[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF67119.1

[Show Plain Result]


## Summary of Sequence Search
    1::263
    1::263     e-138 100%  263 aa  PANB_SALTY RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-138 100%  263 aa  PANB_SALPK RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-138 100%  263 aa  PANB_SALPA RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-138 100%  263 aa  PANB_SALNS RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-138 100%  263 aa  PANB_SALHS RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-138 100%  263 aa  PANB_SALG2 RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-138 100%  263 aa  PANB_SALEP RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-138 100%  263 aa  PANB_SALDC RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-137 100%  263 aa  PANB_SALPC RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-137 100%  263 aa  PANB_SALCH RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-137  99%  263 aa  PANB_SALA4 RecName: Full=3-methyl-2-oxobutanoate
    3::264     e-135  98%  264 aa  PANB_SALTI RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-134  97%  263 aa  PANB_CITK8 RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-131  90%  263 aa  PANB_ENT38 RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-128  90%  263 aa  PANB_KLEP3 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-128  92%  264 aa  PANB_ECOSE RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-128  92%  264 aa  PANB_ECOHS RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-128  92%  264 aa  PANB_ECO55 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-128  92%  264 aa  PANB_ECO24 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-128  92%  264 aa  PANB_ECO8A RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-128  91%  263 aa  PANB_SALAR RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-128  92%  264 aa  PANB_ECOL5 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-128  92%  264 aa  PANB_ECO81 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-127  92%  264 aa  PANB_SHIBS RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-127  92%  264 aa  PANB_SHIB3 RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-127  91%  263 aa  PANB_KLEP7 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-127  92%  264 aa  PANB_ECOLI RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-127  92%  264 aa  PANB_ECOLC RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-127  92%  264 aa  PANB_ECODH RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-127  92%  264 aa  PANB_ECOBW RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-127  91%  264 aa  PANB_SHISS RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-127  91%  264 aa  PANB_ESCF3 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-127  91%  264 aa  PANB_ECOUT RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-127  91%  264 aa  PANB_ECOSM RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-127  91%  264 aa  PANB_ECOL6 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-127  91%  264 aa  PANB_ECOK1 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-127  91%  264 aa  PANB_ECO7I RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-127  91%  264 aa  PANB_ECO45 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-126  92%  264 aa  PANB_ECO5E RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-126  92%  264 aa  PANB_ECO57 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-125  92%  264 aa  PANB_ECOLU RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-125  90%  264 aa  PANB_ECO27 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-125  91%  264 aa  PANB_SHIFL RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-125  91%  264 aa  PANB_SHIF8 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-123  91%  264 aa  PANB_SHIDS RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-119  86%  264 aa  PANB_ENTS8 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-105  71%  265 aa  PANB_YERE8 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-105  71%  265 aa  PANB_YERPY RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-105  71%  265 aa  PANB_YERPS RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-105  71%  265 aa  PANB_YERPB RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-105  71%  265 aa  PANB_YERP3 RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-105  78%  264 aa  PANB_ERWCT RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-104  71%  265 aa  PANB_YERPP RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-104  71%  265 aa  PANB_YERPN RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-104  71%  265 aa  PANB_YERPG RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-104  71%  265 aa  PANB_YERPE RecName: Full=3-methyl-2-oxobutanoate
    1::264     e-104  71%  265 aa  PANB_YERPA RecName: Full=3-methyl-2-oxobutanoate
    1::265     e-104  78%  265 aa  PANB_PECCP RecName: Full=3-methyl-2-oxobutanoate
    1::263     e-101  74%  264 aa  PANB_ERWT9 RecName: Full=3-methyl-2-oxobutanoate
    1::262     e-100  68%  264 aa  PANB_VIBHB RecName: Full=3-methyl-2-oxobutanoate
    1::264     1e-99  70%  264 aa  PANB_EDWI9 RecName: Full=3-methyl-2-oxobutanoate
    1::262     4e-99  66%  264 aa  PANB_VIBSL RecName: Full=3-methyl-2-oxobutanoate
    2::261     7e-98  68%  262 aa  PANB_SODGM RecName: Full=3-methyl-2-oxobutanoate
    1::263     7e-98  72%  263 aa  PANB_PROMH RecName: Full=3-methyl-2-oxobutanoate
    1::262     2e-97  66%  264 aa  PANB_VIBVY RecName: Full=3-methyl-2-oxobutanoate
    1::262     2e-97  66%  264 aa  PANB_VIBVU RecName: Full=3-methyl-2-oxobutanoate
    1::262     1e-96  66%  264 aa  PANB_VIBPA RecName: Full=3-methyl-2-oxobutanoate
    1::263     1e-96  64%  263 aa  PANB_PHOLL RecName: Full=3-methyl-2-oxobutanoate
    1::262     2e-95  65%  264 aa  PANB_VIBCM RecName: Full=3-methyl-2-oxobutanoate
    1::262     2e-95  65%  264 aa  PANB_VIBCH RecName: Full=3-methyl-2-oxobutanoate
    1::262     2e-95  65%  264 aa  PANB_VIBC3 RecName: Full=3-methyl-2-oxobutanoate
    1::264     2e-93  62%  264 aa  PANB1_VIBF1 RecName: Full=3-methyl-2-oxobutanoate
    1::263     3e-93  61%  264 aa  PANB_PHOPR RecName: Full=3-methyl-2-oxobutanoate
    3::266     7e-93  64%  267 aa  PANB_SCHPO RecName: Full=Probable 3-methyl-2-oxobutanoate
    1::264     9e-93  61%  264 aa  PANB_ALISL RecName: Full=3-methyl-2-oxobutanoate
    1::264     2e-92  61%  264 aa  PANB_VIBFM RecName: Full=3-methyl-2-oxobutanoate
    1::263     6e-89  59%  264 aa  PANB_SHELP RecName: Full=3-methyl-2-oxobutanoate
    1::263     5e-88  58%  264 aa  PANB_SHEPW RecName: Full=3-methyl-2-oxobutanoate
    1::264     1e-87  62%  264 aa  PANB_SHEFN RecName: Full=3-methyl-2-oxobutanoate
    1::264     1e-87  57%  264 aa  PANB_SHEPA RecName: Full=3-methyl-2-oxobutanoate
    1::264     5e-87  57%  264 aa  PANB_SHEON RecName: Full=3-methyl-2-oxobutanoate
    1::263     2e-86  57%  264 aa  PANB_SHESM RecName: Full=3-methyl-2-oxobutanoate
    1::264     3e-86  59%  264 aa  PANB_PSYIN RecName: Full=3-methyl-2-oxobutanoate
    3::264     3e-86  59%  264 aa  PANB_AERS4 RecName: Full=3-methyl-2-oxobutanoate
    1::263     6e-86  57%  264 aa  PANB_SHESR RecName: Full=3-methyl-2-oxobutanoate
    1::264     1e-85  56%  264 aa  PANB_SHESA RecName: Full=3-methyl-2-oxobutanoate
    1::263     2e-85  56%  264 aa  PANB_SHEWM RecName: Full=3-methyl-2-oxobutanoate
    1::263     4e-85  61%  264 aa  PANB_ALTMD RecName: Full=3-methyl-2-oxobutanoate
    3::264     1e-84  57%  264 aa  PANB_AERHH RecName: Full=3-methyl-2-oxobutanoate
    1::263     2e-84  56%  264 aa  PANB_SHESW RecName: Full=3-methyl-2-oxobutanoate
    1::263     2e-84  56%  264 aa  PANB_SHEPC RecName: Full=3-methyl-2-oxobutanoate
    1::264     3e-84  56%  264 aa  PANB_SHEHH RecName: Full=3-methyl-2-oxobutanoate
    1::264     6e-84  56%  264 aa  PANB_SHESH RecName: Full=3-methyl-2-oxobutanoate
    1::263     6e-84  55%  264 aa  PANB_PSEHT RecName: Full=3-methyl-2-oxobutanoate
    1::263     1e-83  55%  265 aa  PANB_PSEA6 RecName: Full=3-methyl-2-oxobutanoate
    1::263     6e-83  55%  263 aa  PANB2_VIBF1 RecName: Full=3-methyl-2-oxobutanoate
    1::263     2e-82  55%  263 aa  PANB_BUCAT RecName: Full=3-methyl-2-oxobutanoate
    1::263     5e-82  54%  263 aa  PANB_BUCAI RecName: Full=3-methyl-2-oxobutanoate
    1::263     9e-82  54%  263 aa  PANB_BUCA5 RecName: Full=3-methyl-2-oxobutanoate
    1::262     1e-81  61%  264 aa  PANB_SHEDO RecName: Full=3-methyl-2-oxobutanoate
    1::264     2e-81  55%  264 aa  PANB_TOLAT RecName: Full=3-methyl-2-oxobutanoate
    1::264     8e-81  58%  265 aa  PANB_BAUCH RecName: Full=3-methyl-2-oxobutanoate
    1::263     1e-80  55%  263 aa  PANB_BUCAP RecName: Full=3-methyl-2-oxobutanoate
   12::273     3e-79  52%  275 aa  PANB_MARMS RecName: Full=3-methyl-2-oxobutanoate
    6::265     3e-78  59%  266 aa  PANB_IDILO RecName: Full=3-methyl-2-oxobutanoate
    1::264     4e-76  52%  264 aa  PANB_SHEAM RecName: Full=3-methyl-2-oxobutanoate
    1::264     1e-75  54%  266 aa  PANB_PSEU5 RecName: Full=3-methyl-2-oxobutanoate
    3::263     4e-75  53%  264 aa  PANB_COLP3 RecName: Full=3-methyl-2-oxobutanoate
    1::264     5e-75  50%  266 aa  PANB_PSEPW RecName: Full=3-methyl-2-oxobutanoate
    1::264     2e-74  50%  266 aa  PANB2_PSEF5 RecName: Full=3-methyl-2-oxobutanoate
    4::262     1e-73  50%  264 aa  PANB_MARAV RecName: Full=3-methyl-2-oxobutanoate
    1::264     3e-73  49%  266 aa  PANB_PSEPF RecName: Full=3-methyl-2-oxobutanoate
