---------------------------------------
FADH_PSEAE      ----------------------------------------------------------------------
ADH4_MOUSE      VCLIGCGFSSGYGAAINTTPGSTCAVFGLGCVGLSAIIGCK-IAGASRIIAIDINGEKFPKAKALGATDC
ADH1_MAIZE      VM--------------------------------------------------------------------
ADH3_KLULA      ILCAGVTVYKALKSANLKAGDWVXXXXXXXXXXXXXVQYAKAMGY--RVVGIDGGEEKGKLVKQLGGEAF
ADH1_ORYSJ      VM--------------------------------------------------------------------
ADH1_ORYSI      VM--------------------------------------------------------------------
YBJB_SCHPO      ASVVPFTTA-------------------------------------------------------------
ADHI_RHOS4      ICYIGCGVTTGIGAVINTAKVEIAVVFGLGGIGLNVIQGLK-LAGADMIIGVDLNNAKKEWGERFGMTHF
ADH1A_MACMU     VCLIGCGFSTGYGSAVKVTPGSTCAVFGLGGVGLSAVMGCKAAGAAR-IIAVDINKDKFAKAKELGATEC
ADH_FRAAN       ----------------------------------------------------------------------
ADH3_SOLTU      ----------------------------------------------------------------------
ADH2_SOLTU      ----------------------------------------------------------------------
ADH2_SOLLC      ----------------------------------------------------------------------
ADH1_SOLTU      ----------------------------------------------------------------------
ADH1_PICST      ILCAGITVKALKTAQIQP----------------------------------------------------
ADH1_NEUCR      VLCAGITVYKGLKESGVRPGQCVAIVGAGGGLGSMAIQYANAM--GLHAIAIDGGEEKGKNCRELGADFT
ADH7_YEAST      ----------------------------------------------------------------------
ADH1_PETHY      ----------------------------------------------------------------------
ADH2_KLULA      ILCAGVTVYKALKSADLKAGDWVAISGACGGLGSLAIQYAKAMGY--RVLGIDTGAEKAKLFKELGGEY-
QOR_PIG         IGIPYFTACLALLHSACVKAGEIVLIHGAGGVGIAACQIAR-AYGLK-VLGTAGTEEGQNIVLQNGAHEV
FRMA_PASPI      LLGCGVTTGIGVHNTAKVQEGDSVAVFGLGGIGLAVVQ---GARQAKAIFAIDTNPSKFELAKQFGATDC
ADH2_YEAST      ----------------------------------------------------------------------
ADH2_CANAL      ----------------------------------------------------------------------
QOR_HUMAN       IGIPYFTAYRALIHSACVKAGESVLVHGAGGVGLAACQIAR-AYGLK-ILGTAGTEEGQKIVLQNGAHEV
CAD8A_ORYSJ     ----------------------------------------------------------------------
FDEH_PSEPU      LAALGCALPTVLRGRCGPVGLDDTXXXXXXXXXXXXXXXXXXXXXXKDIIAIDHSPIRLDMARSLGATET
QOR_CAVPO       IGIPYFTACRALFHSARAKAGESVLVHGAGGVGLAACQIAR-AYGLK-VLGTAGTEEGQKVVLQNGAHEV
ADH2_PICST      ----------------------------------------------------------------------
VAT1L_MOUSE     ----------------------------------------------------------------------
ADHA_BACSU      ----------------------------------------------------------------------
ADH1_CANAL      ILCAGVTVYKALKTADLAAGQWVAIXXXXXXXXXXXVQYARAM--GLRVVAIDGGDEKGEFVKSLGAE--
