[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF66838.1

[Show Plain Result]


## Summary of Sequence Search
    1::370
  481::763     4e-53  48%  870 aa  ADH2_ENTHI RecName: Full=Aldehyde-alcohol dehydrogenase 2;Includes:
    1::374     2e-52  36%  388 aa  ADH1_CLOSA RecName: Full=NADPH-dependent butanol dehydrogenase;    
   21::387     2e-52  41%  395 aa  EUTG_ECOLI RecName: Full=Ethanolamine utilization protein eutG;    
   15::375     2e-48  36%  383 aa  ADH2_ZYMMO RecName: Full=Alcohol dehydrogenase 2;       
   51::387     1e-45  40%  395 aa  EUTG_SALTY RecName: Full=Ethanolamine utilization protein eutG;    
   36::375     1e-44  41%  383 aa  ADH2_ECOLI RecName: Full=Probable alcohol dehydrogenase;       
   58::406     1e-43  36%  422 aa  ADH4_SCHPO RecName: Full=Alcohol dehydrogenase 4;       
   29::379     7e-43  37%  387 aa  DHAT_KLEPN RecName: Full=1,3-propanediol dehydrogenase;       
  479::847     2e-40  35%  891 aa  ADHE_ECOLI RecName: Full=Aldehyde-alcohol dehydrogenase;Includes:
  479::847     2e-40  35%  891 aa  ADHE_ECO57 RecName: Full=Aldehyde-alcohol dehydrogenase;Includes:
    4::375     2e-37  35%  383 aa  FUCO_ECOLI RecName: Full=Lactaldehyde reductase;       
    4::375     2e-37  35%  383 aa  FUCO_ECO57 RecName: Full=Lactaldehyde reductase;       
   29::379     3e-37  35%  387 aa  DHAT_CITFR RecName: Full=1,3-propanediol dehydrogenase;       
  505::751     3e-37  39%  862 aa  ADHE_CLOAB RecName: Full=Aldehyde-alcohol dehydrogenase;Includes:
   24::290     3e-36  35%  381 aa  MEDH_BACMT RecName: Full=NAD-dependent methanol dehydrogenase;     
   14::297     5e-35  35%  382 aa  ADH4_YEAST RecName: Full=Alcohol dehydrogenase 4;       
   14::297     2e-34  35%  382 aa  ADH4_YEAS7 RecName: Full=Alcohol dehydrogenase 4;       
   60::305     3e-32  34%  402 aa  GBSB_BACSU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   67::280     5e-28  35%  371 aa  4HDB_CLOK5 RecName: Full=NAD-dependent 4-hydroxybutyrate
  117::272     2e-21  35%  359 aa  TFDF2_RALEJ RecName: Full=Maleylacetate reductase 2;       
   63::368     3e-21  29%  462 aa  HOT_AEDAE RecName: Full=Probable hydroxyacid-oxoacid
    6::288     3e-21  29%  390 aa  ADHB_CLOAB RecName: Full=NADH-dependent butanol dehydrogenase B;   
    6::288     4e-21  28%  389 aa  ADHA_CLOAB RecName: Full=NADH-dependent butanol dehydrogenase A;   
  103::368     7e-21  31%  464 aa  HOT_ANOGA RecName: Full=Probable hydroxyacid-oxoacid
  144::305     3e-20  40%  423 aa  MEDH_RHOER RecName: Full=NDMA-dependent methanol dehydrogenase;    
   59::339     2e-19  28%  352 aa  TFTE_BURCE RecName: Full=Maleylacetate reductase;       
   64::369     3e-19  28%  463 aa  HOT_XENTR RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
   68::373     3e-19  31%  467 aa  HOT_HUMAN RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
   66::371     1e-18  29%  465 aa  HOT_MOUSE RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
    1::289     7e-18  30%  387 aa  YQHD_ECOLI RecName: Full=Alcohol dehydrogenase yqhD;       
   68::373     7e-18  29%  467 aa  HOT_RAT RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
   68::373     7e-18  30%  467 aa  HOT_PONAB RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
   73::372     7e-18  29%  466 aa  HOT_BOVIN RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
   64::367     3e-17  25%  463 aa  HOT_XENLA RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
   92::267     2e-16  28%  352 aa  TFDF_DELAC RecName: Full=Maleylacetate reductase;       
   92::267     2e-16  28%  352 aa  TCBF_PSESQ RecName: Full=Maleylacetate reductase;       
   63::370     5e-16  27%  464 aa  HOT_DROME RecName: Full=Probable hydroxyacid-oxoacid
   71::273     7e-16  30%  357 aa  MACA1_RHOOP RecName: Full=Maleylacetate reductase 1;       
    5::295     9e-16  25%  390 aa  YUGK_BACSU RecName: Full=Probable NADH-dependent butanol
   63::370     2e-15  27%  464 aa  HOT_DROPS RecName: Full=Probable hydroxyacid-oxoacid
   88::268     5e-15  27%  352 aa  CLCE_PSESB RecName: Full=Maleylacetate reductase;       
   88::268     6e-15  27%  352 aa  CLCE_PSEAE RecName: Full=Maleylacetate reductase;       
  103::363     1e-14  28%  465 aa  HOT_CAEEL RecName: Full=Probable hydroxyacid-oxoacid
  176::453     2e-14  28%  547 aa  HOT_DICDI RecName: Full=Probable hydroxyacid-oxoacid
    5::294     3e-14  26%  387 aa  YUGJ_BACSU RecName: Full=Probable NADH-dependent butanol
  113::260     6e-13  28%  354 aa  TFDF1_RALEJ RecName: Full=Maleylacetate reductase 1;       
  103::363     6e-13  27%  465 aa  HOT_CAEBR RecName: Full=Probable hydroxyacid-oxoacid
   64::311     1e-09  27%  395 aa  ADH3_ENTHI RecName: Full=Alcohol dehydrogenase 3;       
   76::290     5e-09  32%  367 aa  GLDA_ECOLI RecName: Full=Glycerol dehydrogenase;       
   76::290     5e-09  32%  367 aa  GLDA_ECOL6 RecName: Full=Glycerol dehydrogenase;       
   10::177     2e-07  24%  364 aa  GLDA_THEMA RecName: Full=Glycerol dehydrogenase;       