   18::263     8e-73  52%  264 aa  PANB2_HAHCH RecName: Full=3-methyl-2-oxobutanoate
    1::264     3e-72  48%  266 aa  PANB_PSEFS RecName: Full=3-methyl-2-oxobutanoate
    1::264     4e-72  53%  266 aa  PANB_PSEMY RecName: Full=3-methyl-2-oxobutanoate
    1::265     2e-71  49%  265 aa  PANB_WIGBR RecName: Full=3-methyl-2-oxobutanoate
    1::264     2e-70  47%  266 aa  PANB_PSE14 RecName: Full=3-methyl-2-oxobutanoate
    1::264     1e-69  46%  266 aa  PANB_PSEU2 RecName: Full=3-methyl-2-oxobutanoate
    1::264     3e-69  47%  266 aa  PANB_PSESM RecName: Full=3-methyl-2-oxobutanoate
    4::262     4e-69  47%  262 aa  PANB_CHRVO RecName: Full=3-methyl-2-oxobutanoate
    1::263     5e-69  51%  263 aa  PANB_CHRSD RecName: Full=3-methyl-2-oxobutanoate
   10::271     7e-69  54%  272 aa  PANB_RALPJ RecName: Full=3-methyl-2-oxobutanoate
   10::270     1e-68  56%  270 aa  PANB_SACD2 RecName: Full=3-methyl-2-oxobutanoate
    2::265     1e-68  54%  266 aa  PANB_PSYA2 RecName: Full=3-methyl-2-oxobutanoate
    1::264     6e-68  47%  266 aa  PANB2_PSEE4 RecName: Full=3-methyl-2-oxobutanoate
    1::264     1e-67  47%  266 aa  PANB_PSEPK RecName: Full=3-methyl-2-oxobutanoate
    1::264     1e-67  47%  266 aa  PANB_PSEP1 RecName: Full=3-methyl-2-oxobutanoate
    3::270     2e-67  49%  270 aa  PANB_PSYWF RecName: Full=3-methyl-2-oxobutanoate
    2::265     3e-67  55%  266 aa  PANB_PSYCK RecName: Full=3-methyl-2-oxobutanoate
    3::261     2e-66  48%  263 aa  PANB_NEIMF RecName: Full=3-methyl-2-oxobutanoate
    4::262     2e-66  47%  262 aa  PANB_ALCBS RecName: Full=3-methyl-2-oxobutanoate
   13::271     2e-66  47%  271 aa  PANB1_BURCM RecName: Full=3-methyl-2-oxobutanoate
    3::265     4e-66  54%  269 aa  PANB_ACIBS RecName: Full=3-methyl-2-oxobutanoate
   13::271     5e-66  47%  271 aa  PANB_BURVG RecName: Full=3-methyl-2-oxobutanoate
    3::265     5e-66  54%  269 aa  PANB_ACIBY RecName: Full=3-methyl-2-oxobutanoate
    3::265     5e-66  54%  269 aa  PANB_ACIBC RecName: Full=3-methyl-2-oxobutanoate
    3::265     5e-66  54%  269 aa  PANB_ACIB5 RecName: Full=3-methyl-2-oxobutanoate
    3::265     5e-66  54%  269 aa  PANB_ACIB3 RecName: Full=3-methyl-2-oxobutanoate
   13::271     7e-66  47%  271 aa  PANB_BURCA RecName: Full=3-methyl-2-oxobutanoate
   13::271     7e-66  47%  271 aa  PANB1_BURCH RecName: Full=3-methyl-2-oxobutanoate
   13::271     9e-66  45%  271 aa  PANB2_BURS3 RecName: Full=3-methyl-2-oxobutanoate
   13::271     2e-65  47%  271 aa  PANB_BURPP RecName: Full=3-methyl-2-oxobutanoate
   13::271     3e-65  47%  271 aa  PANB_BURTA RecName: Full=3-methyl-2-oxobutanoate
   13::271     4e-65  47%  271 aa  PANB_BURXL RecName: Full=3-methyl-2-oxobutanoate
    3::261     6e-65  47%  263 aa  PANB_NEIMB RecName: Full=3-methyl-2-oxobutanoate
   13::271     6e-65  47%  271 aa  PANB_BURPS RecName: Full=3-methyl-2-oxobutanoate
   13::271     6e-65  47%  271 aa  PANB_BURP6 RecName: Full=3-methyl-2-oxobutanoate
   13::271     6e-65  47%  271 aa  PANB_BURP1 RecName: Full=3-methyl-2-oxobutanoate
   13::271     6e-65  47%  271 aa  PANB_BURP0 RecName: Full=3-methyl-2-oxobutanoate
   13::271     6e-65  47%  271 aa  PANB_BURMS RecName: Full=3-methyl-2-oxobutanoate
   13::271     6e-65  47%  271 aa  PANB_BURMA RecName: Full=3-methyl-2-oxobutanoate
   13::271     6e-65  47%  271 aa  PANB_BURM9 RecName: Full=3-methyl-2-oxobutanoate
   13::271     6e-65  47%  271 aa  PANB_BURM7 RecName: Full=3-methyl-2-oxobutanoate
    8::269     8e-65  46%  271 aa  PANB_XANAC RecName: Full=3-methyl-2-oxobutanoate
    3::265     8e-65  48%  269 aa  PANB_ACIAD RecName: Full=3-methyl-2-oxobutanoate
    8::269     1e-64  46%  271 aa  PANB_XANC5 RecName: Full=3-methyl-2-oxobutanoate
   11::272     2e-64  45%  272 aa  PANB_JANMA RecName: Full=3-methyl-2-oxobutanoate
   11::273     2e-64  53%  277 aa  PANB_ALHEH RecName: Full=3-methyl-2-oxobutanoate
   13::271     2e-64  45%  271 aa  PANB_BURP8 RecName: Full=3-methyl-2-oxobutanoate
    4::264     3e-64  47%  275 aa  PANB_CLOBA RecName: Full=3-methyl-2-oxobutanoate
   10::271     5e-64  52%  273 aa  PANB_RALME RecName: Full=3-methyl-2-oxobutanoate
    4::263     5e-64  47%  263 aa  PANB_NITMU RecName: Full=3-methyl-2-oxobutanoate
    1::265     1e-63  45%  266 aa  PANB2_PSEAB RecName: Full=3-methyl-2-oxobutanoate
    8::269     3e-63  49%  271 aa  PANB_STRMK RecName: Full=3-methyl-2-oxobutanoate
    8::269     3e-63  49%  271 aa  PANB_STRM5 RecName: Full=3-methyl-2-oxobutanoate
    1::265     3e-63  45%  266 aa  PANB2_PSEAE RecName: Full=3-methyl-2-oxobutanoate
    8::270     7e-63  51%  272 aa  PANB_XYLFA RecName: Full=3-methyl-2-oxobutanoate
    9::269     7e-63  45%  271 aa  PANB_XANOM RecName: Full=3-methyl-2-oxobutanoate
   15::270     7e-63  47%  272 aa  PANB_DECAR RecName: Full=3-methyl-2-oxobutanoate
    9::269     9e-63  45%  271 aa  PANB_XANOR RecName: Full=3-methyl-2-oxobutanoate
    9::269     9e-63  45%  271 aa  PANB_XANOP RecName: Full=3-methyl-2-oxobutanoate
   10::271     9e-63  46%  273 aa  PANB_RALEJ RecName: Full=3-methyl-2-oxobutanoate
    4::264     3e-62  44%  275 aa  PANB_CLOB8 RecName: Full=3-methyl-2-oxobutanoate
   13::271     3e-62  46%  271 aa  PANB_BURM1 RecName: Full=3-methyl-2-oxobutanoate
   11::272     8e-62  51%  274 aa  PANB_RALSO RecName: Full=3-methyl-2-oxobutanoate
   10::271     1e-61  50%  273 aa  PANB_RALEH RecName: Full=3-methyl-2-oxobutanoate
    7::269     1e-61  43%  269 aa  PANB_NITEC RecName: Full=3-methyl-2-oxobutanoate
    8::269     5e-61  44%  271 aa  PANB_XANCP RecName: Full=3-methyl-2-oxobutanoate
    8::269     5e-61  44%  271 aa  PANB_XANCB RecName: Full=3-methyl-2-oxobutanoate
    8::269     5e-61  44%  271 aa  PANB_XANC8 RecName: Full=3-methyl-2-oxobutanoate
    2::258     1e-60  45%  261 aa  PANB_THICR RecName: Full=3-methyl-2-oxobutanoate
    6::261     3e-60  53%  262 aa  PANB_METFK RecName: Full=3-methyl-2-oxobutanoate
   10::271     3e-60  51%  273 aa  PANB_CUPTR RecName: Full=3-methyl-2-oxobutanoate
    6::269     3e-60  44%  269 aa  PANB_PELPD RecName: Full=3-methyl-2-oxobutanoate
    1::265     5e-59  42%  276 aa  PANB_SYNWW RecName: Full=3-methyl-2-oxobutanoate
    8::270     6e-59  49%  272 aa  PANB_XYLFT RecName: Full=3-methyl-2-oxobutanoate
    8::270     6e-59  49%  272 aa  PANB_XYLF2 RecName: Full=3-methyl-2-oxobutanoate
   10::266     6e-59  44%  274 aa  PANB_THEPX RecName: Full=3-methyl-2-oxobutanoate
   10::266     6e-59  44%  274 aa  PANB_THEP3 RecName: Full=3-methyl-2-oxobutanoate
    4::264     1e-58  45%  269 aa  PANB_METCA RecName: Full=3-methyl-2-oxobutanoate
    9::263     2e-58  44%  279 aa  PANB_GEOTN RecName: Full=3-methyl-2-oxobutanoate
    8::270     2e-58  49%  272 aa  PANB_XYLFM RecName: Full=3-methyl-2-oxobutanoate
    9::263     3e-58  42%  278 aa  PANB_BACC7 RecName: Full=3-methyl-2-oxobutanoate
    7::269     4e-58  40%  269 aa  PANB_NITEU RecName: Full=3-methyl-2-oxobutanoate
    8::271     5e-58  47%  271 aa  PANB_AZOSE RecName: Full=3-methyl-2-oxobutanoate
    4::264     7e-58  44%  275 aa  PANB_CLONN RecName: Full=3-methyl-2-oxobutanoate
    4::264     9e-58  44%  275 aa  PANB_CLOD6 RecName: Full=3-methyl-2-oxobutanoate
    9::263     1e-57  44%  279 aa  PANB_GEOSW RecName: Full=3-methyl-2-oxobutanoate
    3::265     2e-57  43%  266 aa  PANB_GEOLS RecName: Full=3-methyl-2-oxobutanoate
    1::264     2e-57  49%  275 aa  PANB_ENTFA RecName: Full=3-methyl-2-oxobutanoate
    9::263     2e-57  42%  278 aa  PANB_BACC1 RecName: Full=3-methyl-2-oxobutanoate
    3::261     4e-57  43%  263 aa  PANB_NEIMA RecName: Full=3-methyl-2-oxobutanoate
    9::263     4e-57  41%  278 aa  PANB_BACWK RecName: Full=3-methyl-2-oxobutanoate
   11::263     6e-57  44%  279 aa  PANB_GEOKA RecName: Full=3-methyl-2-oxobutanoate
    6::262     6e-57  43%  263 aa  PANB_DESAA RecName: Full=3-methyl-2-oxobutanoate
    3::263     6e-57  40%  279 aa  PANB_BACHD RecName: Full=3-methyl-2-oxobutanoate
    5::264     8e-57  44%  264 aa  PANB_NITOC RecName: Full=3-methyl-2-oxobutanoate
   12::265     8e-57  43%  265 aa  PANB_LEPBL RecName: Full=3-methyl-2-oxobutanoate
    3::264     8e-57  48%  264 aa  PANB_CALS8 RecName: Full=3-methyl-2-oxobutanoate
    3::264     8e-57  50%  264 aa  PANB_ANATD RecName: Full=3-methyl-2-oxobutanoate
   42::297     1e-56  47%  297 aa  PANB_MYCUA RecName: Full=3-methyl-2-oxobutanoate
   42::297     1e-56  47%  297 aa  PANB_MYCMM RecName: Full=3-methyl-2-oxobutanoate
    9::263     1e-56  42%  279 aa  PANB_BACHK RecName: Full=3-methyl-2-oxobutanoate
    9::263     1e-56  42%  279 aa  PANB_BACCZ RecName: Full=3-methyl-2-oxobutanoate
    9::263     1e-56  41%  278 aa  PANB_BACCR RecName: Full=3-methyl-2-oxobutanoate
    9::263     1e-56  41%  278 aa  PANB_BACC4 RecName: Full=3-methyl-2-oxobutanoate
    9::263     1e-56  42%  279 aa  PANB_BACC3 RecName: Full=3-methyl-2-oxobutanoate
    9::263     1e-56  41%  278 aa  PANB_BACC2 RecName: Full=3-methyl-2-oxobutanoate
    9::263     1e-56  42%  279 aa  PANB_BACC0 RecName: Full=3-methyl-2-oxobutanoate
    9::263     1e-56  42%  279 aa  PANB_BACAN RecName: Full=3-methyl-2-oxobutanoate
    9::263     1e-56  42%  279 aa  PANB_BACAH RecName: Full=3-methyl-2-oxobutanoate
    9::263     1e-56  42%  279 aa  PANB_BACAC RecName: Full=3-methyl-2-oxobutanoate
    9::263     1e-56  42%  279 aa  PANB_BACAA RecName: Full=3-methyl-2-oxobutanoate
    3::261     1e-56  43%  263 aa  PANB_NEIG2 RecName: Full=3-methyl-2-oxobutanoate
    3::261     1e-56  43%  263 aa  PANB_NEIG1 RecName: Full=3-methyl-2-oxobutanoate