CADH1_ORYSJ     LLCAGITVSPMMRHNMNQPGKSLGVI-GLGGLGHMAVKFGKAFGLKVTVISTSESKRKEAIDLLGADNFV
ADH1A_UROHA     VCLIGCGFAAVETAKVEP--GSTCAVFGLGGVGLSAVMGCKAA-GASRIIGVDINKDKFPKAKEMGATEC
VAT1L_HUMAN     ----------------------------------------------------------------------
ADH1_KLULA      VLCAGVTVYKALKSANLKAGDWVXXXXXXXXXXXXXVQYAKAMGY--RVLGIDAGEEKAKLFKDLGGEYF
ADH1G_PAPHA     PLEKVCLIGCGFSTGYGPTPGSTCAVFGLGGVGLSAVMGCKAAGAAR-IIAVDINKDKFAKAKELGATEC
QOR_BOVIN       IGIPYFTAYRALLHSACVKPGESVLVHGAGGVGIAACQIAR-AYGLK-VLGTASTEEGQKIVLENGAHKV
CAD8C_ORYSJ     ----------------------------------------------------------------------
QOR_PONAB       IGIPYFTAYRALIHSAHVKAGESVLVHGAGGVGLAACQIAR-AYGLK-VLGTAGTEEGQKIVLQNGAHEV
MTDH_APIGR      PL-----LCAGIT-TYSPLK-----YYGLDKPGTVAVKMAKAFGAQVTVIDISESKRKEALEKLGADSFL
CADH9_ORYSJ     ----------------------------------------------------------------------
CAD8D_ORYSJ     ----------------------------------------------------------------------
CAD8B_ORYSJ     ----------------------------------------------------------------------
ADH1_YEAST      ----------------------------------------------------------------------
TERPD_PSESP     ----------------------------------------------------------------------
CADH7_PICAB     ----------------------------------------------------------------------
CADH2_PICAB     ----------------------------------------------------------------------
YOGA_BACSU      GVLPLSALTAYTKGQLKKGEH--LLIPGIG-SGVATYALFMAKAIGATVSVTSRSEEKRKKALKLGADYA
ZDH1_STAAR      VSLPLTGITAYETFSHNPSEKSVLIINGAGGVGSIATQIAKR-YGL-TVITTASRQETTEWCEKMGADIV
ADH1_RANPE      CLITGYGSAVN-TGKVKP--GSTCAVFXXXXXXXXXXXXCK-VAGASRIIGVDLNSDKFTTAKECGATEC
ADH1_APTAU      ----------------------------------------------------------------------
CADH_EUCBO      VMCAGVTV--------------------------------------------------------------
ZDH1_STAAC      VSLPLTGITAYETFSTNPAENEVLIINGAGGVGSIATQIAKR-YGL-TVITTASRQETTEWCEKMGADIV
QOR_LAMGU       IGVPYFTAYRALLHSACAKAGESVLVHGAGGVGLAACQIARAC--CFKVLGTAGTEEGQRVVLQNGAHEV
GEDH1_OCIBA     ----------------------------------------------------------------------
CADH_EUCGL      ----------------------------------------------------------------------
CADH1_EUCGU     ----------------------------------------------------------------------
ZDH1_STAAW      VSLPLTGITAYETFSHNPAENEVLIINGAGGVGSIATQIAKR-YGL-TVITTASRQETTEWCEKMGADIV
ZDH1_STAAS      VSLPLTGITAYETFSHNPAENEVLIINGAGGVGSIATQIAKR-YGL-TVITTASRQETTEWCEKMGADIV
ZDH1_STAAN      VSLPLTGITAYETFSHNPSEKSVLIINGAGGVGSIATQIAKR-YGL-TVITTASRQETTEWCEKMGADIV
ZDH1_STAAM      VSLPLTGITAYETFSHNPSEKSVLIINGAGGVGSIATQIAKR-YGL-TVITTASRQETTEWCEKMGADIV
CADH2_EUCGU     ----------------------------------------------------------------------
ADH6_RAT        VCIIGCGFATGYGAAINSTPGSTCAVFXXXXXXXXXXXXCKAAGAAR-IIAVDINKDRFAKAKTVGATDC