   76::183     2e-07  34%  362 aa  YBDH_ECOLI RecName: Full=Uncharacterized oxidoreductase ybdH;      
   93::276     2e-07  28%  385 aa  Y1167_SYNY3 RecName: Full=Uncharacterized oxidoreductase slr1167;  
  147::334     8e-07  29%  450 aa  GLD1_SCHPO RecName: Full=Glycerol dehydrogenase;       
   87::257     3e-06  27%  352 aa  G1PDH_IGNH4 RecName: Full=Glycerol-1-phosphate dehydrogenase
   27::258     1e-05  23%  352 aa  G1PDH_HALSA RecName: Full=Glycerol-1-phosphate dehydrogenase
   27::258     1e-05  23%  352 aa  G1PDH_HALS3 RecName: Full=Glycerol-1-phosphate dehydrogenase
   88::254     2e-05  29%  348 aa  G1PDH_METST RecName: Full=Glycerol-1-phosphate dehydrogenase
   92::258     9e-05  23%  352 aa  G1PDH_NATPD RecName: Full=Glycerol-1-phosphate dehydrogenase
   37::255     2e-04  28%  351 aa  G1PDH_SULIM RecName: Full=Glycerol-1-phosphate dehydrogenase
   37::255     2e-04  28%  351 aa  G1PDH_SULIK RecName: Full=Glycerol-1-phosphate dehydrogenase
   37::255     2e-04  28%  351 aa  G1PDH_SULIA RecName: Full=Glycerol-1-phosphate dehydrogenase
   88::255     4e-04  31%  351 aa  G1PDH_SULIL RecName: Full=Glycerol-1-phosphate dehydrogenase
   97::272     5e-04  28%  365 aa  GLDA_CITFR RecName: Full=Glycerol dehydrogenase;       
   10::169     5e-04  27%  351 aa  G1PDH_METS5 RecName: Full=Glycerol-1-phosphate dehydrogenase
   88::255     6e-04  31%  351 aa  G1PDH_SULIY RecName: Full=Glycerol-1-phosphate dehydrogenase
   88::255     6e-04  31%  351 aa  G1PDH_SULIN RecName: Full=Glycerol-1-phosphate dehydrogenase
   78::137     6e-04  30%  349 aa  G1PDH_HYPBU RecName: Full=Glycerol-1-phosphate dehydrogenase
   55::278     8e-04  29%  363 aa  AROB_ARTAT RecName: Full=3-dehydroquinate synthase;       
    1::370

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNTFSLQTRLYSGQGSLAVLKRFTNKHIWIICDGFLAHSPLLDTLRNALPADNRISVFSEITPAPTIHTV
ADH2_ENTHI      ----------------LAELKELSK--IFIVSDRMMYKLGYVDRVMDVLKRRSNIEIFIDVEPDPSIQTV
ADH1_CLOSA      MMRFTLPRDIYYGKGSLEQLKNLKGKKAMLVLGGSMKRFGFVDKVLGYLKAGIEVKLIEGVEPDPSVETV
EUTG_ECOLI      VKTFSVPPVTLCGPGSVSSCGQQAQKHLFVMADSFLHQAGMTAGLTRSLTVKGAMTLWPCPVGEPCITDV
ADH2_ZYMMO      ------------GEGSLEKAIKDLNKNALIVSDAFMNKSGVVKQVADLLKAQGNSAVYDGVMPNPTVTAV
EUTG_SALTY      --------------------------HLFVMVDSFLHQAGMTAPLARSLAMKGVAMTVWPCPPGPCITDV
ADH2_ECOLI      -----------------------------IVTDNMLTKLGMAGDVQKALEERNIFSVIYDGTPNPTTENV
ADH4_SCHPO      ------------GKGCLAEIKMSGFKNTLIVTDPGIIKVGLYDKVKALLEEQSTVHLYDGVQPNPTVGNV
DHAT_KLEPN      --------QLLGGKKALLV----TDKGLRAIKDGAVDK-----TLHYLREAGIEVAIFDGVEPNPKDTNV
ADHE_ECOLI      ------------------------HKRALIVTDRFLFNNGYADQITSVLKAAGETEVFFEVEADPTLSIV
ADHE_ECO57      ------------------------HKRALIVTDRFLFNNGYADQITSVLKAAGETEVFFEVEADPTLSIV
FUCO_ECOLI      -NRMILNETAWFGRGAVGALKRRGYQKALIVTDKTLVQCGVVAKVTDKMDAAGLAAIYDGVVPNPTITVV
FUCO_ECO57      -NRMILNETAWFGRGAVGALKRRGYQKALIVTDKTLVQCGVVAKVTDKMDAAGLAAIYDGVVPNPTITVV
DHAT_CITFR      --------KLLGGKKALLV----TDKGLRAIKDGAVDK-----TLTHLREAGIDVVVFDGVEPNPKDTNV
ADHE_CLOAB      ---------------------------------------------------DIDFKVFNKVGREADLKTI
MEDH_BACMT      -------------------LKQIGAKKALIVTDAFLHSTGLSEEVKNIREAGLDVAIFPKAQPDPADTQV
ADH4_YEAST      ----------FFGEGALEYIKNKDYKKALIVTDPGIAAIGLSGRVQKMLEEDLNVAIYDKTQPNPNIANV
ADH4_YEAS7      ----------FFGEGALEYIKNKDYKKALIVTDPGIAAIGLSGRVQKMLEERGNVAIYDKTQPNPNIANV
GBSB_BACSU      ---------------------------------------PVIESLKEA---GIEVVLFNKVEPNPPVRLV
4HDB_CLOK5      ------------------------------------------------------------------INNI
TFDF2_RALEJ     ----------------------------------------------------------------------
HOT_AEDAE       -------------------LQNLNAKNVCIVTDRNVAK---LNSVKVAFDSLTRCGVYDETRVEPTDQSL
ADHB_CLOAB      ---YSIPTRIFFGKDKINVLKKYGSKVLIVYGGGSIKRNGIYDKAVSILEKNSKFYELAGVEPNPRVTTV
ADHA_CLOAB      ---YSIPTKVFFGKGKIDVIKKYGSRVLIVYGGGSIKRNGIYDRA-TAILKENNIAFYSGVEPNPRITTV
HOT_ANOGA       --------------------------------------------------------LFDAVRVEPTNESL
MEDH_RHOER      ----------------------------------------------------------------------
TFTE_BURCE      ------------------------------------------------------VGVFPRATMHVPIELA
HOT_XENTR       -------------------LQNLGARNVCVMTDRNLVELSPVKAVLNSLVKNNSFKLYDRVRVEPTDKSF
HOT_HUMAN       -------------------LKNMGAKNVCLMTDKNLSKLPAMDSLKNGIP----FTVYDNVRVEPTDSSF
HOT_MOUSE       -------------------LQNMGAKNVCLMTDKNLSQLPPVQIVMDSL-SKNGISVYDDVRVEPTDGSF
YQHD_ECOLI      MNNFNLHTRILFGKGAIAGLREQIPHDARVLITGSVKKTGVLDQVLDALKGMDVLE-FGGIEPNPAYETL
HOT_RAT         -------------------LQNMGAKNVCLMTDKNLSQLPPVQIVMDSL-SKNGISVYDNVRVEPTDGSF
HOT_PONAB       -------------------LQNMGAKNVCLMTDKNLSKLPAMDSLKNGIP----FTVYDNVRVEPTDASF
HOT_BOVIN       -------------------------KNVCLMTDKNLSQLPPVQTVMDSLVKNGNFKVYDHVRVEPTDTSF
HOT_XENLA       -------------------LQNWGTRNVCVMTDRNLSESPVKAVLNSLVKNGINFKLYDSVRVEPTDKSF
TFDF_DELAC      ----------------------------------------------------------------------
TCBF_PSESQ      ----------------------------------------------------------------------
HOT_DROME       -----------------ADLRNLGARKVCLVTDKNVVQLPSVKVALDSLARNGNYEVYDETRVEPTDGSM