    3::266     2e-56  46%  276 aa  PANB_HELMI RecName: Full=3-methyl-2-oxobutanoate
    9::263     2e-56  44%  277 aa  PANB_BACLD RecName: Full=3-methyl-2-oxobutanoate
    6::266     2e-56  44%  267 aa  PANB_GEOSL RecName: Full=3-methyl-2-oxobutanoate
    3::266     3e-56  42%  267 aa  PANB_PELCD RecName: Full=3-methyl-2-oxobutanoate
    6::266     3e-56  44%  305 aa  PANB_MYXXD RecName: Full=3-methyl-2-oxobutanoate
    1::265     3e-56  42%  280 aa  PANB_CLOK5 RecName: Full=3-methyl-2-oxobutanoate
    9::263     4e-56  42%  279 aa  PANB_BACCN RecName: Full=3-methyl-2-oxobutanoate
    3::260     5e-56  42%  260 aa  PANB_VESOH RecName: Full=3-methyl-2-oxobutanoate
    2::262     5e-56  51%  262 aa  PANB_THIDA RecName: Full=3-methyl-2-oxobutanoate
   12::260     5e-56  42%  264 aa  PANB_THEM4 RecName: Full=3-methyl-2-oxobutanoate
    9::263     5e-56  43%  277 aa  PANB_BACA2 RecName: Full=3-methyl-2-oxobutanoate
    8::271     5e-56  50%  271 aa  PANB_AZOSB RecName: Full=3-methyl-2-oxobutanoate
   27::282     6e-56  43%  282 aa  PANB_MYCSS RecName: Full=3-methyl-2-oxobutanoate
   27::282     6e-56  43%  282 aa  PANB_MYCSK RecName: Full=3-methyl-2-oxobutanoate
   27::282     6e-56  43%  282 aa  PANB_MYCSJ RecName: Full=3-methyl-2-oxobutanoate
   34::289     8e-56  43%  289 aa  PANB_RHOSR RecName: Full=3-methyl-2-oxobutanoate
    1::264     8e-56  45%  276 aa  PANB_CLOAB RecName: Full=3-methyl-2-oxobutanoate
   12::265     1e-55  42%  265 aa  PANB_LEPBJ RecName: Full=3-methyl-2-oxobutanoate
    9::263     1e-55  43%  277 aa  PANB_BACSU RecName: Full=3-methyl-2-oxobutanoate
    3::266     3e-55  41%  267 aa  PANB_GEOBB RecName: Full=3-methyl-2-oxobutanoate
   12::260     4e-55  43%  267 aa  PANB_KOSOT RecName: Full=3-methyl-2-oxobutanoate
    6::266     5e-55  41%  267 aa  PANB_GEOMG RecName: Full=3-methyl-2-oxobutanoate
   12::265     7e-55  48%  265 aa  PANB_LEPIN RecName: Full=3-methyl-2-oxobutanoate
   12::265     7e-55  48%  265 aa  PANB_LEPIC RecName: Full=3-methyl-2-oxobutanoate
    3::260     9e-55  42%  260 aa  PANB_RUTMC RecName: Full=3-methyl-2-oxobutanoate
    3::261     9e-55  42%  279 aa  PANB_CHLAD RecName: Full=3-methyl-2-oxobutanoate
   11::262     2e-54  45%  263 aa  PANB_BDEBA RecName: Full=3-methyl-2-oxobutanoate
    3::264     2e-54  43%  279 aa  PANB_DEHSC RecName: Full=3-methyl-2-oxobutanoate
    3::264     4e-54  43%  279 aa  PANB_DEHSB RecName: Full=3-methyl-2-oxobutanoate
   30::285     5e-54  46%  285 aa  PANB_MYCPA RecName: Full=3-methyl-2-oxobutanoate
    3::267     5e-54  48%  267 aa  PANB_GEOUR RecName: Full=3-methyl-2-oxobutanoate
    2::260     6e-54  45%  265 aa  PANB_THEAB RecName: Full=3-methyl-2-oxobutanoate
    8::268     6e-54  49%  269 aa  PANB_MOOTA RecName: Full=3-methyl-2-oxobutanoate
    9::264     6e-54  41%  279 aa  PANB_BACP2 RecName: Full=3-methyl-2-oxobutanoate
    7::261     8e-54  48%  265 aa  PANB_THELT RecName: Full=3-methyl-2-oxobutanoate
   15::274     8e-54  46%  279 aa  PANB2_METPP RecName: Full=3-methyl-2-oxobutanoate
   25::280     1e-53  42%  280 aa  PANB_MYCVP RecName: Full=3-methyl-2-oxobutanoate
    1::264     1e-53  40%  279 aa  PANB_DESPS RecName: Full=3-methyl-2-oxobutanoate
   18::260     2e-53  44%  270 aa  PANB_THESQ RecName: Full=3-methyl-2-oxobutanoate
   18::260     2e-53  44%  270 aa  PANB_THEMA RecName: Full=3-methyl-2-oxobutanoate
   21::283     2e-53  42%  283 aa  PANB_NOCFA RecName: Full=3-methyl-2-oxobutanoate
   26::281     3e-53  47%  281 aa  PANB_MYCTU RecName: Full=3-methyl-2-oxobutanoate
   26::281     3e-53  47%  281 aa  PANB_MYCBP RecName: Full=3-methyl-2-oxobutanoate
   26::281     3e-53  47%  281 aa  PANB_MYCBO RecName: Full=3-methyl-2-oxobutanoate
   30::285     3e-53  45%  285 aa  PANB_MYCA1 RecName: Full=3-methyl-2-oxobutanoate
    4::261     3e-53  41%  281 aa  PANB_CHLSY RecName: Full=3-methyl-2-oxobutanoate
    4::261     3e-53  41%  281 aa  PANB_CHLAA RecName: Full=3-methyl-2-oxobutanoate
    3::267     1e-52  39%  267 aa  PANB_GEOSF RecName: Full=3-methyl-2-oxobutanoate
    3::264     1e-52  47%  282 aa  PANB_DEHE1 RecName: Full=3-methyl-2-oxobutanoate
    3::263     1e-52  44%  279 aa  PANB_BACSK RecName: Full=3-methyl-2-oxobutanoate
   31::286     3e-52  48%  286 aa  PANB_MYCLE RecName: Full=3-methyl-2-oxobutanoate
    7::265     3e-52  49%  268 aa  PANB_LEPBP RecName: Full=3-methyl-2-oxobutanoate
    7::265     3e-52  49%  268 aa  PANB_LEPBA RecName: Full=3-methyl-2-oxobutanoate
    1::262     4e-52  39%  274 aa  PANB_CAMJE RecName: Full=3-methyl-2-oxobutanoate
    1::262     4e-52  39%  274 aa  PANB_CAMJ8 RecName: Full=3-methyl-2-oxobutanoate
    4::266     6e-52  40%  283 aa  PANB_CLOTH RecName: Full=3-methyl-2-oxobutanoate
    1::262     6e-52  40%  274 aa  PANB_CAMJR RecName: Full=3-methyl-2-oxobutanoate
    1::262     6e-52  40%  274 aa  PANB_CAMJJ RecName: Full=3-methyl-2-oxobutanoate
   16::265     1e-51  43%  282 aa  PANB_SYNFM RecName: Full=3-methyl-2-oxobutanoate
   14::261     2e-51  46%  261 aa  PANB_THET2 RecName: Full=3-methyl-2-oxobutanoate
   14::261     3e-51  46%  261 aa  PANB_THET8 RecName: Full=3-methyl-2-oxobutanoate
    3::263     3e-51  40%  277 aa  PANB_EXISA RecName: Full=3-methyl-2-oxobutanoate
    1::262     3e-51  40%  274 aa  PANB_CAMJD RecName: Full=3-methyl-2-oxobutanoate
   11::271     5e-51  40%  272 aa  PANB_SYNAS RecName: Full=3-methyl-2-oxobutanoate
    9::271     8e-51  40%  292 aa  PANB2_BRAJA RecName: Full=3-methyl-2-oxobutanoate
    3::261     1e-50  48%  288 aa  PANB_HERA2 RecName: Full=3-methyl-2-oxobutanoate
   20::279     2e-50  45%  280 aa  PANB_THEFY RecName: Full=3-methyl-2-oxobutanoate
    1::262     2e-50  40%  263 aa  PANB_DESAH RecName: Full=3-methyl-2-oxobutanoate
   17::262     2e-50  43%  265 aa  PANB_CALMQ RecName: Full=3-methyl-2-oxobutanoate
   14::265     3e-50  44%  266 aa  PANB_UNCTG RecName: Full=3-methyl-2-oxobutanoate
   11::263     3e-50  46%  277 aa  PANB_LISW6 RecName: Full=3-methyl-2-oxobutanoate
   16::258     4e-50  44%  261 aa  PANB_PYRIL RecName: Full=3-methyl-2-oxobutanoate
    4::261     5e-50  49%  276 aa  PANB_GLUDA RecName: Full=3-methyl-2-oxobutanoate
   11::263     5e-50  40%  278 aa  PANB_DESHD RecName: Full=3-methyl-2-oxobutanoate
   11::263     2e-49  46%  277 aa  PANB_LISMH RecName: Full=3-methyl-2-oxobutanoate
   18::281     2e-49  43%  307 aa  PANB_DESVV RecName: Full=3-methyl-2-oxobutanoate
   18::281     2e-49  43%  307 aa  PANB_DESVH RecName: Full=3-methyl-2-oxobutanoate
    8::262     3e-49  49%  288 aa  PANB_HYPBU RecName: Full=3-methyl-2-oxobutanoate
   22::270     3e-49  44%  289 aa  PANB_DESDG RecName: Full=3-methyl-2-oxobutanoate
   11::263     4e-49  46%  277 aa  PANB_LISIN RecName: Full=3-methyl-2-oxobutanoate
   11::263     6e-49  39%  278 aa  PANB_DESHY RecName: Full=3-methyl-2-oxobutanoate
   12::263     8e-49  39%  279 aa  PANB_NITMS RecName: Full=3-methyl-2-oxobutanoate
   11::263     8e-49  46%  277 aa  PANB_LISMF RecName: Full=3-methyl-2-oxobutanoate
   11::263     8e-49  46%  277 aa  PANB_LISMC RecName: Full=3-methyl-2-oxobutanoate
   37::292     1e-48  47%  293 aa  PANB_SACEN RecName: Full=3-methyl-2-oxobutanoate
    4::262     1e-48  48%  278 aa  PANB_ROSS1 RecName: Full=3-methyl-2-oxobutanoate
   18::260     1e-48  42%  264 aa  PANB_PYRAR RecName: Full=3-methyl-2-oxobutanoate
    3::260     1e-48  44%  270 aa  PANB_STAS1 RecName: Full=3-methyl-2-oxobutanoate
   11::263     2e-48  46%  277 aa  PANB_LISMO RecName: Full=3-methyl-2-oxobutanoate
    4::264     4e-48  39%  275 aa  PANB_CLOBM RecName: Full=3-methyl-2-oxobutanoate
    1::258     8e-48  50%  263 aa  PANB_TRIEI RecName: Full=3-methyl-2-oxobutanoate
   20::283     8e-48  39%  283 aa  PANB_CORJK RecName: Full=3-methyl-2-oxobutanoate
    4::264     8e-48  39%  275 aa  PANB_CLOBL RecName: Full=3-methyl-2-oxobutanoate
    4::264     8e-48  39%  275 aa  PANB_CLOBK RecName: Full=3-methyl-2-oxobutanoate
    4::264     8e-48  39%  275 aa  PANB_CLOBJ RecName: Full=3-methyl-2-oxobutanoate
    1::263     1e-47  38%  279 aa  PANB_LYSSC RecName: Full=3-methyl-2-oxobutanoate
    4::264     1e-47  39%  275 aa  PANB_CLOB6 RecName: Full=3-methyl-2-oxobutanoate
   31::291     1e-47  40%  291 aa  PANB_STRCO RecName: Full=3-methyl-2-oxobutanoate
    1::259     1e-47  44%  263 aa  PANB_IGNH4 RecName: Full=3-methyl-2-oxobutanoate
   23::277     2e-47  39%  277 aa  PANB_LEIXX RecName: Full=3-methyl-2-oxobutanoate
   46::301     2e-47  39%  301 aa  PANB_ARTAT RecName: Full=3-methyl-2-oxobutanoate
    1::265     2e-47  42%  265 aa  PANB_SALRD RecName: Full=3-methyl-2-oxobutanoate
    9::272     2e-47  36%  272 aa  PANB_GRAFK RecName: Full=3-methyl-2-oxobutanoate
    1::265     3e-47  46%  276 aa  PANB_CARHZ RecName: Full=3-methyl-2-oxobutanoate
   35::287     7e-47  41%  287 aa  PANB_STRAW RecName: Full=3-methyl-2-oxobutanoate
   26::268     7e-47  48%  280 aa  PANB_SILST RecName: Full=3-methyl-2-oxobutanoate
   13::277     7e-47  38%  277 aa  PANB_CHLPB RecName: Full=3-methyl-2-oxobutanoate
   13::277     9e-47  40%  277 aa  PANB_PROA2 RecName: Full=3-methyl-2-oxobutanoate
   21::277     2e-46  37%  277 aa  PANB_CHLP8 RecName: Full=3-methyl-2-oxobutanoate
   23::269     2e-46  42%  275 aa  PANB_BORPD RecName: Full=3-methyl-2-oxobutanoate
   28::291     2e-46  39%  296 aa  PANB_ACIAC RecName: Full=3-methyl-2-oxobutanoate
    1::261     2e-46  37%  267 aa  PANB_SULIN RecName: Full=3-methyl-2-oxobutanoate
    5::264     2e-46  39%  265 aa  PANB_AQUAE RecName: Full=3-methyl-2-oxobutanoate