QORL2_MOUSE     AVLPTAILAVDHRARIQPGE-XXXXXXXXXXXXXXXIDVATNVFRAK-VIAATGSDEKCKLAVQRGAQFS
CADH1_ARACO     ----------------------------------------------------------------------
ADH1_STRCA      ----------------------------------------------------------------------
ADH1_ENTHI      VMLDMVTTGFHGAELANIKLGDTVCVIGIGPVGLMSVAGANHLGAGRIFAVGSR-KHCCDIALEYGATDI
QOR_LEIAM       LPVSALT-AAVALGEVGRVKKDVALVXXXXXXXXIAVQLLKHVYGC-TVIGTCSSEEKAEFLKSIGCDHV
QORL2_RAT       AVLPTAILAVDHRARIQPGE-XXXXXXXXXXXXXXXIDVATNVFCAK-VIAAAGSDEKCKLAMQRGAQSG
ZDH1_STAES      ASLPLTGLTADVFGSKEPSEKSLLIINGAGGVGSIATQIAK-FYGLKVITTASR-EDTIKWSVNMGADVV
ZDH1_STAEQ      ASLPLTGLTADVFGSKEPSEKSLLIINGAGGVGSIATQIAK-FYGLKVITTASR-EDTIKWSVNMGADVV
QOR_MOUSE       LGIPYFTACRALFHSARARAGESVLVHGAGGVGLATCQIAR-AHGLK-VLGTAGSEEGKKLVLQNGAHEV
ZADH2_HUMAN     LLVSGTTAYISLKELGGLSEKKVLVTAAAGGTGQFAMQLSK---KAKCVIGTCSSDEKSAFLKSLGCDRP
QOR_RAT         LGIPYFTACRALFHSARARAGESVLVHGAGGVGLATCQIAR-AHGLK-VLGTAGSEEGKKLVLQNGAHEV
FADH_PICPA      CLVTTGYGAAINTAKI--SKGDKIGVFGAGCIGLSVIQGAKGASE---IIVIDINDSKKAWADQFGATKF
ZADH2_BOVIN     LLVSGTTAYISLKELGGLSEKKVLVTAAAGGTGQFAVQLAK---KAKCVIGTCSSAEKSAFLKSVGCDRP
YGD6_SCHPO      ATLPCAAVTAGLFGSKEHQVKPXXXXXXXXXXXXSTFALQFALAAGANVTVTSSSDEKLEFAKKLGATHT
QOR_SALTY       AFLKGLTVLLRKTYEVKP-DEPFLFHAAAGGVGLIACQWAKGAKLIGTVGSAQKAQRAL----DAGAWQV
ADHX_CAEEL      ----------------------------------------------------------------------
ADH1_NAJNA      ----------------------------------------------------------------------
YGGP_ECOLI      CIIGAYHANYHTTQYVYEHRMNIALLACAGPMGIGAIDAINGGIQPSRVVVVDIDDKRLAQVQK------
TARJ_BACSU      AFTELITIAVHALSRMAHKKRDTFGVWGDGNLGFIMTLLLKKKYPDSKVFIFGKTPYKLDHFSFVDAAYQ
ADH7_MOUSE      CLIGGFSTAAVKTAKVTPXXXXIMGCKAAGASRIIGIDINKDKFQKALAVGATECKDSTKPISEVLSDMT
ZADH2_MOUSE     MLVSGTTYXXXXXXXXXXXXKKVLVTAAAGGTGQFAVQLSK--IAKCHVIGTCSSDEKAAFLKSIGCDRP
VAT1_DANRE      AALPVNYITAYMMGHLRP-NQSVLVHMAAGGVGIAATQLCKTVNDV------------------------
YHFP_BACSU      MVTAGFTAALSV----------------------------------------------------------
ADH2_KLUMA      ----------------------------------------------------------------------
CADH_POPDE      ----------------------------------------------------------------------
ADHL4_ARATH     ----------------------------------------------------------------------
MAO1_SHEWM      VTVGSL-LAACKAAKSQLCEQRIAFL-GAGSAGCGIAEAIEGIDEAQAVFMVDRFQEKLAQKTQAVKDWT
VAT1_TORCA      AAISVNYTAAYVMANLRPS-QSILIHMAAGGVGIAATQLCKLVHDV------------------------
PKS7_DICDI      SFISLFNV-----GSLNIEDNESILIHGSDGFGLSTFEILK-----------------------------
DHG_THEAC       ----------------------------------------------------------------------
PKS5_DICDI      SFMSLFNV-----GCLNIEDNESILIHGSDSFGLSTFEILK-----------------------------
RT4I1_DICDI     ----------------------------------------------------------------------