MACA1_RHOOP     ------------------------------------------------------------------MHTP
YUGK_BACSU      --TYYNPTKLIFGKGQLEQLKRYGKNVLLVYGGGSIKRNGLYDQVTGILKEEGAVHELSGVEPNPRLATV
HOT_DROPS       -----------------ADLRNLGAKKVCLVTDRNVAKLPSVKVALDSLARHGNYEVYDETRVEPTDASL
CLCE_PSESB      ----------------------------------------------------------------------
CLCE_PSEAE      ----------------------------------------------------------------------
HOT_CAEEL       --------------------------------------------------------VFDDVLIEPTVNSM
HOT_DICDI       -----------------------------------------------------KYTIYSDVSIEPTDTSF
YUGJ_BACSU      --TYWNPTKLIFGRGEVEELKPYGKNVLLVYGGGSIKRSGLYDQVIEQLKAGATVHELAGVEPNPRVSTV
TFDF1_RALEJ     ----------------------------------------------------------------------
HOT_CAEBR       --------------------------------------------------------IFDDVLIEPSEKSM
ADH3_ENTHI      ---------------------------------------------------------FGGIEPNPSHETC
GLDA_ECOLI      ----------------------------------------------------------------------
GLDA_ECOL6      ----------------------------------------------------------------------
GLDA_THEMA      --------RYVQGAGAINILEEELSRRAFVVIDDFVDKNVLGE---NFFSSFTKVRVNKQIFGGECSDEE
YBDH_ECOLI      ----------------------------------------------------------------------
Y1167_SYNY3     ----------------------------------------------------------------------
GLD1_SCHPO      ----------------------------------------------------------------------
G1PDH_IGNH4     ----------------------------------------------------------------------
G1PDH_HALSA     -----------------------------VVRDTHLTGRPLVVTTPKTVAAENVVAQFEAVGDDPTFNSV
G1PDH_HALS3     -----------------------------VVRDTHLTGRPLVVTTPKTVAAENVVAQFEAVGDDPTFNSV
G1PDH_METST     ----------------------------------------------------------------------
G1PDH_NATPD     ----------------------------------------------------------------------
G1PDH_SULIM     ----------------------------FLIVTGTKYTKKIADKVIENLPKDAKYEVI-EIDTA-TLDDX
G1PDH_SULIK     ----------------------------FLIVTGTKYTKKIADKVIENLPKDAKYEVI-EIDTA-TLDDX
G1PDH_SULIA     ----------------------------FLIVTGTKYTKKIADKVIENLPKDAKYEVI-EIDTA-TLDDX
G1PDH_SULIL     ----------------------------------------------------------------------
GLDA_CITFR      ----------------------------------------------------------------------
G1PDH_METS5     -----LPKKVYVGNGILSKLRDYLFQEPVLVVTGPNVRKIVIDEVAKGLNEIGKIE-FIEVLDS-SIDEV
G1PDH_SULIY     ----------------------------------------------------------------------
G1PDH_SULIN     ----------------------------------------------------------------------
G1PDH_HYPBU     ----------------------------------------------------------------------
AROB_ARTAT      ------------------------------------------DTVRDELEAAGFTALTAEIPDAEEKHIQ


                         .         .         *         .         .         .         .:140
query           VQGIAQMQALQPQVVIGFGGGSAMDAAKAIVWFSQQSGINIETCVAIPTTSGTGSEVTSACVISDPDKGI
ADH2_ENTHI      QKGLAVMNTFGPDNIIAIGGGSAMDAAK-IMWLMKQKFIDLRKLICIPTTSGTGSEVTPFAVISDHETGK
ADH1_CLOSA      FKGAELMRQFEPDWIIAMGGGSPIDAAKAMWIFYEHPEKTFDDILAIPSTSGTATEVTAFSVITDYKTEI
EUTG_ECOLI      CAAVAQLRESGCDGVIAFGGGSVLDAAKAVTLLVTNPDSTLETSVAIPTTAGTGSETTNVTVIIDAVSGR
ADH2_ZYMMO      LEGLKILKDNNSDFVISLGGGSPHDCAKAIALVATNGGIDKSKKPALPTTAGTASEMTRFCIITDEVRHV
EUTG_SALTY      CAAVAQLREAACDGVVAFGGGSXXNPDQTLSAMTEHSTLRPRLLIAVPTTAGTGSETTNVTVIIDAVSGR
ADH2_ECOLI      AAGLKLLKENNCDSVISLGGGSPHDCAKGIALVAANGGDIRDPMIAINTTAGTASEMTRFCIITDEARHI
ADH4_SCHPO      NQGLEIVKKENCDSMVSIGGGSAHDCAKGIALLATNGGKIADPLIAINTTAGTASEMTRFAIITEETRHI
DHAT_KLEPN      RDGLAVFRREQCDIIVTVGGGSPHDCGKGIGIAATHEGAGIETLVAVNTTAGTASEVTRHCVLTNTETKV
ADHE_ECOLI      RKGAELANSFKPDVIIALGGGSPMDAAK-IMWVMYEHGVKAKM-IAXXXXXXXXXXXXPFAVVTDDATGQ
ADHE_ECO57      RKGAELANSFKPDVIIALGGGSPMDAAK-IMWVMYEHGVKAKM-IAXXXXXXXXXXXXPFAVVTDDATGQ
FUCO_ECOLI      KEGLGVFQNSGADYLIAIGGGSPQDTCKAIGIISNNEGLSPTNILAIPTTAGTAAEVTINYVITDEEKRR
FUCO_ECO57      KEGLGVFQNSGADYLIAIGGGSPQDTCKAIGIISNNEGLSPTNILAIPTTAGTAAEVTINYVITDEEKRR
DHAT_CITFR      RDGLEVFRKEHCDIIVTVGGGSPHDCGKGIGIAATHEGAGIETLVAVNTTAGTASEVTRHCVLTNTKTKV
ADHE_CLOAB      KKATEEMSSFMPDTIIALGGTPEMSSAKLMWVLYEHPEVKFEDLVAITTSAGSGSEVTPFALVTDNNTGN
MEDH_BACMT      HEGVDVFKQENCDALVSIGGGSSHDTAKAIGLVAANGG-RINDYQGVNSVEXXXXXXXXLAVITDSARKV
ADH4_YEAST      TAGLKVLKEQNSEIVVSIGGGSAHDNAKAIALLATNGGVNQSKKAALPTTAGTASEMTRFTIISNEEKKI
ADH4_YEAS7      TAGLKVLKEQNSEIVVSIGGGSAHDNAKAIALLATNGGVNQSKKAALPTTAGTASEMTRFTIISNEEKKI
GBSB_BACSU      NEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSRIPPLTTIPTTAGTGSEVTQWAVITDEEREF
4HDB_CLOK5      IKDIGDKQYNR---IIAVGGGSVIDIAKILSLKYTDDSLDLKELIIVPTTCGTGSEVTNVSVAELKRRHT
TFDF2_RALEJ     --------------------------------------------VALPTTYA-GSEMTPIWGLTAD--GA
HOT_AEDAE       LHAAEYARQNKFDSFVAIGGGSVIDTCKVANLFSKEVNVKLKPLIAVPTTAGTGSETTGVVIFDYKPLHA
ADHB_CLOAB      EKGVKICRENGVEVVLAIGGGSAIDCAKVIAWDIVLDGSKIKRVLPIATIAATGSEMDTWAVINNMDTNE
ADHA_CLOAB      KKGIEICRENNVDLVLAIGGGSAIDCSKVIAAGVYYDGTKVLPIASILTLSATGSEMDQIAVISNMETNE