    1::261     3e-46  37%  267 aa  PANB_SULIY RecName: Full=3-methyl-2-oxobutanoate
    1::261     3e-46  37%  267 aa  PANB_SULIL RecName: Full=3-methyl-2-oxobutanoate
    8::262     3e-46  40%  265 aa  PANB_FRATW RecName: Full=3-methyl-2-oxobutanoate
    8::262     3e-46  40%  265 aa  PANB_FRATN RecName: Full=3-methyl-2-oxobutanoate
    8::262     3e-46  40%  265 aa  PANB_FRATM RecName: Full=3-methyl-2-oxobutanoate
   44::303     3e-46  46%  303 aa  PANB_FRAAA RecName: Full=3-methyl-2-oxobutanoate
    8::262     4e-46  40%  265 aa  PANB_FRATO RecName: Full=3-methyl-2-oxobutanoate
    8::262     4e-46  40%  265 aa  PANB_FRATH RecName: Full=3-methyl-2-oxobutanoate
    8::262     4e-46  40%  265 aa  PANB_FRATF RecName: Full=3-methyl-2-oxobutanoate
   10::259     6e-46  43%  266 aa  PANB_COXBU RecName: Full=3-methyl-2-oxobutanoate
   10::259     6e-46  43%  266 aa  PANB_COXBN RecName: Full=3-methyl-2-oxobutanoate
   10::259     6e-46  43%  266 aa  PANB_COXB2 RecName: Full=3-methyl-2-oxobutanoate
   10::259     6e-46  43%  266 aa  PANB_COXB1 RecName: Full=3-methyl-2-oxobutanoate
    3::263     6e-46  46%  263 aa  PANB_CORDI RecName: Full=3-methyl-2-oxobutanoate
    1::259     8e-46  40%  261 aa  PANB_SYNJA RecName: Full=3-methyl-2-oxobutanoate
   22::261     8e-46  40%  267 aa  PANB_SULTO RecName: Full=3-methyl-2-oxobutanoate
   18::260     1e-45  38%  270 aa  PANB_THENN RecName: Full=3-methyl-2-oxobutanoate
   14::259     1e-45  41%  262 aa  PANB_PYRAE RecName: Full=3-methyl-2-oxobutanoate
   10::278     1e-45  38%  306 aa  PANB_ANAD2 RecName: Full=3-methyl-2-oxobutanoate
    3::266     1e-45  38%  282 aa  PANB_ALKMQ RecName: Full=3-methyl-2-oxobutanoate
    3::260     1e-45  41%  272 aa  PANB_STAAM RecName: Full=3-methyl-2-oxobutanoate
    3::260     1e-45  41%  272 aa  PANB_STAA1 RecName: Full=3-methyl-2-oxobutanoate
   10::278     1e-45  37%  306 aa  PANB_ANASK RecName: Full=3-methyl-2-oxobutanoate
    1::261     2e-45  37%  267 aa  PANB_SULSO RecName: Full=3-methyl-2-oxobutanoate
   18::262     2e-45  42%  265 aa  PANB_PYRCJ RecName: Full=3-methyl-2-oxobutanoate
   12::256     2e-45  40%  262 aa  PANB_METS5 RecName: Full=3-methyl-2-oxobutanoate
    4::259     2e-45  40%  261 aa  PANB_CYAP4 RecName: Full=3-methyl-2-oxobutanoate
   14::261     3e-45  41%  264 aa  PANB_FRATT RecName: Full=3-methyl-2-oxobutanoate
   14::261     3e-45  41%  264 aa  PANB_FRAT1 RecName: Full=3-methyl-2-oxobutanoate
   10::266     4e-45  47%  268 aa  PANB_MAGSM RecName: Full=3-methyl-2-oxobutanoate
   13::277     4e-45  43%  277 aa  PANB_CHLPD RecName: Full=3-methyl-2-oxobutanoate
    3::260     7e-45  40%  272 aa  PANB_STAAW RecName: Full=3-methyl-2-oxobutanoate
    3::260     7e-45  40%  272 aa  PANB_STAAT RecName: Full=3-methyl-2-oxobutanoate
    3::260     7e-45  40%  272 aa  PANB_STAAS RecName: Full=3-methyl-2-oxobutanoate
    3::260     7e-45  40%  272 aa  PANB_STAAN RecName: Full=3-methyl-2-oxobutanoate
    3::260     7e-45  40%  272 aa  PANB_STAAC RecName: Full=3-methyl-2-oxobutanoate
    3::260     7e-45  40%  272 aa  PANB_STAAB RecName: Full=3-methyl-2-oxobutanoate
    3::260     7e-45  40%  272 aa  PANB_STAA9 RecName: Full=3-methyl-2-oxobutanoate
    3::260     7e-45  40%  272 aa  PANB_STAA8 RecName: Full=3-methyl-2-oxobutanoate
    3::260     7e-45  40%  272 aa  PANB_STAA3 RecName: Full=3-methyl-2-oxobutanoate
    3::260     7e-45  40%  272 aa  PANB_STAA2 RecName: Full=3-methyl-2-oxobutanoate
   13::277     7e-45  36%  277 aa  PANB_CHLL2 RecName: Full=3-methyl-2-oxobutanoate
   10::269     7e-45  40%  274 aa  PANB_AGRVS RecName: Full=3-methyl-2-oxobutanoate
   16::258     9e-45  41%  261 aa  PANB_THENV RecName: Full=3-methyl-2-oxobutanoate
    3::260     9e-45  40%  272 aa  PANB_STAAR RecName: Full=3-methyl-2-oxobutanoate
   15::278     9e-45  38%  289 aa  PANB_LEPCP RecName: Full=3-methyl-2-oxobutanoate
    4::254     9e-45  48%  260 aa  PANB_GLOVI RecName: Full=3-methyl-2-oxobutanoate
    8::272     9e-45  34%  272 aa  PANB_AZOPC RecName: Full=3-methyl-2-oxobutanoate
   13::277     1e-44  39%  277 aa  PANB_PELLD RecName: Full=3-methyl-2-oxobutanoate
   29::273     1e-44  40%  284 aa  PANB_DEIRA RecName: Full=3-methyl-2-oxobutanoate
    1::262     1e-44  37%  271 aa  PANB_STAMF RecName: Full=3-methyl-2-oxobutanoate
   21::268     1e-44  40%  281 aa  PANB_MESSB RecName: Full=3-methyl-2-oxobutanoate
   26::268     2e-44  40%  280 aa  PANB_XANP2 RecName: Full=3-methyl-2-oxobutanoate
   61::287     3e-44  42%  294 aa  PANB_RHOFD RecName: Full=3-methyl-2-oxobutanoate
   15::273     3e-44  45%  275 aa  PANB_HALHL RecName: Full=3-methyl-2-oxobutanoate
    3::260     3e-44  40%  272 aa  PANB_STAAE RecName: Full=3-methyl-2-oxobutanoate
   16::264     3e-44  46%  275 aa  PANB_BARQU RecName: Full=3-methyl-2-oxobutanoate
   10::256     3e-44  45%  261 aa  PANB_ACIF5 RecName: Full=3-methyl-2-oxobutanoate
   10::256     3e-44  45%  261 aa  PANB_ACIF2 RecName: Full=3-methyl-2-oxobutanoate
    3::260     4e-44  39%  272 aa  PANB_STAES RecName: Full=3-methyl-2-oxobutanoate
    3::260     4e-44  39%  272 aa  PANB_STAEQ RecName: Full=3-methyl-2-oxobutanoate
    1::262     6e-44  37%  262 aa  PANB_WOLSU RecName: Full=3-methyl-2-oxobutanoate
    4::264     6e-44  37%  275 aa  PANB_CLOB1 RecName: Full=3-methyl-2-oxobutanoate
   16::268     6e-44  38%  271 aa  PANB_BART1 RecName: Full=3-methyl-2-oxobutanoate
   28::269     6e-44  41%  269 aa  PANB_ARCB4 RecName: Full=3-methyl-2-oxobutanoate
   13::277     7e-44  36%  277 aa  PANB_PROVI RecName: Full=3-methyl-2-oxobutanoate
   19::259     7e-44  41%  269 aa  PANB_HALMA RecName: Full=3-methyl-2-oxobutanoate
    1::259     1e-43  39%  261 aa  PANB_SYNJB RecName: Full=3-methyl-2-oxobutanoate
    4::260     1e-43  41%  272 aa  PANB_STAHJ RecName: Full=3-methyl-2-oxobutanoate
   13::277     1e-43  35%  277 aa  PANB_PELPB RecName: Full=3-methyl-2-oxobutanoate
   21::277     1e-43  36%  277 aa  PANB_CHLTE RecName: Full=3-methyl-2-oxobutanoate
   24::287     1e-43  43%  293 aa  PANB_ACISJ RecName: Full=3-methyl-2-oxobutanoate
    4::257     2e-43  40%  257 aa  PANB_CYAP8 RecName: Full=3-methyl-2-oxobutanoate
   37::296     2e-43  44%  296 aa  PANB_FRASC RecName: Full=3-methyl-2-oxobutanoate
    8::272     2e-43  35%  272 aa  PANB_CYTH3 RecName: Full=3-methyl-2-oxobutanoate
   46::301     2e-43  37%  301 aa  PANB_ARTS2 RecName: Full=3-methyl-2-oxobutanoate
    9::260     2e-43  37%  277 aa  PANB_ANAMM RecName: Full=3-methyl-2-oxobutanoate
    9::260     2e-43  37%  277 aa  PANB_ANAMF RecName: Full=3-methyl-2-oxobutanoate
    4::260     4e-43  41%  270 aa  PANB_STACT RecName: Full=3-methyl-2-oxobutanoate
    1::262     4e-43  36%  264 aa  PANB_CAMFF RecName: Full=3-methyl-2-oxobutanoate
   27::268     5e-43  40%  277 aa  PANB_RHOS4 RecName: Full=3-methyl-2-oxobutanoate
   27::268     5e-43  40%  277 aa  PANB_RHOS1 RecName: Full=3-methyl-2-oxobutanoate
    3::259     5e-43  38%  259 aa  PANB_NITSB RecName: Full=3-methyl-2-oxobutanoate
    5::251     5e-43  38%  262 aa  PANB_CENSY RecName: Full=3-methyl-2-oxobutanoate
   40::295     6e-43  44%  295 aa  PANB_NOCSJ RecName: Full=3-methyl-2-oxobutanoate
   67::295     8e-43  41%  300 aa  PANB_VEREI RecName: Full=3-methyl-2-oxobutanoate
   24::261     8e-43  38%  267 aa  PANB_SULIM RecName: Full=3-methyl-2-oxobutanoate
   24::261     8e-43  38%  267 aa  PANB_SULIK RecName: Full=3-methyl-2-oxobutanoate
   24::261     8e-43  38%  267 aa  PANB_SULIA RecName: Full=3-methyl-2-oxobutanoate
   10::262     1e-42  44%  273 aa  PANB_DEIDV RecName: Full=3-methyl-2-oxobutanoate
   16::268     1e-42  43%  275 aa  PANB_BARHE RecName: Full=3-methyl-2-oxobutanoate
    8::257     2e-42  41%  262 aa  PANB_SYNP2 RecName: Full=3-methyl-2-oxobutanoate
   63::328     2e-42  39%  349 aa  PANB_EMENI RecName: Full=3-methyl-2-oxobutanoate
   12::274     3e-42  34%  294 aa  PANB1_METPP RecName: Full=3-methyl-2-oxobutanoate
   60::288     5e-42  40%  293 aa  PANB_DELAS RecName: Full=3-methyl-2-oxobutanoate
    2::251     7e-42  50%  268 aa  PANB_SYNP6 RecName: Full=3-methyl-2-oxobutanoate
    2::251     7e-42  50%  268 aa  PANB_SYNE7 RecName: Full=3-methyl-2-oxobutanoate
   26::269     7e-42  40%  273 aa  PANB_SINMW RecName: Full=3-methyl-2-oxobutanoate
   16::244     7e-42  45%  279 aa  PANB_ROSDO RecName: Full=3-methyl-2-oxobutanoate
    7::268     7e-42  46%  271 aa  PANB_BARBK RecName: Full=3-methyl-2-oxobutanoate
    3::263     9e-42  37%  279 aa  PANB_EXIS2 RecName: Full=3-methyl-2-oxobutanoate
   67::301     9e-42  41%  302 aa  PANB1_ZYMMO RecName: Full=3-methyl-2-oxobutanoate
   18::236     1e-41  49%  273 aa  PANB_DEIGD RecName: Full=3-methyl-2-oxobutanoate
   15::269     2e-41  34%  269 aa  PANB_CORGL RecName: Full=3-methyl-2-oxobutanoate
    4::262     2e-41  40%  278 aa  PANB_ROSCS RecName: Full=3-methyl-2-oxobutanoate
   27::268     2e-41  44%  273 aa  PANB_RHOP5 RecName: Full=3-methyl-2-oxobutanoate
   10::269     2e-41  38%  273 aa  PANB_RHIME RecName: Full=3-methyl-2-oxobutanoate
   10::262     2e-41  35%  262 aa  PANB_LEGPH RecName: Full=3-methyl-2-oxobutanoate
   17::271     2e-41  34%  271 aa  PANB_CORGB RecName: Full=3-methyl-2-oxobutanoate
   28::270     3e-41  46%  276 aa  PANB_PARDP RecName: Full=3-methyl-2-oxobutanoate
   27::268     4e-41  43%  274 aa  PANB_RHOP2 RecName: Full=3-methyl-2-oxobutanoate
   17::271     4e-41  39%  272 aa  PANB_METRJ RecName: Full=3-methyl-2-oxobutanoate
   10::262     4e-41  35%  262 aa  PANB_LEGPA RecName: Full=3-methyl-2-oxobutanoate