PKS9_DICDI      SFMSLFNI-----GSLNIEDNESILIHGSDGFGLSTFEILK-----------------------------
PKS8_DICDI      SFMSLFNV-----GSLNIEDNESILIHGSDSFGLSTFEILK-----------------------------
MECR_DROME      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LNNGQHSLAEFLQQKALKPTLIVDAACHPAILQEAITLASPAARIVLMGFSSDPCEIVQQGITGKELAIY
RSPB_ECOLI      INNSQTPLGEIFTEKGIKPTLIIDAACHPSILKEAVTLASPAARIVLMGFSSEPSEVIQQGITGKELSIF
YJMD_BACSU      VN----VQAEHVAERVLEWTVVIDAVCLPETFALSIEAVSPAGHVVVLGFDERAAQISQLPITKKEVTIT
Y053_HAEIN      VNPHKEDDIKRIKESGRMAEVVMEASGANISIKNTLHYASFAGRIALTGWPKTETPLPTNLITFKELNIY
YDJJ_ECOLI      INGAKEDTIARCQQEDMGADIVFETAGSAVTVKQAPYLVMRGGKIMIVGTVPGDSAINFLKI-NREVTIQ
DHSO_BACSU      INIREQDALEEIKTITNDRGVDVETAGNPAALQSALASVRRGGKLAIVGLSQNEIPLNVPFIADNEIDIY
IDND_VITVI      IQDLDEEVAKIQSTMVTGVDVSFDCVGFNKTMSTALNATRAGGKVCLVGLAQSEMTVPLTPAAAREVDIV
DOIAD_STRFR     XXXXXXXXELTRSDPAAVPDVVLEASGYPTAVQEAVEAVRPGGRVGLVGYRIEEAAVMPHHIVLKVLTVR
TDH_THET8       VNPLEEDLLEVVRRTGSGVEVLLEFSGNEAAIHQGLMALIPGGEARILGIPSDPIELVMRGITAFGIALW
TDH_THET2       VNPLEEDLLEVVRRTGSGVEVLLEFSGNEAAIHQGLMALIPGGEARILGIPSDPIELVMRGITAFGIALW
TDH_COXBU       VNSTKTPLTETMKNLGMTEGFDVEMSGNAEAFRSMLTVMNNGGKIAFLGIPPEPFAIDWNQVVFKSLGIY
TDH_COXBR       VNSTKTPLTETMKNLGMTEGFDVEMSGNAEAFRSMLTVMNNGGKIAFLGIPPEPFAIDWNQVVFKSLGIY
TDH_COXBN       VNSTKTPLTETMKNLGMTEGFDVEMSGNAEAFRSMLTVMNNGGKIAFLGIPPEPFAIDWNQVVFKSLGIY
TDH_COXB2       VNSTKTPLTETMKNLGMTEGFDVEMSGNAEAFRSMLTVMNNGGKIAFLGIPPEPFAIDWNQVVFKSLGIY
TDH_ERWCT       VNVAEEKLTDVMIELGMTEDIGLEMSGAPSAFRAMLKAMNHGGRIAMLGIPHEPMSIFIKGIYGREMFET
DHSO_BACHD      IDTQEVDIKELVSELTDGYGADVVLECSGAVAKQGIDLLRKKGQYAQVGLFAQPIQFNFEKIIQKEISVV
TDH_VIBPA       VNVAEEKLEDVMAELGMTEGFDVEMSGNPAAFNSMLTTMNHGGRIALLGIPPSDMGIVIKGIYGREM---
TDH_BACSU       VSIEKEDPLKIVSTSGEGADLVCEMSGHPSAIAQGLAMAANGGRFHILSLPEHPVTITIQGITGRKM---
TDH_AERS4       VNVSKEKLADVMSALGMTEGFDVEMSGVPSAFQDMIDKMNHGGKIAMLGIPPSTMAIDWNKVIFKGLGIY
TDH_EDWI9       VNVSRESLPEVMQ---------------------------------------------------------
TDH_YERPY       VNVSKENLNDVMTELGMTEGFDVEMSGAPPAFRSLLNSMNHGGRIAMLGMSIDWNQVIFKGLFIK--GIY
TDH_YERPS       VNVSKENLNDVMTELGMTEGFDVEMSGAPPAFRSLLNSMNHGGRIAMLGMSIDWNQVIFKGLFIK--GIY
TDH_YERPP       VNVSKENLNDVMTELGMTEGFDVEMSGAPPAFRSLLNSMNHGGRIAMLGMSIDWNQVIFKGLFIK--GIY
TDH_YERPN       VNVSKENLNDVMTELGMTEGFDVEMSGAPPAFRSLLNSMNHGGRIAMLGMSIDWNQVIFKGLFIK--GIY
TDH_YERPG       VNVSKENLNDVMTELGMTEGFDVEMSGAPPAFRSLLNSMNHGGRIAMLGMSIDWNQVIFKGLFIK--GIY
TDH_YERPE       VNVSKENLNDVMTELGMTEGFDVEMSGAPPAFRSLLNSMNHGGRIAMLGMSIDWNQVIFKGLFIK--GIY
TDH_YERPB       VNVSKENLNDVMTELGMTEGFDVEMSGAPPAFRSLLNSMNHGGRIAMLGMSIDWNQVIFKGLFIK--GIY
TDH_YERPA       VNVSKENLNDVMTELGMTEGFDVEMSGAPPAFRSLLNSMNHGGRIAMLGMSIDWNQVIFKGLFIK--GIY
TDH_YERP3       VNVSKENLNDVMTELGMTEGFDVEMSGAPPAFRSLLNSMNHGGRIAMLGMSIDWNQVIFKGLF