HOT_ANOGA       QTAIDFARSHRFDAFVAIGGGSAIDTCKVANLYSKEVTVPLKPLIAVPTTAGTGSETTGVAIFDHKPLHA
MEDH_RHOER      --------------------------------------------IAVSTTAGTGSETSWAYVISDMNNPH
TFTE_BURCE      REARLEASRLGADCAVAIGGGSTTGLGKAI---ALESGLPI---LSIPTTYA-GSEMTPIYGVTD--NGV
HOT_XENTR       MDAIEFAKKGQFDAYVGVGGGSVIDTCKAANLYSSSPGADFLDYVNPPIGKGKAVTVPLKPLIAVPELKA
HOT_HUMAN       MEAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPXXXV
HOT_MOUSE       MDAIEFAKKGAFDAYVAVGGGSTMDTCKAANLYASSPHVPLKPLIAVPXXXXXXXXXXXVAIFDYEHLKV
YQHD_ECOLI      MNAVKLVREQKVTFLLAVGGGSVLDGTKFIAWHILQTG-GKEIKSAIPTLPATGSESNAGAVISRKTTGD
HOT_RAT         MDAIEFAKKGAFDAYVAVGGGSTMDTCKAANLYAKPVTVPLKPLIAVPXXXXXXXXXXXVAIFDYEHLKV
HOT_PONAB       MEAIEFAQKGAFDAYVAVGGGSTMDTCMAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPXXXV
HOT_BOVIN       MEAIEFAKKGAFDAFLAVGGGSTIDTCKAANLYSSSPDSDFLDYVNAPIGKGKPVTVPLKPLIAVPXXXV
HOT_XENLA       MDAIEFAKKGQFDAFVAVGGGSVIDTCKAANLYSSSPDVPLKPLIAVPXXXXXXXXXXXIAIFDYEELKA
TFDF_DELAC      ------------------GGGSTIGLAKMLALHSSLP------IVAIPTTYA-GSEMTSIYGVTENE--L
TCBF_PSESQ      ------------------GGGSTIGLAKMLALHSSLP------IVAIPTTYA-GSEMTSIYGVTENE--L
HOT_DROME       WHAVEFARGKEFDAFLAIGGGSAMDTAKAANLFSSDANAEFLDYVNCPIGRGKEISVKLKPLIAMPXXXX
MACA1_RHOOP     VEALAQLRTSEADCVVAIGGGSTTGLAKAL---AARTGVDQ---VILPTTYA-GSEVTP--VLGETVEGR
YUGK_BACSU      EKGIGLCREHDIDFLLAVGGGSVIDCTKAIAWDIFSKKVTAEDALTVLTLAATGSEMNPDSVITNWETNE
HOT_DROPS       WHAADYARQNEFDAFLAIGGGSVMDTAKAANLFSKEISVKLKPLIAMPXXXXXXXXXXXVAIFDYKRLHA
CLCE_PSESB      --------------VIAIGGGSTIGLAKIVALRTELP------IVAVPTTYA-GSEMTSIFGITEG--GV
CLCE_PSEAE      --------------VIAIGGGSTIGLAKIVALRTELP------IVAVPTTYA-GSEMTSIFGITEG--GV
HOT_CAEEL       QKAIAFAKSKQFDSFIAVGGGSVIDTTKAAALYSMQPKNPMLPLIAVPXXXXXXXXXXXXXIMDLPEHKC
HOT_DICDI       KDAISVMGKGRYDGVVAVGGGSVMDTAKALAYINPPIGKGLRPLIAIPTTCGTASETTGVCILDGDGLSA
YUGJ_BACSU      NKGVAICKEQNIDFLLAVGGGSVIDCTKAIAAGAKYDGDAWDIVTALPTLAATGSEMNSGSVITNWETKE
TFDF1_RALEJ     --------------------------------------------LVIPTTYA-GSEMTTIWGVTEG--GM
HOT_CAEBR       QKAIAFAKSKPFDSFIAVGGGSVIDTTKAAALYASNPGKSLQPLIAVPXXXXXXXXXXXXXIMDLPEHKC
ADH3_ENTHI      XXXXXXXXXXXXXFLVAVGGGSIIDATKYIALGMEHSDDPYDICLVVLTIPATGSETNCWGVISRHADKL
GLDA_ECOLI      LRGIAE--TAQCGAILGIGGGKTLDTAKALAHF-----MGVPVAIA-PTIASTDAPCSALSVITDEGEFD
GLDA_ECOL6      LRGIAE--TAQCGAILGIGGGKTLDTAKALAHF-----MGVPVAIA-PTIASTDAPCSALSVITDEGEFD
GLDA_THEMA      IERLSGLVEEETDVVVGIGGGKTLDTAKAVAYKLK------KPVVIVPTIASTDAPCSALSVIYTPNGEF
YBDH_ECOLI      VQQLAAESGDDRSVVIGVGGGALLDTAKAL---ARRLGLPF---VAVPTIAATCAAWTPLSVYNDAGQAL
Y1167_SYNY3     ----------QPDFILGIGGGKALDTAKLL---AHQTQLAIAT---VPTSAATCAGWTALANVYSETGAF
GLD1_SCHPO      ------------QVIIGVGGGKTMDSAKYIA-----HSMNLPSIIC-PXXXXXXXXXXXXXVIYTPDGQF
G1PDH_IGNH4     ----------EPNVVVGFGGGKAIDVAK---YVAMKLGRDVVSVPTATSHDGIASPFSSL-------KGL
G1PDH_HALSA     ERVLGEAEAVDPGYLVGVGGGKAIDIAKL-----ASDHLNV-GFVSVPTAASHDGIVSGRGSVPEGDTRH
G1PDH_HALS3     ERVLGEAEAVDPGYLVGVGGGKAIDIAKL-----ASDHLNV-GFVSVPTAASHDGIVSGRGSVPEGDTRH
G1PDH_METST     --------------ILGVGGGKVIDVAK------MASTINHIPLISVPTTAAHDGMASPRASIKN-DKG-
G1PDH_NATPD     --------------LVGFGGGKPIDIAK-MAADERNCGF-----ISVPTAASHDGIVSGRGSVPEGD---
G1PDH_SULIM     XXXXXXXXXXNPNILLGIGGGKVIDVTKYAAFRNNLEFVSIPTS---PSHDGITSPFASI-------KGL
G1PDH_SULIK     XXXXXXXXXXNPNILLGIGGGKVIDVTKYAAFRNNLEFVSIPTS---PSHDGITSPFASI-------KGL
G1PDH_SULIA     XXXXXXXXXXNPNILLGIGGGKVIDVTKYAAFRNNLEFVSIPTS---PSHDGITSPFASI-------KGL
G1PDH_SULIL     -----------PNILLGIGGGKVIDVTKYAAFRNNLEFVSIPTS---PSHDGITSPFASI-------KGL
GLDA_CITFR      -----------------------LDTAKAIGYYQKLP------VVVIPTIASTDAPTSALSVITEAGEFE
G1PDH_METS5     NRVEEKAKQLNPKFVLGIGGGKTIDVAKYVAYKLNVNFISIPTA---PSHDGITSPFASI-------KGL
G1PDH_SULIY     -----------PNILLGIGGGKVIDVTKYAAFRNNLEFVSIPTS---PSHDGITSPFASI-------KGL
G1PDH_SULIN     -----------PNILLGIGGGKVIDVTKYAAFRNNLEFVSIPTS---PSHDGITSPFASI-------KGL
G1PDH_HYPBU     ---LEDVKAYSPSLVVGFGGGKSIDLAKYVAY---RLGVRMISVPTSPSHDGIASPFTSLKGLDKP----
AROB_ARTAT      VQVLGQNDFTRSDAIVAVGGGAVTDLAGAATWLRGVKVIHMPTSLGINTAEGVGSFHPPAAVLADLDTLQ


                         +         .         .         .         .         *         .:210
query           KYPLFNNALYPDMAILDPELVVSVPPQITANTGMDVLTHALEAWVSPRASDFTDALAEKAAKLVFQYLPT
ADH2_ENTHI      KYPLADYSLTPSVAIVDPMFTMSLPKRAIADTGLDVLVHATEAYVSVMANEYTDGLAREAVKLVFENLLK
ADH1_CLOSA      KYPLADFNITPDVAVVDSELAETMPPKLTAHTGMDALTHAIEAYVATLHSPFTDPLAMQAIEMINEHLFK
EUTG_ECOLI      KQVLAHASLMPDVAILDAALTEGVPSHVTAMTGIDALTHAIEAYSALNATPFTDSLAIGAIAMIGKSLPK
ADH2_ZYMMO      KMAIVDRHVTPMVSVNDPLLMVGMPKGLTAATGMDALTHAFEAYSSTAATPITDACALKAASMIAKNLKT
EUTG_SALTY      KQVLAHASLMPDVAILDAAVTEGVPPNVTAMTGIDALTHAIEAYSALNATPFTDSLAIGAIAMIGKSLPK
ADH2_ECOLI      KMAIVDKHVTPLLSVNDSSLMIGMPKSLTAATGMDALTHAIEAYVSIAATPITDACALKAVTMIAENLPL
ADH4_SCHPO      KMAIIDKHTMPILSVNDPETMYGLPPSLTAATGMDALTHAVEAYVSTAANPITDACAVKCIELVNKYLKR
DHAT_KLEPN      KFVIVSWRNLPSVSINDPLLMIGKPAALTAATGMDALTHAVEAYISKDANPVTDAAAMQAIRLIARNLRQ
ADHE_ECOLI      KYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHAMEAYVSVLASEFSDGQALQALKLLKEYLPA
ADHE_ECO57      KYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHAMEAYVSVLASEFSDGQALQALKLLKEYLPA