   13::277     4e-41  39%  277 aa  PANB_CHLCH RecName: Full=3-methyl-2-oxobutanoate
   26::269     4e-41  39%  285 aa  PANB1_BURS3 RecName: Full=3-methyl-2-oxobutanoate
   27::268     1e-40  45%  274 aa  PANB_RHOPB RecName: Full=3-methyl-2-oxobutanoate
   10::269     1e-40  38%  273 aa  PANB_RHISN RecName: Full=3-methyl-2-oxobutanoate
    9::270     1e-40  42%  270 aa  PANB_HELAH RecName: Full=3-methyl-2-oxobutanoate
   18::269     1e-40  39%  275 aa  PANB_RHOCS RecName: Full=3-methyl-2-oxobutanoate
   10::262     1e-40  35%  262 aa  PANB_LEGPC RecName: Full=3-methyl-2-oxobutanoate
   59::277     1e-40  41%  305 aa  PANB_ANADF RecName: Full=3-methyl-2-oxobutanoate
    8::269     1e-40  37%  278 aa  PANB1_HAHCH RecName: Full=3-methyl-2-oxobutanoate
   27::268     2e-40  38%  274 aa  PANB_RHOPS RecName: Full=3-methyl-2-oxobutanoate
   10::262     2e-40  35%  262 aa  PANB_LEGPL RecName: Full=3-methyl-2-oxobutanoate
    6::267     2e-40  37%  269 aa  PANB_CAMC5 RecName: Full=3-methyl-2-oxobutanoate
   27::268     2e-40  42%  274 aa  PANB_RHOPT RecName: Full=3-methyl-2-oxobutanoate
   15::260     2e-40  39%  284 aa  PANB_PYRKO RecName: Full=3-methyl-2-oxobutanoate
   10::273     2e-40  32%  273 aa  PANB_BACTN RecName: Full=3-methyl-2-oxobutanoate
   14::262     3e-40  34%  268 aa  PANB_SULAC RecName: Full=3-methyl-2-oxobutanoate
   27::268     3e-40  43%  274 aa  PANB_RHOPA RecName: Full=3-methyl-2-oxobutanoate
   12::264     3e-40  36%  264 aa  PANB_HELHP RecName: Full=3-methyl-2-oxobutanoate
   11::274     3e-40  36%  295 aa  PANB_ACIBL RecName: Full=3-methyl-2-oxobutanoate
   27::269     3e-40  38%  273 aa  PANB1_PSEAE RecName: Full=3-methyl-2-oxobutanoate
   27::269     3e-40  38%  273 aa  PANB1_PSEAB RecName: Full=3-methyl-2-oxobutanoate
   12::257     4e-40  39%  260 aa  PANB_SYNY3 RecName: Full=3-methyl-2-oxobutanoate
   22::263     4e-40  36%  263 aa  PANB_SULDN RecName: Full=3-methyl-2-oxobutanoate
    2::256     4e-40  36%  257 aa  PANB_ANAVT RecName: Full=3-methyl-2-oxobutanoate
   32::293     5e-40  36%  300 aa  PANB_POLSJ RecName: Full=3-methyl-2-oxobutanoate
   27::269     5e-40  38%  276 aa  PANB_OLICO RecName: Full=3-methyl-2-oxobutanoate
   15::271     5e-40  40%  274 aa  PANB_METPB RecName: Full=3-methyl-2-oxobutanoate
   27::268     6e-40  39%  275 aa  PANB_NITHX RecName: Full=3-methyl-2-oxobutanoate
    2::256     6e-40  35%  257 aa  PANB_ANASP RecName: Full=3-methyl-2-oxobutanoate
   26::269     6e-40  38%  284 aa  PANB2_BURCH RecName: Full=3-methyl-2-oxobutanoate
   27::293     8e-40  39%  295 aa  PANB_POLNA RecName: Full=3-methyl-2-oxobutanoate
   21::286     8e-40  38%  289 aa  PANB_NOVAD RecName: Full=3-methyl-2-oxobutanoate
    4::261     1e-39  42%  261 aa  PANB_THEEB RecName: Full=3-methyl-2-oxobutanoate
   14::269     1e-39  41%  269 aa  PANB_COREF RecName: Full=3-methyl-2-oxobutanoate
   23::265     1e-39  42%  274 aa  PANB_AERPE RecName: Full=3-methyl-2-oxobutanoate
    9::277     2e-39  35%  305 aa  PANB_ANADE RecName: Full=3-methyl-2-oxobutanoate
   26::238     2e-39  49%  279 aa  PANB_SILPO RecName: Full=3-methyl-2-oxobutanoate
   27::238     2e-39  41%  277 aa  PANB_RHOS5 RecName: Full=3-methyl-2-oxobutanoate
   17::269     2e-39  37%  271 aa  PANB_CAMC1 RecName: Full=3-methyl-2-oxobutanoate
   23::266     3e-39  35%  269 aa  PANB_TROW8 RecName: Full=3-methyl-2-oxobutanoate
   15::260     3e-39  38%  283 aa  PANB_PYRFU RecName: Full=3-methyl-2-oxobutanoate
   27::268     3e-39  39%  274 aa  PANB_NITWN RecName: Full=3-methyl-2-oxobutanoate
    4::258     3e-39  43%  259 aa  PANB_ACAM1 RecName: Full=3-methyl-2-oxobutanoate
   15::271     4e-39  39%  274 aa  PANB_METEP RecName: Full=3-methyl-2-oxobutanoate
   15::271     4e-39  39%  274 aa  PANB_METC4 RecName: Full=3-methyl-2-oxobutanoate
   27::266     4e-39  45%  278 aa  PANB_BORPE RecName: Full=3-methyl-2-oxobutanoate
   27::266     4e-39  45%  278 aa  PANB_BORPA RecName: Full=3-methyl-2-oxobutanoate
   27::266     4e-39  45%  278 aa  PANB_BORBR RecName: Full=3-methyl-2-oxobutanoate
   24::285     5e-39  37%  287 aa  PANB_SPHAL RecName: Full=3-methyl-2-oxobutanoate
   15::260     5e-39  38%  283 aa  PANB_PYRHO RecName: Full=3-methyl-2-oxobutanoate
   15::260     5e-39  37%  282 aa  PANB_PYRAB RecName: Full=3-methyl-2-oxobutanoate
    9::260     9e-39  39%  270 aa  PANB_OCEIH RecName: Full=3-methyl-2-oxobutanoate
   10::273     1e-38  32%  273 aa  PANB_BACV8 RecName: Full=3-methyl-2-oxobutanoate
   27::268     1e-38  37%  273 aa  PANB3_BRAJA RecName: Full=3-methyl-2-oxobutanoate
   31::272     4e-38  42%  279 aa  PANB_MARMM RecName: Full=3-methyl-2-oxobutanoate
    8::269     4e-38  43%  275 aa  PANB_BRUSU RecName: Full=3-methyl-2-oxobutanoate
    8::269     4e-38  43%  275 aa  PANB_BRUME RecName: Full=3-methyl-2-oxobutanoate
    8::269     4e-38  43%  275 aa  PANB_BRUMB RecName: Full=3-methyl-2-oxobutanoate
    8::269     4e-38  43%  275 aa  PANB_BRUC2 RecName: Full=3-methyl-2-oxobutanoate
    8::269     4e-38  43%  275 aa  PANB_BRUAB RecName: Full=3-methyl-2-oxobutanoate
    8::269     4e-38  43%  275 aa  PANB_BRUA2 RecName: Full=3-methyl-2-oxobutanoate
    8::269     4e-38  43%  275 aa  PANB_BRUA1 RecName: Full=3-methyl-2-oxobutanoate
   22::269     5e-38  37%  273 aa  PANB_RHIL3 RecName: Full=3-methyl-2-oxobutanoate
    8::269     5e-38  42%  275 aa  PANB_BRUSI RecName: Full=3-methyl-2-oxobutanoate
   11::269     6e-38  37%  279 aa  PANB_AGRT5 RecName: Full=3-methyl-2-oxobutanoate
   12::268     2e-37  37%  269 aa  PANB_RHOBA RecName: Full=3-methyl-2-oxobutanoate
   21::269     2e-37  35%  275 aa  PANB1_PSEF5 RecName: Full=3-methyl-2-oxobutanoate
    7::260     2e-37  36%  268 aa  PANB_NATPD RecName: Full=3-methyl-2-oxobutanoate
   17::269     5e-37  34%  273 aa  PANB2_ZYMMO RecName: Full=3-methyl-2-oxobutanoate
   21::286     7e-37  37%  289 aa  PANB_ERYLH RecName: Full=3-methyl-2-oxobutanoate
   11::273     2e-36  33%  273 aa  PANB_PARD8 RecName: Full=3-methyl-2-oxobutanoate
   12::271     2e-36  39%  271 aa  PANB_ACIC1 RecName: Full=3-methyl-2-oxobutanoate
   27::269     3e-36  43%  273 aa  PANB_GRABC RecName: Full=3-methyl-2-oxobutanoate
   26::269     3e-36  37%  273 aa  PANB_AGRRK RecName: Full=3-methyl-2-oxobutanoate
   21::276     4e-36  35%  287 aa  PANB_METS4 RecName: Full=3-methyl-2-oxobutanoate
   19::267     1e-35  36%  269 aa  PANB1_PSEE4 RecName: Full=3-methyl-2-oxobutanoate
   26::269     2e-35  33%  272 aa  PANB_TROWT RecName: Full=3-methyl-2-oxobutanoate
   45::288     2e-35  35%  312 aa  PANB_YEAST RecName: Full=3-methyl-2-oxobutanoate
   12::266     4e-35  37%  270 aa  PANB_SYNR3 RecName: Full=3-methyl-2-oxobutanoate
   30::272     4e-35  44%  278 aa  PANB_RHORT RecName: Full=3-methyl-2-oxobutanoate
   16::269     6e-35  40%  274 aa  PANB_MAGSA RecName: Full=3-methyl-2-oxobutanoate
   16::268     1e-34  42%  274 aa  PANB_PARL1 RecName: Full=3-methyl-2-oxobutanoate
    8::270     5e-34  40%  270 aa  PANB_HELP2 RecName: Full=3-methyl-2-oxobutanoate
   11::273     5e-34  30%  273 aa  PANB_BACFR RecName: Full=3-methyl-2-oxobutanoate
   11::273     5e-34  30%  273 aa  PANB_BACFN RecName: Full=3-methyl-2-oxobutanoate
   29::271     7e-34  36%  286 aa  PANB_RHILO RecName: Full=3-methyl-2-oxobutanoate
    6::238     9e-34  40%  272 aa  PANB_PROMT RecName: Full=3-methyl-2-oxobutanoate
    8::270     9e-34  40%  270 aa  PANB_HELPG RecName: Full=3-methyl-2-oxobutanoate
   22::269     1e-33  34%  273 aa  PANB_RHIEC RecName: Full=3-methyl-2-oxobutanoate
    8::270     1e-33  40%  270 aa  PANB_HELPJ RecName: Full=3-methyl-2-oxobutanoate
    6::238     2e-33  39%  272 aa  PANB_PROM1 RecName: Full=3-methyl-2-oxobutanoate
    8::270     4e-33  40%  270 aa  PANB_HELPY RecName: Full=3-methyl-2-oxobutanoate
   27::238     8e-33  48%  275 aa  PANB_HYPNA RecName: Full=3-methyl-2-oxobutanoate
   11::273     1e-32  30%  273 aa  PANB_PORGI RecName: Full=3-methyl-2-oxobutanoate
   11::273     1e-32  30%  273 aa  PANB_PORG3 RecName: Full=3-methyl-2-oxobutanoate
    8::270     1e-32  41%  270 aa  PANB_HELPH RecName: Full=3-methyl-2-oxobutanoate
   12::272     2e-32  30%  272 aa  PANB_FLAJ1 RecName: Full=3-methyl-2-oxobutanoate
   26::269     2e-32  34%  284 aa  PANB2_BURCM RecName: Full=3-methyl-2-oxobutanoate
    8::270     5e-32  41%  270 aa  PANB_HELPS RecName: Full=3-methyl-2-oxobutanoate
    6::231     1e-31  41%  272 aa  PANB_SYNS3 RecName: Full=3-methyl-2-oxobutanoate
    6::234     2e-31  38%  256 aa  PANB_PROMA RecName: Full=3-methyl-2-oxobutanoate
   29::265     9e-31  43%  275 aa  PANB_PHEZH RecName: Full=3-methyl-2-oxobutanoate
   50::271     6e-30  35%  275 aa  PANB_CAUCR RecName: Full=3-methyl-2-oxobutanoate
   50::271     6e-30  35%  275 aa  PANB_CAUCN RecName: Full=3-methyl-2-oxobutanoate
    6::233     1e-29  40%  270 aa  PANB_SYNS9 RecName: Full=3-methyl-2-oxobutanoate
    4::231     2e-29  39%  257 aa  PANB_PROMP RecName: Full=3-methyl-2-oxobutanoate
    4::234     3e-29  38%  257 aa  PANB_PROM5 RecName: Full=3-methyl-2-oxobutanoate
   10::231     5e-29  38%  257 aa  PANB_PROM0 RecName: Full=3-methyl-2-oxobutanoate
   13::221     5e-29  35%  326 aa  PANB1_BRAJA RecName: Full=3-methyl-2-oxobutanoate
    6::231     9e-29  38%  257 aa  PANB_PROM9 RecName: Full=3-methyl-2-oxobutanoate
   10::231     1e-28  38%  257 aa  PANB_PROMS RecName: Full=3-methyl-2-oxobutanoate
    1::231     1e-28  36%  272 aa  PANB_PROMM RecName: Full=3-methyl-2-oxobutanoate
    1::231     1e-28  36%  272 aa  PANB_PROM3 RecName: Full=3-methyl-2-oxobutanoate