FUCO_ECOLI      KFVCVDPHDIPQVAFIDADMMDGMPPALKAATGVDALTHAIEGYITRGAWALTDALHIKAIEIIAGALRG
FUCO_ECO57      KFVCVDPHDIPQVAFIDADMMDGMPPALKAATGVDALTHAIEGYITRGAWALTDALHIKAIEIIAGALRG
DHAT_CITFR      KFVIVSWRNLPSVSINDPLLMLGKPAPLTAATGMDALTHAVEAYISKDANPVTDXXXXXXXXXXXXXXXQ
ADHE_CLOAB      KYMLADYEMTPNMAIVDAELMMKMPKGLTAYSGIDALVNSIEAYTSVYASEYTNGLALEAIRLIFKYLPE
MEDH_BACMT      KMPVIDEKITPTVAIVDPELMVKKPAGLTIATGMDALSHAIEAYVAKGATPVTDAFAIQAMKLINEYLPK
ADH4_YEAST      KMAIIDNNVTPAVAVNDPSTMFXXXXXXXXXXXXXXXXHCIEAYVSTASNPITDACALKGIDLINESLVA
ADH4_YEAS7      KMAIIDNNVTPAVAVNDPSTMFXXXXXXXXXXXXXXXXHCIEAYVSTASNPITDACALKGIDLINESLVA
GBSB_BACSU      KFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKR
4HDB_CLOK5      KKGIASDELYATYAVLVPEFIKGLPYKFFVTSSVDALIHATEAYVSPNANPYTDMFSVKAMELILNGYMQ
TFDF2_RALEJ     KRTGRDPRVLPSTVLYDPHHLTSLPPEVTGPSGMNAIAHAVESMYAPDRNPITMLLAEESIRAMAQGLPV
HOT_AEDAE       KTGISSKYLRPQLGLIDPLHTLSQPEKVAAYCGFDVFCHALESFTAQGSNPISDVWARFALKIIRENFIS
ADHB_CLOAB      KLIAAHPDMAPKFSILDPTYTYTVPTNQTAAGTADIMSHIFEVYFSTKTAYLQDRMAEALLRTCIKYGGI
ADHA_CLOAB      KLGVGHDDMRPKFSVLDPTYTFTVPKNQTAAGTADIMSHTFESYFSGVEGAYVDGIAEAILRTCIKYGKI
HOT_ANOGA       KTGISSKALRPILGLVDPLHTLSQPEKVAAYCGFDVFCHALESFANPKSNPISDVWARFALQTISRHFRR
MEDH_RHOER      KWVGFDEATIVTLAIDDPLLYYTCPQHFTAYCGFDVLAHGSEPFVS--RLDFAPSLGNASVELVAKNLRE
TFTE_BURCE      KQTGRDARVLPRTVIYDPELTLGLPIRMTVSSGLNAIAHAAESLYAHDGNPVIGLMAEEGIRAIGAALPL
HOT_XENTR       KTGIASRAIKPTLGLIDPVHTLSMPERVVANSGFDVLCHSLESYTAQGSNPISDVWAKHALRIVAKYLKR
HOT_HUMAN       KIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTSPCPSNISDIWAIHALRIVAKYLKR
HOT_MOUSE       KTGIASRAIKPTLGLVDPLHTLHMPCQVVANSGFDVLCHALESYTSPCPSNISDIWAVHALQIVAKYLKR
YQHD_ECOLI      KQAFHSAHVQPVFAVLDPVYTYTLPPRQVANGVVDAFVHTVEQYVTPVDAKIQDRFAEGILLTLIEDGPK
HOT_RAT         KTGIASRAIKPTLGLVDPLHTLHMPCQVVANSGFDVLCHALESYTSPCPSNISDIWAVHALRIVAKYLKR
HOT_PONAB       KIGIASRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTSPCPSNISDIWAIHALRIVAKYLKR
HOT_BOVIN       KTGIASRAIKPTLGLIDPLHTLHMPERVVANSGFDVLCHALESYTSPCPSSISDIWAVHALRIVAKYLKR
HOT_XENLA       KTGIASRAIKPTLGLIDPAHTLSMPERVVANSGFDVLCHSLESYTAQGSNPISDVWAKHALRIVAKFLKR
TFDF_DELAC      KKTGRDRRVLARTVIYDPELTFGLPTGISVTSGLNAIAHAVEGLYAPEVNPILAIMAQQGIAALAKSIPT
TCBF_PSESQ      KKTGRDRRVLARTVIYDPELTFGLPTGISVTSGLNAIAHAVEGLYAPEVNPILAIMAQQGIAALAKSIPT
HOT_DROME       KTGISSKFLKPTLAVIDPLHTLSQPQRVMAFAGFDVFCHALESFTAQGRNPVSDVWARFALETIRKNFVN
MACA1_RHOOP     KTTRSTLAVLPETVIYDVELSKNLPVPIXXXXXXXXXXXXXXXMYSPDANPVVDTWXXXXXXXXXXXXXX
YUGK_BACSU      KFVWGSNVTHPRFSILDPENTFTVPENQTVYGMVDMMSHVFEQYFNVENTPLQDRMCFAVLQTVIETAPK
HOT_DROPS       KTGISSKYLKPTLAIIDPLHTLSQPERVMAFAGFDVFCHALESFTAPAPSDISDVWARFALETIRKNFIN
CLCE_PSESB      KKTGRDARVMPRAVIYEPRLTLELPLSISVTSAINAIAHAVEGLYAPDATPLLTIMAQEGIAATVRAISR
CLCE_PSEAE      KKTGRDARVMPRAVIYEPRLTLELPLSISVTSAINAIAHAVEGLYAPDATPLLTIMAQEGIAATVRAISR
HOT_CAEEL       KTGIRLRCIKPYLAVVDPLNVMSMPRNVAIYSGFDVLCHALESFTSPRSNPISDVWSKEALRIIGKYFRR
HOT_DICDI       KTGIASRHLKPILGLVDPDNLLTLPSNVAISSGFDQLCHALESFTSPRANPVSDVWSLRSLEMLCKNIHR
YUGJ_BACSU      KYGWGSPLVFPKFSILDPVNTFTVPKNHTIYGMVDMMSHVFEQYFHHVSTPYQDRMCESLLRTVIETAPK
TFDF1_RALEJ     KRTGRDPKVLPKTVIYDPLLTVDLPLAISVTSALNAIAHAAEGLYSADLNPVLETMCKQGICALFDAIPR
HOT_CAEBR       KTGIRLRCIKPYLAVVDPLNVMSMPRNVAIYSGFDVLCHALESYTSPRSNPISDVWSREALRIIGQYFRR
ADH3_ENTHI      KLPFNNESVFPTWSIVDPCFTMSLPDNQIRNGLVDSFVHCIEQYINYHLNPVVEAETEGVMRTIIGVSHK
GLDA_ECOLI      RYLLLPN--NPNMVIVDTKIVAGAPARLLAAGIGDALATWFEARACSRSGATTMACTQAALALAELCYNT
GLDA_ECOL6      RYLLLPN--NPNMVIVDTKIVAGAPARLLAAGIGDALATWFEARACSRSGATTMACTQAALALAELCYNT
GLDA_THEMA      KRYLF-LPRNPDVVLVDTEIVAKAPARFLVAGMGDALATWFEA---------------------------
YBDH_ECOLI      HYEIFDDANF--MVLVEPEIILNAPQQYLLAGIGDTLAKWYEAVV-------------------------
Y1167_SYNY3     RYDVALDRC-PDLLIVDYELIQRAEPRLLVAGIGDAIAKWYEASVSSGQSSFTVAAVQQARDILFQKSAE
GLD1_SCHPO      KYSFY--PLNPNLIFIDTDVIVRAPVRFLISGIGDALSTETESVIRSNSTSFAGGVASIAGRYIARACKD
G1PDH_IGNH4     KGPTSVKTKTPIAVVADIEVIARAPERLNRAGIGDVLASAVRDWRLAHVGSYAASLALMSAKHVLKYSPA
G1PDH_HALSA     SV----SAAPPLAVIADTGVIADAPWELTTAGCADIISNAVKDWRLANRSEYAGALSQMTAEMLVDNIKP
G1PDH_HALS3     SV----SAAPPLAVIADTGVIADAPWELTTAGCADIISNAVKDWRLANRSEYAGALSQMTAEMLVDNIKP
G1PDH_METST     TVSLKANA--PFALIADTTIISQAPYRFTAAGFSDIISNAVEDWINEPFSDSAAALSVMTAKLLIDNIHP
G1PDH_NATPD     --TRHSVAAHPPLAVIDTELIANSPWRLTTAGCADIISNAVKDWKNVEYSEYAGALSQMTAEMLVDSIKR
G1PDH_SULIM     QKPVSVKAKEPLAIIADIE-ILSLSPRRLINAGIDTIGKAVRDWRGEYYGDYTASLALMSAKHAFQC--T
G1PDH_SULIK     QKPVSVKAKEPLAIIADIE-ILSLSPRRLINAGIDTIGKAVRDWRGEYYGDYTASLALMSAKHAFQC--T
G1PDH_SULIA     QKPVSVKAKEPLAIIADIE-ILSLSPRRLINAGIDTIGKAVRDWRGEYYGDYTASLALMSAKHAFQC--T
G1PDH_SULIL     QKPVSVKAKEPLAIIVDIE-ILSLSPRRLINAGIDTIGKAVRDWRGEYYGDYTASLALMSAKHAFQC--T
GLDA_CITFR      EYLIYPKN--PDMVVMDTAIIAKAPVRLLVAGMGDALSTWFEARATSMAGGQSTVAALSLARLCYDTLLA
G1PDH_METS5     GKPVSVKAKMPYAIIADINVLSSAPRRL-INSGI------------------------------------
G1PDH_SULIY     QKPVSVKAKEPLAIIADIE-ILSLSPRRLINAGIDTIGKAVRDWRGEYYGDYTASLALMSAKHAFQC--T
G1PDH_SULIN     QKPVSVKAKEPLAIIADIE-ILSLSPRRLINAGIDTIGKAVRDWRGEYYGDYTASLALMSAKHAFQC--T
G1PDH_HYPBU     ----------------------------------------------------------------------
AROB_ARTAT      TLP--KNELISGMAIADPAILDLVEKNTDADPGSDVVRELIERAISVKADVVSQDLKESGLREILNYGHT


                         .         .         .         +         .         .         .:280
query           AVEKGDCVATRGKMHNASTLAGMAFSQAGLGLNHAIAHQLGGQFHLPHGLANALLLTTVIRFNAGVPXXX
ADH2_ENTHI      SY-NGDLEA-REKMHNAATIAGMAFASAFLGMDHSMAHKVGAAFHLPHGRCVAVLLPHVIRYNGQKP---
ADH1_CLOSA      SYE-GDKEA-REQMHYAQCLAGMAFSNALLGICHSMAHKTGAVFHIPHGCANAIYLPYVIKFNSKTSLER
EUTG_ECOLI      AVGYGHDLAARESMLLASCMAGMAFSSAGLGLCHAMAHQPGAALHIPHGLANAMLLPTVMEFNRMV----
ADH2_ZYMMO      ACDNGKDMPAREAMAYAQFLAGMAFNNASLGYVHAMAHQLGGYYNLPHGVCNAVLLPHVLAYNASV--VA
EUTG_SALTY      AVGYGHDLAARENMLLASCMAGMAFSSAGLGLCHAMAHQPGAALHIPHGQANAMLLPTVMGFNRMV----
ADH2_ECOLI      AVEDGSNAKAREAMAYAQFLAGMAFNNASLGYVHAMAHQLGGFYNLPHGVCNAVLLPHVQVFNSKV--XX
ADH4_SCHPO      AVDNGKDEEARDNMAYAEFLGGMAFNNASLGYVHAMAHQLGGFYGIPHGVCNAVLLAHVQKFNSRDPRAN
DHAT_KLEPN      AVALGSNLQARENMAYASLLAGMAFNNANLGYVHAMAHQLGGLYDMPHGVANAVLLPHVARYN--LIANP
ADHE_ECOLI      SYHEGSNPVARERVHSXXXXXXXXXXXXXLGVCHSMAHKLGSQFHIPHGLANALLICNVIRYNANRPQAR
ADHE_ECO57      SYHEGSNPVARERVHSXXXXXXXXXXXXXLGVCHSMAHKLGSQFHIPHGLANALLICNVIRYNANRPQAR
FUCO_ECOLI      SV-AGDKDAGE-EMALGQYVAGMGFSNVGLGLVHGMAHPLGAFYNTPHGVANAILLPHVMRYNAGEKYRD
FUCO_ECO57      SV-AGDKDAGE-EMALGQYVAGMGFSNVGLGLVHGMAHPLGAFYNTPHGVANAILLPHVMRYNAGEKYRD
DHAT_CITFR      AVALGSNLKARENMAYASLLAGMAFNNANLGYVHAMAHQLGGLYDMPHGVANAVLLPHVARYN-----LI
ADHE_CLOAB      AYKNGRTEKAREKMAHASTMAGMASANAFLGLCHSMAIKLSSEHNIPSGIANALLIEEVIKFNA------
MEDH_BACMT      AVANGEDIEAREAMAYAQYMAGVAFNNGGLGLVHSISHQVGGVYKLQHGICNSVNMPHVCAFN-------
ADH4_YEAST      AYKDGKDKKARTDMCYAEYLAGMAFNNASLGYVHALAHQLGGFYHLPHGVCNAVLLPHVQEANMQCP---
ADH4_YEAS7      AYKDGKDKKARTDMCYAEYLAGMAFNNASLGYVHALAHQLGGFYHLPHGVCNAVLLPHVQEANMQCP---
GBSB_BACSU      AFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYN-------
4HDB_CLOK5      MVEKGNRVEIIEDFVIGSNYAGIAFGNAGVGAVHALSYPIGGNYHVPHGEANYLFFTEIFK---------
TFDF2_RALEJ     AVDSPGDLDARTRTLYAAWLAGTVLGMVSMGLHHKLCHVLGGRFNLPHAPMHAVLLPHVAAFN-------
HOT_AEDAE       AVFNQDDLKARSNMHLASTMAGVGFGNAGVHLCHGLSYPISGHVKIPHGLSVVMTAPAVFKFTA------
ADHB_CLOAB      ALEKPDDYEARANLMWASSLAINGLLTYGKDTNHLMEHELSAYYDITHGVGLAIL---------------
ADHA_CLOAB      AMEKTDDYEARANLMWASSLAINGLLSLGKDRKHPMEHELSAYYDITHGVGLAIL---------------
HOT_ANOGA       AVYAPDDLEARSQMHLASTMAGVGFGNAGVHLCHGLSYPIAGQFIIPHGLSVVMTAPSVFRF--------
MEDH_RHOER      AVFEPRNLKAREGMMNAQYIAGQAFNSGGLGIVHSISHAVSAFFDSHHGLNNAIALPRVWEYN-------
TFTE_BURCE      QANPADLVARSDALYGA-WLCGAVLGAVSMGLHHKLCHTLGGAFNLPHAELHTVILPHALAYNSARASQA
HOT_XENTR       AVRNPDDREARFAMHLASSFAGVGFGNAGVHLCHGMSYPIAGHVKVPHGLSVVLTSPAVFSFTA------
HOT_HUMAN       AVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKMPHGLSVVLTSPAVFTFTA------
HOT_MOUSE       AVRNPDDLEARSKMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKVPHGLSVVLTSPAVFTFTA------
YQHD_ECOLI      ALKEPENYDVRANVMWAATQALNGLIGAGVPQDWA-THMLGHELTAMHGLDHAQTLAIVL----------
HOT_RAT         AVRNPDDLEARSSMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKVPHGLSVVLTSPAVFTFTA------
HOT_PONAB       AVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKVPHGLSVVLTSPAVFTFTA------
HOT_BOVIN       AIRNPDDLEARSNMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKVPHGLSVVLTSPAVFTFTS------
HOT_XENLA       AVRNPDDREARFAMHLASSFAGVGFGNAGVHLCHGMSYPIAGHVKVPHGLSVVLTSPAVFSF--------
TFDF_DELAC      IRSAPTDLEARSQAQYGAWLCGSVLGNVSMALHHKLCHTLGGTFNLPHAETHTVVLPHALAYN-------
TCBF_PSESQ      IRSAPTDLEARSQAQYGAWLCGSVLGNVSMALHHKLCHTLGGTFNLPHAETHTVVLPHALAYN-------
HOT_DROME       AIYQPDNLEARSQMHLASTMAGVGFGNAGVHLCHGLSYPISGNVRIPHGLSVVISAPAVFEFTA------
MACA1_RHOOP     XVSDPSCRRIRTDLLRGSWLAGMCLGSVGMAVHHKLCHTLGGAFGLPHAPTHTVVLPYAMSFNA------
YUGK_BACSU      LLEDLENYELRETILYAGTIALNGTLQMGYWASHTMEHAVSAVYDIPHAGGLAILFPNWMRY--------
HOT_DROPS       AIYEPGNLEARSQMHLASTMAGVGFGNAGVHLCHGLSYPISGNVRIPHGLSVVISAPAVFEFTA------
CLCE_PSESB      MYQSPRDLQARGDALYGAWLCASVLGNVSMALHHKLCHTLGGTLDLPHAQTHTVVLPHALAYNA------
CLCE_PSEAE      MYQSPRDLQARGDALYGAWLCASVVGNVSMALHHKLCHTLGGTLDLPHAQTHTVVLPHALAYNA------
HOT_CAEEL       SIFDPTDEEARTEMLKASSFAGIGFGNAGVHLCHGLSYPISSQAKIPHGLS---VMTTAV----------
HOT_DICDI       FVLNPNDDYARSQMMLAASYAGLGFGNSGVHACHGMSYSISSMVKIPHGQSVILSAPAVFKFTA------
YUGJ_BACSU      LINDLENYELRETILYTGTIAGMSMGARGDWATHNIEHAVSAVYDIPHAGGLAILFPNWMR---------
TFDF1_RALEJ     LVAKPTDAEARTDALFGAWMCGTALCHLGMGLHHKLCHTLGGTLNLPHAETHAIV---------------
HOT_CAEBR       SVFDPSDEEARTEMLKASSFAGIGFGNAGVHLCHGLSYPISSQAKIPHGLS---VMTTAV----------
ADH3_ENTHI      TLENHQCYAATVAL-NMSLLCGVAVGVTLCGGAHAVGHELTSYYGLAHGETLAITTPGVMRFN-------
GLDA_ECOLI      LLEEGEKAMLAAEQHEANTLSGVGFESGGLAAAHAVHNGLTAAHHYYHGEKVAFTLTQLVLENAPV----
GLDA_ECOL6      LLEEGEKAMLAAEQHEANTLSGVGFESGGLAAAHAVHNGLTAAHHYYHGEKVAFTLTQLVLENAPV----
GLDA_THEMA      ----------------------------------------------------------------------
YBDH_ECOLI      ----------------------------------------------------------------------
Y1167_SYNY3     ALAQPGSETWREVVDASLLMAGVIGGLGGANCRTVAAHQLPQAHHALHG---------------------