    6::231     7e-28  37%  257 aa  PANB_PROM2 RecName: Full=3-methyl-2-oxobutanoate
    6::231     3e-27  36%  271 aa  PANB_SYNSC RecName: Full=3-methyl-2-oxobutanoate
   15::264     6e-24  30%  274 aa  PANB_HALSA RecName: Full=3-methyl-2-oxobutanoate
   15::264     6e-24  30%  274 aa  PANB_HALS3 RecName: Full=3-methyl-2-oxobutanoate
   10::226     9e-23  36%  267 aa  PANB_SYNPX RecName: Full=3-methyl-2-oxobutanoate
   53::257     4e-22  30%  257 aa  PANB_PELUB RecName: Full=3-methyl-2-oxobutanoate
    1::263

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PANB_SALTY      MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PANB_SALPK      MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PANB_SALPA      MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PANB_SALNS      MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PANB_SALHS      MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PANB_SALG2      MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PANB_SALEP      MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PANB_SALDC      MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PANB_SALPC      MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PANB_SALCH      MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PANB_SALA4      MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PANB_SALTI      -KPTTIAVLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PANB_CITK8      MKPTTIALLQKCKQEKKRFATITAYDYSFARLFADEGINVMLVGDSLGMTVQGHDSTLPVTVEDIAYHTR
PANB_ENT38      MKPTTISLLQKCKQEKKRFATITAYDFSFAKLFAEEGINVMLVGDSLGMTVQGHDSTLPVTVDDIAYHTR
PANB_KLEP3      MKPTTIALLQKCKQEKKRFATITAYDHSFAKLFADEGINVLLVGDSLGMTVQGHDSTLPVTVEDIAYHTR
PANB_ECOSE      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVEDIAYHTA
PANB_ECOHS      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVEDIAYHTA
PANB_ECO55      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVEDIAYHTA
PANB_ECO24      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVEDIAYHTA
PANB_ECO8A      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVEDIAYHTA
PANB_SALAR      MKPTTIALLQKYKQEKKRFATITAYDYSFAKLFADEGLSVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PANB_ECOL5      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_ECO81      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_SHIBS      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_SHIB3      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_KLEP7      MKPTTIALLQKCKQEKKRFATITAYDHSFAKLFADEGINVLLVGDSLGMTVQGHDSTLPVTVEDIAYHTR
PANB_ECOLI      MKPTTISLLQKYKQEKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_ECOLC      MKPTTISLLQKYKQEKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_ECODH      MKPTTISLLQKYKQEKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_ECOBW      MKPTTISLLQKYKQEKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_SHISS      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_ESCF3      MKPTTIASLQKCKQNKKRFATITAYDYSFAKLFAEEGLNVMLVGDSLGMTVQGHDSTLPVTVQDIAYHTA
PANB_ECOUT      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFAEEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_ECOSM      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFAEEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_ECOL6      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFAEEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_ECOK1      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFAEEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_ECO7I      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFAEEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_ECO45      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFAEEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_ECO5E      MKPTTIASLQKCKQEKKRFATITAYDYSFAKLFAEEGLNVMLVGDSLGMTVQGHESTLPVTVEDIAYHTT
PANB_ECO57      MKPTTIASLQKCKQEKKRFATITAYDYSFAKLFAEEGLNVMLVGDSLGMTVQGHESTLPVTVEDIAYHTT
PANB_ECOLU      MKPTTIASLQKCKQEKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_ECO27      MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFAEEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_SHIFL      MKPTTIASLQKYKQDKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_SHIF8      MKPTTIASLQKYKQDKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTA
PANB_SHIDS      MKPTTIASLQKCKQEKKRFATITAYDYSFAKLFADEGLNVILVGDSLGMTVQGHDSTLPVTVADIAYHTT
PANB_ENTS8      MKPTTISQLRRLKETGKKFATITAYDFSFAKLFEEEGIGVMLVGDSLGMTVQGHDSTLPVTVDDIAYHTR
PANB_YERE8      MKATTMSHLRQWKLEKRKFATLTAYDASFAQLFAEQGIEVLLVGDSLGMTLQGFDSTLPVTTADVAYHTR
PANB_YERPY      MKTTTMSQLRQWKQEKRKFATLTAYDASFAQLFAEQGIQVLLVGDSLGMTLQGFDSTLPVTVADVAYHTR
PANB_YERPS      MKTTTMSQLRQWKQEKRKFATLTAYDASFAQLFAEQGIQVLLVGDSLGMTLQGFDSTLPVTVADVAYHTR
PANB_YERPB      MKTTTMSQLRQWKQEKRKFATLTAYDASFAQLFAEQGIQVLLVGDSLGMTLQGFDSTLPVTVADVAYHTR
PANB_YERP3      MKTTTMSQLRQWKQEKRKFATLTAYDASFAQLFAEQGIQVLLVGDSLGMTLQGFDSTLPVTVADVAYHTR
PANB_ERWCT      MKPTTISHLRQWKQEQRKFATITAYDASFSRLFFEQGIRVMLVGDSLGMTVQGHDSTLPVTTHDIVYHTQ
PANB_YERPP      MKTTTMSQLRQWKQEKRKFATLTAYDASFAQLFAEQGIQVLLVGDSLGMTLQGFDSTLPVTVADMAYHTR
PANB_YERPN      MKTTTMSQLRQWKQEKRKFATLTAYDASFAQLFAEQGIQVLLVGDSLGMTLQGFDSTLPVTVADMAYHTR
PANB_YERPG      MKTTTMSQLRQWKQEKRKFATLTAYDASFAQLFAEQGIQVLLVGDSLGMTLQGFDSTLPVTVADMAYHTR
PANB_YERPE      MKTTTMSQLRQWKQEKRKFATLTAYDASFAQLFAEQGIQVLLVGDSLGMTLQGFDSTLPVTVADMAYHTR
PANB_YERPA      MKTTTMSQLRQWKQEKRKFATLTAYDASFAQLFAEQGIQVLLVGDSLGMTLQGFDSTLPVTVADMAYHTR
PANB_PECCP      MKPTTISHLRQWKQEQRKFATITAYDASFSRLFFEQGIRVMLVGDSLGMTVQGHDSTLPVTTSDIVYHTQ
PANB_ERWT9      MKPTTVSTLRQWKQQGEKFASITAYDFSFARLFADEGIQVMLVGDSLGMVVQGHDSTLPVTLADIVYHTE
PANB_VIBHB      MKKMTINDLIKWKQEGRKFATSTAYDASFAQLFESQEMPVLLVGDSLGMVLQGKTDTLPVTVEDIAYHTR
PANB_EDWI9      MTPTTLSHLRKRKQEKHKFATITAYDASFARLFAEQGIDVMLVGDSLGMTLQGHDTTLSVTVADIAYHTR
PANB_VIBSL      MKKVTINDLIKCKQEGRKFATSTAYDASFAQLFESQDMPVLLVGDSLGMVLQGRNDTLPVTVEDIAYHTR
PANB_SODGM      ---TTISHLRKWKQQQRKFTSITAYDAAFARLFAEQGIKVMLVGDSLGMTMQGHDSTLPVTLEDMVYHTR
PANB_PROMH      MKPVTLSTLNRYKQEKKKFATITAYDASFARLFANEGIPAMLIGDSLGMTLQGHDSTLPVTVEQIAYHTR
PANB_VIBVY      MKKITINDLIKWKQEGRKFATSTAYDASFAQLFESQEMPVLLVGDSLGMVLQGKNDTLPVTVEDIAYHTR
PANB_VIBVU      MKKITINDLIKWKQEGRKFATSTAYDASFAQLFESQEMPVLLVGDSLGMVLQGKNDTLPVTVEDIAYHTR
PANB_VIBPA      MKKMTINDLIKWKQEGRKFATSTAYDASFAQLFESQEMPVLLVGDSLGMVLQGENDTLPVTVDDIVYHTR
PANB_PHOLL      MKPMTMTDLNQLKKEKRKFATITAYDASFAHLFAEQGIDVMLVGDSLGMTVQGADTTIPVTVEDIVYHTR
PANB_VIBCM      MKKITINDLMKWKQEGRKFATSTAYDASFAQLFESQEMPVLLVGDSLGMVLQGETDTLPVTVDDIAYHTR
PANB_VIBCH      MKKITINDLMKWKQEGRKFATSTAYDASFAQLFESQEMPVLLVGDSLGMVLQGETDTLPVTVDDIAYHTR
PANB_VIBC3      MKKITINDLMKWKQEGRKFATSTAYDASFAQLFESQEMPVLLVGDSLGMVLQGETDTLPVTVDDIAYHTR
PANB1_VIBF1     MKKISIHDLMKWKQEGKKFATVTAYDASFAQLFEQQEVPVLLVGDSLGMVLQGKSDTLPVTTEEIAYHTR
PANB_PHOPR      MKKITINDLMTWKHEGRKFASITAYDASFAQLFEQQEVPVLLVGDSLGMVLQGKPDTLPVSVSDIAYHTR
PANB_SCHPO      LKQITISTLRQWKLANKKFACITAYDASFSRLFAEQGMPVMLVGDSLGMTAQGHSTTLPVSVEDIAYHTK
PANB_ALISL      MKKISIHDLMKWKQDGRKFATVTAYDASFAQLFEQQDMPVLLVGDSLGMVLQGKSDTLPVTTEEIAYHTR
PANB_VIBFM      MKKISIHDLMKWKQEGKKFATVTAYDASFAQLFEQQEVPVLLVGDSLGMVLQGKSDTLPVTTEEIAYHTR
PANB_SHELP      MSKITSSTLLKFKQEGKKFTALTAYDASFAGAFDSEGIDVLLVGDSLGMVLQGHDDTLPVTVEDIVYHTR
PANB_SHEPW      MSKITSSTLRTFKSEGKKFTALTAYDASFANAFDSEGVDVLLVGDSMGMVLQGHNDTLPVTVDDIAYHTR
PANB_SHEFN      MSKVTSSTLIKFKQEGKKFTALTAYDASFAGAFDSEGVDVLLVGDSLGMVLQGHNDTLPVTIADIAYHTA
PANB_SHEPA      MSKITSSTLRTFKQEGKKFTALTAYDASFAGAFDSEGIDVLLVGDSMGMVLQGHSDTLPVTVEEIAYHTR
PANB_SHEON      MSKVTSSTLLKYKQEGRKFTALTAYDASFASAFDGEGIDVLLVGDSLGMVLQGHDDTLPVTTADIAYHTR
PANB_SHESM      MSKVTSSTLLKYKQEGRKFTALTAYDASFASAFDGEGIDVLLVGDSLGMVLQGHDDTLPVTTADIAYHTR
PANB_PSYIN      MAKISVSRLTKMKQDNQKITCMTAYDASFAAIFDQAGIQVLLVGDSLGMVLQGHDSTLPVTVDDIRYHTA
PANB_AERS4      -KITTASLL-KMKQDDQKITAITAYDASFAKLFDDEGAHVLLIGDSLGMVLQGGQDTLAVSVDEMVYHTR
PANB_SHESR      MSKVTSSTLLKYKQEGRKFTALTAYDASFASAFDGEGIDVLLVGDSLGMVLQGHDDTLPVTTAEIAYHTR
PANB_SHESA      MSKVTSSTLLKYKQEGRKFTALTAYDASFASAFDGEGIDVLLVGDSLGMVLQGHDDTLPVTTAEIAYHTR
PANB_SHEWM      MSKITSSTLLKFKQEGKKFTALTAYXXXXXXXXXXEGVDVLLVGDSMGMVLQGHDDTLPVSVEDIAYHTR
PANB_ALTMD      MKKVTVSGLLKKKQAGEKITSLTAYDASFAKMFDEQGVDALLIGDSLGMVLQGEDDTLPVTIDDIAYHTK
PANB_AERHH      -KITTTNLL-KMKQEGQRITAITAYDATFAKLFDDEGAHVLLIGDSLGMVLQGGQDTLGVSMDEMVYHTR
PANB_SHESW      MSKITSSTLLKYKQEGRKFTALTAYDASFAGAFDSEGVDVLLVGDSLGMVLQGHDDTLPVTTAEIAYHTR
PANB_SHEPC      MSKITSSTLLKYKQEGRKFTALTAYDASFAGAFDSEGVDVLLVGDSLGMVLQGHDDTLPVTTAEIAYHTR
PANB_SHEHH      MSKITSSTLRTFKQEGKKFTALTAYXXXXXXXXXXEGIDVLLVGDSMGMVLQGHSDTLPVTVDDIAYHTR
PANB_SHESH      MSKITSSTLLKFKQEGKKFTALTAYXXXXXXXXXXEGIDVLLVGDSMGMVLQGHDDTLPVTVEDIAYHTR
PANB_PSEHT      MSKITVSTLNKMKAEKNKITALTAYDASFAKLFHDNGVEVILVGDSLGMVLQGGDDTLGVTNQDIAYHTR
PANB_PSEA6      MKKVTTSTLLKMKQQSEKISALTAYDASFSKLFDEQGIDVLLIGDSLGMVLQGCDDTLGVSIDDVAYHTR
PANB2_VIBF1     MKKITISDLNNWKEVGEKFASITAYDASFAKIFEEQSMPVIIVGDSLGSVIQGKPTTLDVSIEELVYHTK
PANB_BUCAT      MESITISQLKNWKRNKKKFAAITAYDFSFSRLFSNCGIPVILIGDSLGMTIQGHTSTLPVKIEDIAYHTK
PANB_BUCAI      MESITISQLKNWKINKKKFAAITAYDFSFSRLFSNCGIPVILIGDSLGMTIQGHTSTLPVKIEDIAYHTK
PANB_BUCA5      MESITISQLKNWKRNKKKIAAITAYDFSFSRLFSNCGIPVILIGDSLGMTIQGHTSTLPVKIEDIAYHTK
PANB_SHEDO      MSKVTSSTLLKFKQEGTKFTSITAYXXXXXXXXXXEGIDAILVGDSLGMVLQGHDDTLPVTTADVAYHTA
PANB_TOLAT      MSKISLTQVQKMKQSGEKIAMITAYDATFARLFDDEGVHSILVGDSLGMVVQGHNDTLPVTVNDMVYHTA
PANB_BAUCH      MNITTISHLRKYKQRQQKFXXXXXXXXXXXSLFEQNGIQVMLVGDSLGMTIQGNDSTLPVTLEDMIYHTR
PANB_BUCAP      MESITISKIQNWKKNQIKFAAITAYDFSFSRLFEKEGIPIMLVGDSLGMTIQGHNSTLPVKIQDIKYHTK
PANB_MARMS      -KAVTLSTLKKMKADKEKITCLTSYDASFTNVMNVAGVETILVGDSLGMVIQGQDSTLPVTIEDMCYHTA