GLD1_SCHPO      TLEKGVCTEAFENVVEANTLSGLGFENGGLAAAHAIHNGMGPVHRLMHG---------------------
G1PDH_IGNH4     LSEDGLRILVEALISSGVAMCIAGSSRPASGSEHLFSHAL------------------------------
G1PDH_HALSA     ELEESAWVVVKALVSSGVAMSIADSSRPASGSEHLFSHQL------------------------------
G1PDH_HALS3     ELEESAWVVVKALVSSGVAMSIADSSRPASGSEHLFSHQL------------------------------
G1PDH_METST     NNENSASVVVKGLISSGMAISIAGNSRPASGSEHKFSHAL------------------------------
G1PDH_NATPD     GLEESAWIVVKALVSSGVAMSIAGSSRPASGAEHLISHQL------------------------------
G1PDH_SULIM     KIINKDIKYGVRMLIEALISSGVAMGMAGSGSEHLFAH--------------------------------
G1PDH_SULIK     KIINKDIKYGVRMLIEALISSGVAMGMAGSGSEHLFAH--------------------------------
G1PDH_SULIA     KIINKDIKYGVRMLIEALISSGVAMGMAGSGSEHLFAH--------------------------------
G1PDH_SULIL     KIINKDIKYGVRMLIEALISSGVAMGMAGSGSEHLFAH--------------------------------
GLDA_CITFR      EGEKARFAAQAGVVTDATYLSGIGFESSGLAGAHAIHNGLEECHHLYHG---------------------
G1PDH_METS5     ----------------------------------------------------------------------
G1PDH_SULIY     KIINKDIKYGVRMLIEALISSGVAMGMAGSGSEHLFAH--------------------------------
G1PDH_SULIN     KIINKDIKYGVRMLIEALISSGVAMGMAGSGSEHLFAH--------------------------------
G1PDH_HYPBU     ----------------------------------------------------------------------
AROB_ARTAT      LGHAIELVERYSWRHGAAVSVGMMFA--------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXXXXXXCGFCPAEANDIAAINALIQQIELLKQRCVLPSLAVALKEGRSDFSARIPAMVQAALADVTL
ADH2_ENTHI      ----------------------------------------------------------------------
ADH1_CLOSA      YAKIAKQISL----AGNTNEELVDSLINLVKELNKKMQIPTTLKEYGIHEQEFKNKVDLISERAIGDACT
EUTG_ECOLI      CRERFSQIGRALRTKKSDDRDAINAVSE---------LIAEVGIGKRLGDGATSAHYGAWAQAALEDICL
ADH2_ZYMMO      GRLKDVGVAMGLDIANLGDKEGAEATIQAVRDLAASIGIPANLTELGAKKED----VPLLADHALKDACA
EUTG_SALTY      CRERFSQIGRALTNKKSDDRDAIAAVCELIAEVGQSKRLAD-AGAKPEHYS-------AWAQAALEDICL
ADH2_ECOLI      XXXXXXXXXMGVNVTGKNDAEGAEACINAIRELAKKVDIPAGLRDLNVKEEDFA----VLATNALKDACG
ADH4_SCHPO      ARLGDIAFHLG-CEEHTAE-AALDRISQLVLEVKIRPHLVDLGVKEKD--------FDVLVDHAMKDACG
DHAT_KLEPN      EKFADIAELMGENITGLSTLDAAEKAIAAITRLSMDIGIPQHLRDLGVKEADF----PYMAEMALKDGNA
ADHE_ECOLI      RRYAEIADHLGLSAPGDRTAAKIEKLLAWLETLKAELGIPKSIREAGVQEADFLANVDKLSEDAFDDQCT
ADHE_ECO57      RRYAEIADHLGLSAPGDRTAAKIEKLLAWLETLKAELGIPKSIREAGVQEADFLANVDKLSEDAFDDQCT
FUCO_ECOLI      IARVMGVKVEGMSLEEAR-----NAAVEAVFALNRDVGIPPHLRDVGVRKED----IPALAQAALDDVCT
FUCO_ECO57      IARVMGVKVEGMSLEEAR-----NAAVEAVFALNRDVGIPPHLRDVGVRKED----IPALAQAALDDVCT
DHAT_CITFR      ANPEKFADIAEFMGENTDGLSTMDAAIHAIARLSADIGIPQHLRDLGVKEADF----PYMAEMALKDGNA
ADHE_CLOAB      ----------------------------------------------------------------------
MEDH_BACMT      ----------------------------------------------------------------------
ADH4_YEAST      ----------------------------------------------------------------------
ADH4_YEAS7      ----------------------------------------------------------------------
GBSB_BACSU      ----------------------------------------------------------------------
4HDB_CLOK5      ----------------------------------------------------------------------
TFDF2_RALEJ     ----------------------------------------------------------------------
HOT_AEDAE       ----------------------------------------------------------------------
ADHB_CLOAB      ----------------------------------------------------------------------
ADHA_CLOAB      ----------------------------------------------------------------------
HOT_ANOGA       ----------------------------------------------------------------------
MEDH_RHOER      ----------------------------------------------------------------------
TFTE_BURCE      MERIARALGVSSAPRGLFDLA-------------ERSGLPVSLAALGMPREGIE------LAADMAVKNP
HOT_XENTR       ----------------------------------------------------------------------
HOT_HUMAN       ----------------------------------------------------------------------
HOT_MOUSE       ----------------------------------------------------------------------
YQHD_ECOLI      ----------------------------------------------------------------------
HOT_RAT         ----------------------------------------------------------------------
HOT_PONAB       ----------------------------------------------------------------------
HOT_BOVIN       ----------------------------------------------------------------------
HOT_XENLA       ----------------------------------------------------------------------
TFDF_DELAC      ----------------------------------------------------------------------
TCBF_PSESQ      ----------------------------------------------------------------------
HOT_DROME       ----------------------------------------------------------------------
MACA1_RHOOP     ----------------------------------------------------------------------
YUGK_BACSU      ----------------------------------------------------------------------
HOT_DROPS       ----------------------------------------------------------------------
CLCE_PSESB      ----------------------------------------------------------------------
CLCE_PSEAE      ----------------------------------------------------------------------
HOT_CAEEL       ----------------------------------------------------------------------
HOT_DICDI       ----------------------------------------------------------------------
YUGJ_BACSU      ----------------------------------------------------------------------
TFDF1_RALEJ     ----------------------------------------------------------------------
HOT_CAEBR       ----------------------------------------------------------------------
ADH3_ENTHI      ----------------------------------------------------------------------
GLDA_ECOLI      ----------------------------------------------------------------------
GLDA_ECOL6      ----------------------------------------------------------------------
GLDA_THEMA      ----------------------------------------------------------------------
YBDH_ECOLI      ----------------------------------------------------------------------
Y1167_SYNY3     ----------------------------------------------------------------------
GLD1_SCHPO      ----------------------------------------------------------------------
G1PDH_IGNH4     ----------------------------------------------------------------------
G1PDH_HALSA     ----------------------------------------------------------------------
G1PDH_HALS3     ----------------------------------------------------------------------
G1PDH_METST     ----------------------------------------------------------------------
G1PDH_NATPD     ----------------------------------------------------------------------
G1PDH_SULIM     ----------------------------------------------------------------------
G1PDH_SULIK     ----------------------------------------------------------------------
G1PDH_SULIA     ----------------------------------------------------------------------
G1PDH_SULIL     ----------------------------------------------------------------------
GLDA_CITFR      ----------------------------------------------------------------------
G1PDH_METS5     ----------------------------------------------------------------------
G1PDH_SULIY     ----------------------------------------------------------------------
G1PDH_SULIN     ----------------------------------------------------------------------
G1PDH_HYPBU     ----------------------------------------------------------------------
AROB_ARTAT      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RTNPRPANAEAIRxxxxxxx
ADH2_ENTHI      --------------------
ADH1_CLOSA      GSNPRQLNKDEMK-------
EUTG_ECOLI      RSNPRTASLEQI--------
ADH2_ZYMMO      LTNPRQGDQKEV--------
EUTG_SALTY      RSNPRTATQAQI--------
ADH2_ECOLI      FTNPIQATHEEI--------
ADH4_SCHPO      ATNP----------------
DHAT_KLEPN      FSNPRKGNEQEI--------
ADHE_ECOLI      GANPR---------------
ADHE_ECO57      GANPR---------------
FUCO_ECOLI      GGNPREATLEDI--------
FUCO_ECO57      GGNPREATLEDI--------
DHAT_CITFR      FSNPRKGNEKEI--------
ADHE_CLOAB      --------------------
MEDH_BACMT      --------------------
ADH4_YEAST      --------------------
ADH4_YEAS7      --------------------
GBSB_BACSU      --------------------
4HDB_CLOK5      --------------------
TFDF2_RALEJ     --------------------
HOT_AEDAE       --------------------
ADHB_CLOAB      --------------------
ADHA_CLOAB      --------------------
HOT_ANOGA       --------------------
MEDH_RHOER      --------------------
TFTE_BURCE      YPNPRPLERDAIR-------
HOT_XENTR       --------------------
HOT_HUMAN       --------------------
HOT_MOUSE       --------------------
YQHD_ECOLI      --------------------
HOT_RAT         --------------------
HOT_PONAB       --------------------
HOT_BOVIN       --------------------
HOT_XENLA       --------------------
TFDF_DELAC      --------------------
TCBF_PSESQ      --------------------
HOT_DROME       --------------------
MACA1_RHOOP     --------------------
YUGK_BACSU      --------------------
HOT_DROPS       --------------------
CLCE_PSESB      --------------------
CLCE_PSEAE      --------------------
HOT_CAEEL       --------------------
HOT_DICDI       --------------------
YUGJ_BACSU      --------------------
TFDF1_RALEJ     --------------------
HOT_CAEBR       --------------------
ADH3_ENTHI      --------------------
GLDA_ECOLI      --------------------
GLDA_ECOL6      --------------------
GLDA_THEMA      --------------------
YBDH_ECOLI      --------------------
Y1167_SYNY3     --------------------
GLD1_SCHPO      --------------------
G1PDH_IGNH4     --------------------
G1PDH_HALSA     --------------------
G1PDH_HALS3     --------------------
G1PDH_METST     --------------------
G1PDH_NATPD     --------------------
G1PDH_SULIM     --------------------
G1PDH_SULIK     --------------------
G1PDH_SULIA     --------------------
G1PDH_SULIL     --------------------
GLDA_CITFR      --------------------
G1PDH_METS5     --------------------
G1PDH_SULIY     --------------------
G1PDH_SULIN     --------------------
G1PDH_HYPBU     --------------------
AROB_ARTAT      --------------------