PANB_IDILO      ---TSIATLQKMKREGTKISSLTAYDSSFAKLMTEQGVDFILVGDSLGNVVQGRDSTVPVTVDDMIYHTQ
PANB_SHEAM      MSKVTTSTLMKFKQEGKKFXXXXXXXXXXXXXXXXEGVDVLLVGDSLGMVLQGHEDTLPVTVQDIAYHTR
PANB_PSEU5      MPDVTLTTLQGLKQKGEKIVMLTCYDATFAKTACDAGVEMLLIGDSLGMVLQGHDSTLPVTVADMAYHTA
PANB_COLP3      -KITTASLLNM-KQQGKKISTITAYDASFAKLFDQAGIHAILIGDSLGMVLQGQDSTLPVTIEDMAYHTR
PANB_PSEPW      MPEVTLTTLHGLKAKGEKITMLTCYDATFAKAASQAGVEVLLVGDSLGMVLQGHDSTLPVTTAEMAYHTA
PANB2_PSEF5     MPDITLTTLQSLKQKGEKITMLTCYDATFAHTCCEAGVEVLLVGDSLGMVLQGHDSTLPVSTADMAYHVA
PANB_MARAV      ----TINTLREYKQKGEAFSALTSYDATFAQVVSEAGVDVILIGDSLGMVLQGHDSTLPVTMDQMVYHTS
PANB_PSEPF      MPAITLTTLQSLKQKGEKITMLTCYDATFAHACNEAGVEVLLVGDSLGMVLQGHDSTLPVTTAEMAYHVA
PANB2_HAHCH     ------------------FAVMTAYDATFAYEMDQAGVEVILVGDSLGMVLQGHDSTIPVRLEDMVYHTA
PANB_PSEFS      MPDITLTTLQSLKLKGEKITMLTCYDATFAHASCQAGIEVLLVGDSLGMVLQGNDSTLPVTTDELAYHTA
PANB_PSEMY      MPDVTLTTLQSLKQGGDKIAMLTCYDATFARAACQAGVDVLLVGDSLGMVLQGHDSTLPVSVEEMAYHTA
PANB_WIGBR      MKKTNIYDLYKLKEQNKKFASITAYDATFANLFFKKGIRTILVGDSLGMTIQGHSSTVPVKIDEMMYHTK
PANB_PSE14      MPNITVTSLLAMKQKGEKITMLTCYDATFAHTASQAGVEVLLIGDSLGMVLQGHDSTLPVTTAETAYHVA
PANB_PSEU2      MPNITVTSLLAMKQKGEKITMLTCYDATFAHTASQAGVEVLLIGDSLGMVLQGHDSTLPVTTAETAYHVA
PANB_PSESM      MPNITVTSLLAMKHKGEKITMLTCYDATFAHTACQAGVEVLLIGDSLGMVLQGHDSTLPVTTAETAYHVA
PANB_CHRVO      ----TVNTLHKLAEEGRKITMLTCYDASFASLLDEAGVEILLVGDSLGPVMQGVDSTLPVSEEDMLYHIR
PANB_CHRSD      MKTVTLSRLNAFKHAQEPFSCLTAYDASFAQHADAAGIDVLLVGDSLGMVLQGHASTLPVTLDDILYHTR
PANB_RALPJ      -KAVTVTSLQAMRAAGERIVMLTAYDSSFAALMDRNGTDVLLVGDSLGNVMQGQKTTLPVTLEHIVYHTE
PANB_SACD2      -KKVTVNTLRKMKADKEKFITVALYDAPMAAMAQKCGVEVVLIGDSLGMTVLGYDSTVPVTMEQMIYHIE
PANB_PSYA2      ---TTLSTLNKFKKDGTKFTCLTCYDAMFARMMEKAQIDTILIGDSLGMVVQGHDSTLPVTVDDMAYHTA
PANB2_PSEE4     MPEVTLTTLNGLKAKGEKITMLTCYDATFAKAASEAGVEVLLVGDSLGMVLQGHDSTLPVSNDDMAYHTA
PANB_PSEPK      MPEVTLTTLNGLKAKGEKITMLTCYDATFAKAASQAGVEVLLVGDSLGMVLQGHDSTLPVTTAEMAYHTA
PANB_PSEP1      MPEVTLTTLNGLKAKGEKITMLTCYDATFAKAASQAGVEVLLVGDSLGMVLQGHDSTLPVTTAEMAYHTA
PANB_PSYWF      ----TLSTLKKYKKEGRKFSCLTCYDAMFAKMMQNAQVDTILIGDSLGMVVQGNDSTLPVTVEDIVYHTG
PANB_PSYCK      ---TTLSTLNKFKKDGTKFTCLTCYDAMFARMMEKAQIDTILIGDSLGMVVQGHDSTLPVTVDDMAYHTA
PANB_NEIMF      ----TVNTLQKMKAAGEKIAMLTAYESSFAALMDDAGVEMLLVGDSLGMAVQGRKSTLPVSLRDMCYHTE
PANB_ALCBS      ----TIRTLQKRKQDGGKFSVLTAYDACFSRLISEAGVEAILVGDSLGNVIQGQTSTVPVTLEQMVYHTQ
PANB1_BURCM     ----TVPKLQAMRDAGEKIAMLTCYDASFAALLDRSGVDVLLIGDSLGNVLQGHTTTLPVSLDDIAYHTA
PANB_ACIBS      ----SLSDLRKFKAEGRKFSCLTCYDASMAKAMELAEIDTILIGDSLGMAIQGRDSTLPVTVEDMAYHTA
PANB_BURVG      ----TVPKLQAMREAGEKIAMLTCYDASFAALLDRAGTDVLLIGDSLGNVLQGHTTTLPVSLDDIAYHTA
PANB_ACIBY      ----SLSDLRKFKAEGRKFSCLTCYDASMAKAMELAEIDTILIGDSLGMAIQGRDSTLPVTVEDMAYHTA
PANB_ACIBC      ----SLSDLRKFKAEGRKFSCLTCYDASMAKAMELAEIDTILIGDSLGMAIQGRDSTLPVTVEDMAYHTA
PANB_ACIB5      ----SLSDLRKFKAEGRKFSCLTCYDASMAKAMELAEIDTILIGDSLGMAIQGRDSTLPVTVEDMAYHTA
PANB_ACIB3      ----SLSDLRKFKAEGRKFSCLTCYDASMAKAMELAEIDTILIGDSLGMAIQGRDSTLPVTVEDMAYHTA
PANB_BURCA      ----TVPKLQAMRDAGEKIAMLTCYDASFSALLDRAGTDVLLIGDSLGNVLQGHTTTLPVSIDDIAYHTA
PANB1_BURCH     ----TVPKLQAMRDAGEKIAMLTCYDASFSALLDRAGTDVLLIGDSLGNVLQGHTTTLPVSIDDIAYHTA
PANB2_BURS3     ----TVPKLQAMRDAGEKIAMLTCYDASFSALLDRSGVDVLLIGDSLGNVLQGHTTTLPVSLDDIAYHTA
PANB_BURPP      ----TVPKLQAMRDAGEKIAMLTCYDASFAALLDRAGVDVLLIGDSLGNVLQGQTTTLPVSLADIAYHTA
PANB_BURTA      ----TVPKLQAMREAGEKIAMLTCYDASFAALLDRANVDVQLIGDSLGNVLQGQTTTLPVTLDDIAYHTA
PANB_BURXL      ----TVPKLQAMRDAGEKIAMLTCYDASFAALLDRAGVDVLLIGDSLGNVLQGQTTTLPVSLADIAYHTA
PANB_NEIMB      ----TVNTLQKMKAAGEKIAMLTAYESSFAALMDDAGVEMLLVGDSLGMAVQGRKSTLPVSLRDMCYHTE
PANB_BURPS      ----TVPKLQAMREAGEKIAMLTSYDASFAALLDRANVDVQLIGDSLGNVLQGQATTLPVTLDDIAYHTA
PANB_BURP6      ----TVPKLQAMREAGEKIAMLTSYDASFAALLDRANVDVQLIGDSLGNVLQGQATTLPVTLDDIAYHTA
PANB_BURP1      ----TVPKLQAMREAGEKIAMLTSYDASFAALLDRANVDVQLIGDSLGNVLQGQATTLPVTLDDIAYHTA
PANB_BURP0      ----TVPKLQAMREAGEKIAMLTSYDASFAALLDRANVDVQLIGDSLGNVLQGQATTLPVTLDDIAYHTA
PANB_BURMS      ----TVPKLQAMREAGEKIAMLTSYDASFAALLDRANVDVQLIGDSLGNVLQGQATTLPVTLDDIAYHTA
PANB_BURMA      ----TVPKLQAMREAGEKIAMLTSYDASFAALLDRANVDVQLIGDSLGNVLQGQATTLPVTLDDIAYHTA
PANB_BURM9      ----TVPKLQAMREAGEKIAMLTSYDASFAALLDRANVDVQLIGDSLGNVLQGQATTLPVTLDDIAYHTA
PANB_BURM7      ----TVPKLQAMREAGEKIAMLTSYDASFAALLDRANVDVQLIGDSLGNVLQGQATTLPVTLDDIAYHTA
PANB_XANAC      -KPWTVPALAQAKREGRKLVMLTAYDAGFARTFDANGVDLILVGDSLGMVVQGHDSTLPVTTADMVYHTX
PANB_ACIAD      ----SLSDLRKFKTEGRKFSCLTCYDASMAKAMEFAEIDSILIGDSLGMVIQGHDSTLPVTVDDMAYHTA
PANB_XANC5      -KPWTVPALAQAKREGRKLVMLTAYDAGFARTFDAHGVDLILVGDSLGMVVQGHDSTLPVTTADMVYHTX
PANB_JANMA      -KAVTIPSLLAMKERGEKITMLTAYDASFASMMDTCGVEMILIGDSLGMVCQGHNSTLPVTIEDVAYHTA
PANB_ALHEH      -RPVTVGRLQRMKADGQKVVALTAYDYTFAVAEDQAGVDVILVGDSLGMVVQGRDTTVPVTVEEMVYHTR
PANB_BURP8      ----TVPKLMAMREAGEKIAMLTCYDASFAALLDRAGVDSLLIGDSLGNVLQGQSTTLPVTLDEIAYHTA
PANB_CLOBA      ----TIATFQEFKNKGKKISMLTAYDYSMAKIIDESGINGILIGDSLGMVIKGEEDTLSVTVDEIIYHTK
PANB_RALME      -KTVTIPKLQAMREAGEKIAMLTAYDSSFSALLDLCGVEVILVGDSLGNVMQGQQTTLPVTLEHMVYHTE
PANB_NITMU      ----TQDVFQKMRDDGEKIAIVTCYDASFAALLERAGVDILLVGDSLGNVIQGEETTLPVTLDDMIYHTL
PANB2_PSEAB     MPDVTLTTLQGLKQSGEKIAMLTCYDATFAHTASQAGVDVLLVGDSLGMVLQGHDSTLPVSNEEMAYHTA
PANB_STRMK      -KPWTVPALAEAKRNGQKLVMLTAYDAGFARTFDANGVDLILIGDSLGMVVQGHDSTLPVTVADMVYHTR
PANB_STRM5      -KPWTVPALAEAKRNGQKLVMLTAYDAGFARTFDANGVDLILIGDSLGMVVQGHDSTLPVTVADMVYHTR
PANB2_PSEAE     MPDVTLTTLQGLKQSGEKIAMLTCYDATFAHTASQAGVDVLLVGDSLGMVLQGHDSTLPVSNEEMAYHTA
PANB_XYLFA      -KPWTVPALAEAKRNGSKIVMLTAYDAGFARILDANGVDLVLVGDSLGMVVQGHDSTLPVSVHDMVYHTA
PANB_XANOM      --PWTVPALAQAKRAGRKLVMLTAYDASFARTFDANGVDLILVGDSLGMVMQGHDSTLAVTTADMVYHTX
PANB_DECAR      --------LAKLYQAGEKIAQFTCYDASFARLLDGAGVDSILIGDSLGNVIQGHDTTLPVTVADIAYHTA
PANB_XANOR      --PWTVPALAQAKRAGRKLVMLTAYDASFARTFDVNGVDLILVGDSLGMVMQGHDSTLAVTTADMVYHTX
PANB_XANOP      --PWTVPALAQAKRAGRKLVMLTAYDASFARTFDVNGVDLILVGDSLGMVMQGHDSTLAVTTADMVYHTX
PANB_RALEJ      -KTVTITRLQAMRDAGEKIAMLTAYDSSFAALLDYCGVEVILVGDSLGNVMQGQQTTLPVTLEHMAYHTE
PANB_CLOB8      ----TVLTFKQAKEEKRRLSMLTAYDYSMAKIIDESGVNGILIGDSLGMVIKGEDDTLAVTMDEIIYHTK
PANB_BURM1      ----TVPKLQAMRDAGEKIAMLTCYDASFAALLDRAGTDVLLIGDSLGNVLQGHATTLPVSLDDIAYHTA
PANB_RALSO      -KAVTVTSLQGMRAAGERIAMLTAYDASFAALMERXXXXXXXXXXXXXXXXQGQKTTLPVTLDHIVYHTE
PANB_RALEH      -KTITIPKLQAMRDAGEKIAMLTAYDSSFAALLDYCGVEMILVGDSLGNVMQGQQTTLPVTLEQMAYHTE
PANB_NITEC      -KRITVLTLQNIYREKGKIAALTCYDATFAAVLENAGVDILLVGDSLGNVIQGQASTLPVTLDEMIYHVC
PANB_XANCP      -KPWTVPALAQAKRDGRKLVMLTAYDAGFARTFDANGVDLILVGDSLGMVVQGHESTLPVTTADMVYHTX
PANB_XANCB      -KPWTVPALAQAKRDGRKLVMLTAYDAGFARTFDANGVDLILVGDSLGMVVQGHESTLPVTTADMVYHTX
PANB_XANC8      -KPWTVPALAQAKRDGRKLVMLTAYDAGFARTFDANGVDLILVGDSLGMVVQGHESTLPVTTADMVYHTX
PANB_THICR      ----TLTKLHKMKQAGEKIVCLTAYEASQAYWAVEAGVEVILVGDSLGMVVQGHQTTLPVTLNDMVYHTQ
PANB_METFK      --------LQQMKERGEKIAVLTSYDASFAALSDKAGVDVLLVGDSLGMTMQGHANTLAVSLRDMEYHTR
PANB_CUPTR      -KTITIPKLQAMRDAGEKIAMLTAYDSSFAALLDYCGVEMILVGDSLGNVMQGQQTTLPVTLEQMAYHTE
PANB_PELPD      -KKVTIPDILKMKQERRRITMMTAYDYPFARLVDSGGVDAILVGDSLGVVFSGHDNTLSVTMDEMIYHTR
PANB_SYNWW      MARVTVSVLKDKKKRKEKISMLTAYDYSLAGMVDEAGIDMILVGDSLGNVVLGYDNTLAVTMDDMIHHSK
PANB_XYLFT      -KPWTVPALAEAKRNGSKIVMLTAYDAGFARILDANGVDLILVGDSLGMVVQGHDSTLPVSVHDMVYHTA
PANB_XYLF2      -KPWTVPALAEAKRNGSKIVMLTAYDAGFARILDANGVDLILVGDSLGMVVQGHDSTLPVSVHDMVYHTA
PANB_THEPX      --------LRKFKKEGRKITALTAYDFPTAKILDNCGIDMILVGDSLGMVVLGYESTIPVTMEDMIHHTK
PANB_THEP3      --------LRKFKKEGRKITALTAYDFPTAKILDNCGIDMILVGDSLGMVVLGYESTIPVTMEDMIHHTK
PANB_METCA      --PVTLPDLLAMKRRGEKIACLTAYDASSAALQDEAGIEVILVGDSLGNVIQGQPTTLSVTLDHMVYHTA
PANB_GEOTN      ----------RMKQADEPIVMVTAYDFPSAKLVEQAGVDMILVGDSLGMVVLGYDSTIPVTVDDMIHHTK
PANB_XYLFM      -KPWTVPALAEAKRNGSKIVMLTAYDAGFARILDANGVDLVLVGDSLGMVVQGHDSTLPVSVHDMVYHTA
PANB_BACC7      ----------KMKEQGEPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHTK
PANB_NITEU      -KRMTITTLQNACEQGEKIAVLTCYDATFAAVLEEAGVDILLVGDSLGNVVQGKSSTLPVTLDEMIYHVR
PANB_AZOSE      -KPVTLFEIGKMRAEGRKISMLTCYDASFASLLERAGVDILLVGDSLGNVVQGQKSTLPVTLEHMIYHTE
PANB_CLONN      ----TVTTFQKAKNNGEKLTMLTAYDYSTAKLIDESGINGILVGDSLGMVCLGYEDTLSVTMEDMIHHTR
PANB_CLOD6      ----TIQTFKNAKYEGKKLSMLTAYDYSIAKIMDECDINGILIGDSLGMVIKGEENTLSVTIDEIIYHTK
PANB_GEOSW      ----------KMKQENEPIVMLTAYDFPSAKLAEAAGVDMILVGDSLGMVVLGYDSTIPVTVEDMIHHTK
PANB_GEOLS      -KKITIPEILLMKQEGRKVTVLTAYDYPTARLVDAGGVDAILVGDSAGVVFSGHENTLPVTMDEMLYHVK
PANB_ENTFA      MKNTAVTF-KESKLRNEKLTMLTAYDYSTAKIIDEAGINGILVGDSLGMVCLGHEDTLSVTMEDMIHHTR
PANB_BACC1      ----------KMKEQGEPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHTK
PANB_NEIMA      ----TVNTLQKMKAAGEKIAMLTAYESSFXXXXXXXXXXXXXXXXXXXXAVQGRQSTLPVSLRDMCYHTE
PANB_BACWK      ----------KMKEQGEPITMLTAYDYPSAKLAEEAKVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHTK
PANB_GEOKA      ------------KQAGEPIVMVTAYDFPSAKLAEQAGVDMILVGDSLGMVVLGYDSTIPVTVDDMIHHTK
PANB_DESAA      ----TVTVLAKMKAEGEKITMLTAYDYPFARMVDECGVDMILVGDSLGMVVQGETSTLPVTMDQMVYHTT
PANB_BACHD      ----TTASFKKMKQQKEKIAMMTAYDAPSARLVEDADVDMILVGDSLGMVVLGYDSTIPVTLDDMIHHTK
PANB_NITOC      ----TLTKLQKMKRQGEKITMLTAYDASFXXXXXXXXXXXXXXXDSLGMVIQGQESTLSVTMDDMVYHCR
PANB_LEPBL      ------------KKGKEKISVVTCYDFSFARILGETPIDSILVGDSLGMVFQGNSSTLPVTLEEMIYHTK
PANB_CALS8      -KVTTKTLFEK-KQKGEKITMLTAYDYTFAKLFDSCMVDILLVGDSLGMVILGYDSTIPVTMEDMEHHVK
PANB_ANATD      -KVTTKTLFEK-KQKGEKITMITAYDYTFAKIFDSCSVDILLVGDSLGMVILGYDSTIPVTMDDMEHHVR
PANB_MYCUA      --------LQKWKAEGHKWAMLTVYDYSTARAFDDAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLVR
PANB_MYCMM      --------LQKWKAEGHKWAMLTVYDYSTARAFDDAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLVR
PANB_BACHK      ----------KMKEQGEPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHTK
PANB_BACCZ      ----------KMKEQGEPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHTK
PANB_BACCR      ----------KMKEQGEPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHTK
PANB_BACC4      ----------KMKEQGEPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHTK
PANB_BACC3      ----------KMKEQGEPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHTK
PANB_BACC2      ----------KMKEQGEPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHTK
PANB_BACC0      ----------KMKEQGEPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHTK
PANB_BACAN      ----------KMKEQGEPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHTK
PANB_BACAH      ----------KMKEQGEPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHTK
PANB_BACAC      ----------KMKEQGEPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHTK
PANB_BACAA      ----------KMKEQGEPITMLTAYDYPSAKLAEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHTK
PANB_NEIG2      ----TVNTLQKMKAAGEKIVMLTAYESSFXXXXXXXXXXXXXXXXXXXXAVQGRQSTLPVSLRDMCYHTE
PANB_NEIG1      ----TVNTLQKMKAAGEKIVMLTAYESSFXXXXXXXXXXXXXXXXXXXXAVQGRQSTLPVSLRDMCYHTE
PANB_HELMI      -KKITLPQCKEMKKQGKRLRMITAYDYPFARLVDESEIEIILVGDSLGMVVLGYDSTVPVTLDEMIHHCK
PANB_BACLD      ----------KMKQEGEPIVMLTAYDYPAAKLAEQAGVDMILVGDSLGMVVLGLDSTVSVTVADMIHHTK
PANB_GEOSL      ----TILDIQKMKATGEKITVLTSYDYPFTRIMDECGIDMILVGDSVGVVFAGHDNTLPVTVDDMLYHTR
PANB_PELCD      -KRKTVLDIQRMKAEGEKIAMLTAYDYPFARLMDLEGIDMVLVGDSVGPVVAGYDHTLPVTMDEMIYHCR
PANB_MYXXD      ----TIHTLKRFKQIGQKICMVTAYDATFAHILEEAGADVLLIGDSLGMVIQGHDSTLPVTMDQMVYHTX
PANB_CLOK5      MAKNNVSTFVSAKHNNEKITMLTAYDYSMAKLMDESGINGILVGDSLGMVCLGYKDTLSVTMEDMLHHIK
PANB_BACCN      ----------RMKQKGEPITMLTAYDYPSAKLVEEAEVDMILVGDSLGMVVLGYDSTVPVTVEDMIHHTK
PANB_VESOH      -----IEALKVFKESGEKITCLTAYDASFASVFDACGIDIILVGDSLGNVIQGDKNTLDVSMSDMIYHMQ
PANB_THIDA      --PVTLSTLKALRQKGEKIAVLTCYDASFARVFDAAGVDVLLVGDSLGMVIQGHASTLPVKLAEMAYHTR
PANB_THEM4      ---------------KEKIVMVTAYDTPTAKIAEEAGVDIILIGDSIGNNVLGYDSTIPVTMEEIIIHLK
PANB_BACA2      ----------KMKENGEPIVMLTAYDYPQAKLAEQAGVDMILVGDSLGMVVLGLDSTVGVTVSDMIHHTK
PANB_AZOSB      -KPVTLFELGKMRAEGRKIAMLTCYDASFAALLERNGVDVLLVGDSLGNVLQGQKSTLPVTLEQMAYHTE
PANB_MYCSS      --------LQKWKAEGHKWAMLTAYDFSTARAFDDAGIPVLLVGDSAANVVYGYDTTVPITIDELIPLVR
PANB_MYCSK      --------LQKWKAEGHKWAMLTAYDFSTARAFDDAGIPVLLVGDSAANVVYGYDTTVPITIDELIPLVR
PANB_MYCSJ      --------LQKWKAEGHKWAMLTAYDFSTARAFDDAGIPVLLVGDSAANVVYGYDTTVPITIDELIPLVR
PANB_RHOSR      --------LQAMKAEGERWAMLTAYDYSSARIFEEAGIPVLLVGDSAANVVYGYETTVPVTIDELLPLVR
PANB_CLOAB      MKNTT-ETFKNSKFKKEKLVMLTAYDYSTAKIIDSCDINGILVGDSLGMVCLGYENTLSVTMEDMIHHTK
PANB_LEPBJ      ------------KKGKEKISVVTCYDFSFARILGETPIDSILVGDSLGMVFQGNSSTLPVTLEEMIYHTK
PANB_BACSU      ----------KMKESEEPIVMLTAYDYPAAKLAEQAGVDMILVGDSLGMVVLGLDSTVGVTVADMIHHTK
PANB_GEOBB      -KQRTILDFQRMKAEGEKIAVLTSYDFPMTGIMDACGIDMILVGDSVGVVVAGYDNTLPVTMEDMIYHTR
PANB_KOSOT      ---------------KRKLSMVTAYSYFQAKMAEEAGIDMILVGDSYGNTILGYENTLPVTMEEMLIAVS
PANB_GEOMG      ----TIIDIQKMKAAGEKITVLTSYDYPFTRVMDECGIDMILIGDSVGVVFSGYDNTLPVTMDEMIYHTR
PANB_LEPIN      ------------KKGKEKISVVTCYDFSFARILNETEIDSILVGDSLGMVFQGNTSTLPVTLEEMIYHTK
PANB_LEPIC      ------------KKGKEKISVVTCYDFSFARILNETEIDSILVGDSLGMVFQGNTSTLPVTLEEMIYHTK
PANB_RUTMC      -----IEALNNFKQSGEKITCLTAYDASFASVFDVCXXXXXXXXXXXXNVIQGGENTLNVSMDDMVYHTK
PANB_CHLAD      ---TTIRDIQQMRDRGERIPMVTAYDYTSAQIADRAGIPMILVGDSLGMVVLGHDSTVPVTLDEMIHHTR
PANB_BDEBA      ------------KSKKQKISMITCYDYSFARIVADSDIDCILVGDSLAMVMLGHSTTLDVSASVMAHHTA
PANB_DEHSC      ---TTISQLKEMKQNKQKIAILTAYDYPTAQILDKAGIPAILVGDSLGMVVLGYDSTVSVTMEDMLHHLK
PANB_DEHSB      ---TTISQLKEMKQNKQKIAILTAYDYPTAQILDKAGIPAILVGDSLGMVVLGYDSTVSVTMEDMLHHLK
PANB_MYCPA      --------LQKMKAEGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPVSIDELIPLVR
PANB_GEOUR      -KTKTILDILKMKSDGEKITVLTCYDYATAGIMDGCGIDMILVGDSAGVVCAGYDNTLPVTMEEMIYHTK
PANB_THEAB      ----TIQKILKMKN-KEKIVMVTAYDAPTAKILEKAGVDIILVGDSLGNNVLGYDSTIPVTLEEMIIHLQ
PANB_MOOTA      ----TLPQLQAMKERGERITMVTAYDYPSSLLADRAGMDMILVGDSLGMVVLGYSSTVPVTMDEMIHHTK
PANB_BACP2      ----------KMKEQNEPIVMLTAYDYPSAKQAEKAEVDMILVGDSLGMVVLGLDSTIQVTIDDMIHHTK
PANB_THELT      ----------KSMKGKKPIVMLTAYDSVFASIVHQAGVDAILVGDSLANNVLGYSDTLPATMEDMIRHTQ
PANB2_METPP     -KPVTLHTLREMHARGEKIAMITAYDASFAALVDTAGVDCILVGDSLGMVLKGQSSTLSVTMEQIGYHTR
PANB_MYCVP      --------LHKWKAEGHKWAMLTAYDYSTAAVFDEAEIPVLLVGDSAANVVYGYDTTVPVTLDELIPLVR
PANB_DESPS      MRKTVVDIIAM-KAAGQKISMLTAYDASMSALLDQAGIDILLVGDSLGMTVLGYDSTVPVTMADMVHHMA
PANB_THESQ      ---------------------VTAYDAPSARIARDAGIDVILVGDSLGNNVLGYENTIPVTMEEMLIHVA
PANB_THEMA      ---------------------VTAYDAPSARIARDAGIDVILVGDSLGNNVLGYENTIPVTMEEMLIHVA
PANB_NOCFA      -RKTRIPHLRQMKADGERWAMLTAYDYSSARLFEEAGIPVLLVGDSAANVVYGYDTTVPITVDELIPLVR
PANB_MYCTU      --------LQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLVR
PANB_MYCBP      --------LQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLVR
PANB_MYCBO      --------LQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLVR
PANB_MYCA1      --------LQKMKAEGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPVSIDELIPLVR
PANB_CHLSY      ----TIRDIQQMRDRGERIPMVTAYDYTSAQIADRAGIPLILVGDSLGMVVLGYNSTVPVTLDDMIHHTR
PANB_CHLAA      ----TIRDIQQMRDRGERIPMVTAYDYTSAQIADRAGIPLILVGDSLGMVVLGYNSTVPVTLDDMIHHTR
PANB_GEOSF      -KATTILDIQKMKAEGEKISMLTCYDYPTARIMDDCGIDMILIGDSVGVVYAGYDNTLPVTMEDMIYHTR
PANB_DEHE1      ---TTISQLKEMKQNKQKIAMLTAYDYPTAQILDKAGIPAILVGDSLGMVVLGYDSTVSVTMEDMLHHLK
PANB_BACSK      ----TTKTFKQMKRDGEPIAMLTAYDAPSARLAERAGVDMILVGDSLGMVVLGYDSTVPVSVDDMVLHTK
PANB_MYCLE      --------LQKMKAEGHKWAMLTAYDYSTARVFDEAGIPVLLVGDSAANVVYGYDTTVPVSADELLPLVR
PANB_LEPBP      -------------QYKKKYSVVTCYDYTFATLFNRTDVDCLLVGDSLGMVIQGNQSTLPVTLDEIIYHTK
PANB_LEPBA      -------------QYKKKYSVVTCYDYTFATLFNRTDVDCLLVGDSLGMVIQGNQSTLPVTLDEIIYHTK
PANB_CAMJE      MRKSMISFLEK-KAKNEKITMVSAYDYHSARILDNSDIDIILVGDSLAMTVLGMQDTLSVTMDEMLIFTK
PANB_CAMJ8      MRKSMISFLEK-KAKNEKITMVSAYDYHSARILDNSDIDIILVGDSLAMTVLGMQDTLSVTMDEMLIFTK
PANB_CLOTH      -KFTTASFLESKKQGRK-ITMLTAYDYPTAKILDEAGVDSILVGDSLGMVVLGYEDTTRVTMDDMVHHTK
PANB_CAMJR      MRKSILSFLEK-KGKNEKITMVSAYDYHSAKILDNCDIDIILVGDSLAMTVLGMQDTLSVTMDEMLIFTK
PANB_CAMJJ      MRKSMISFLEK-KAKNEKITMVSAYDYHSAKILDNCDIDIILVGDSLAMTVLGMQDTLSVTMDEMLIFTK
PANB_SYNFM      ---------------KRKLSELTAYDYPTA-LWADQGIDMLLVGDSLAMVVLGHDDTLSVGMTEMLHHTS
PANB_THET2      ----------------QRLVYLTAYDYPTARLAEAAGVDAILVGDSLGMVVLGYPSTVPVTLEEMLHHTK
PANB_THET8      ----------------QRLVYLTAYDYPTARLAEAAGVDAILVGDSLGMVVLGYPSTVPVTLEEMLHHTK
PANB_EXISA      ----TMTTLLKKMNEQEKLVMLTAYDYPSAKLAESAGVDLILVGDSLGMVVLGYDSTIPVTMEDMLHHSK
PANB_CAMJD      MRKSILSFLEK-KGKNEKITMVSAYDYHSAKILDNCDIDIILVGDSLAMIVLGMQDTLSVTMDEMLIFTK
PANB_SYNAS      ----TTSVIRGMKKKGEKITMLTAYDYAMASLLDEVGVEMLLVGDSLGMVVLGYESTLPVTMNDMLHHTR
PANB2_BRAJA     LERVTIPALQQWKDKGRRVVMTTAYDAVAARI-ADPIVDIILVGDSVGNVCLGFDNTLPVSVAMMNHHLE
PANB_HERA2      ---TQLSDIQRMKDRGERLVMVTAYDYTSAQLVDRTDIPLILVGDSLGMVIQGNSSTVPVTIDEMVYHTK
PANB_THEFY      ----TVQDLAAAKERGERWPMLTAYDALTARIFDEAGIPVLLVGDSAAMVVFGYDSTIPVTLDDMIPLTA
PANB_DESAH      MQPVTTTTLFKMKQEGKRITALTAYDHPFATLVDAAGIDIILVGDSLGMVVQGKQTTLPVTMDEILYHTA
PANB_CALMQ      ---------------KRRIAMITAYDYPTARLVDEAGVDGILVGDSLGMVVLGYESTIPVTLTDMLIHVA
PANB_UNCTG      -------------QSGEKITMLTCYDYVTAKLISSQDIDVLLVGDSLGNVKLGYENTLSVTVDDMIYHTK
PANB_LISW6      ------------KESGEKITMITAYDYPSAKNVEQAAADMILVGDSLGMVVLGYDSTVPVTIDDMIHHTK
PANB_PYRIL      ------------------YVWITAYDYPTAKAVDEAGVDGILVGDSLGMVLLGLPNTLGVTMEDMVRHTE
PANB_GLUDA      ----TLFDVQAMKPAGQRIAMLTAYDHPSAVLAERAGVPMLLVGDSLGMAVHGFDTTLPVTLDDMIRHAR
PANB_DESHD      ------------KNEGKKIVMITAYDYPSAKQAEQAGADIILVGDSLGNVVLGYDSTVYVTMEDMIHHGK
PANB_LISMH      ------------KENGEKITMITAYDYPSAKNVEQAEADMILVGDSLGMVVLGYDSTVPVTMDDMIHHTK
PANB_DESVV      VRPLTTADIRKAKG-RQRLAMLTAYDYTSARIVDGAGADLILVGDSLGMVMLGREDTLSVTLDEMLHHCR
PANB_DESVH      VRPLTTADIRKAKG-RQRLAMLTAYDYTSARIVDGAGADLILVGDSLGMVMLGREDTLSVTLDEMLHHCR
PANB_HYPBU      ----TVRDIVRAKQRGERIVMVTAYDYITAKLVDEAGVDMILVGDSLGMVVLGLPSTHQVTLEDMERHTA
PANB_DESDG      ----------------RRLAMLTAYDYPTASIADEGGMDMLLVGDSLAMVVLGHEDTLSVTLDEMIHHCR
PANB_LISIN      ------------KENGEKITMITAYDYPSAKNVEQAEADMILVGDSLGMVVLGYDSTVPVTMNDMIHHTK
PANB_DESHY      ------------KNEGKKIVMITAYDYPSAKQAEQAGADIILVGDSLGNVVLGYDSTVYVTMEDMIHHGK
PANB_NITMS      ------------KKGKKKVSVITGYDYTLASLCDKAGIDVLLVGDSAGMVMLGYENTIPVTMDQMCMFTE
PANB_LISMF      ------------KENGEKITMITAYDYPSAKNVEQAEADMILVGDSLGMVVLGYDSTVPVTMDDMIHHTK
PANB_LISMC      ------------KENGEKITMITAYDYPSAKNVEQAEADMILVGDSLGMVVLGYDSTVPVTMDDMIHHTK
PANB_SACEN      --------LLELKQRGEAWPMLTSYDMYTARIFDEAGIPVLLVGDSAANNVYGYDTTVPVTVEELIPLVR
PANB_ROSS1      ----TITDIQQMKVRGEPIAMLTAYDATIAALFDAAGVPMLLVGDSLGDNVLGFSSTVPVTIEDMVRHTA
PANB_PYRAR      ------------------YVWVTAYDYPTAKLVDEAGVDGILVGDSLGMVVLGLPNTLGVTLADMVRHTQ
PANB_STAS1      ----TLNQLQDLKVNKEKISMVTAYDYPSAKQVEAADIDIILVGDSLGMTVLGYDSTVQVTVADMIHHTK
PANB_LISMO      ------------KENGEKITMITAYDYPSAKNVEQAEADMILVGDSLGMVVLGYDSTVPVTIDDMIHHTK
PANB_CLOBM      ----TVSTFQELKNKGEKITMLTAYDYSMAKLIDSSGINGILVGDSLGMVCLGYENTLSVTMEDMLHHTK
PANB_TRIEI      MAVTTKQLIQ-WKQKGRPIVALTAYDYTIAQLLDNAGVDLILVGDSLGMVTLGYETTLPVTLEEMIHHAK
PANB_CORJK      -KKVRIADLKARKGTGEPFAMLTAYDYSTAVAFAEAGVEIMLVGDSAANVVFGYDATQRISMDEMVYLTX
PANB_CLOBL      ----TVSTFQELKNKGEKITMLTAYDYSMAKLIDSSGINGILVGDSLGMVCLGYENTLSVTMEDMLHHTK
PANB_CLOBK      ----TVSTFQELKNKGEKITMLTAYDYSMAKLIDSSGINGILVGDSLGMVCLGYENTLSVTMEDMLHHTK
PANB_CLOBJ      ----TVSTFQELKNKGEKITMLTAYDYSMAKLIDSSGINGILVGDSLGMVCLGYENTLSVTMEDMLHHTK
PANB_LYSSC      MKTTTDFLKMKAAGEK--IVMVTAYDYPAAKFAEAANVDMILVGDSLGMVVLGYDSTMPVTVADMIHHAK
PANB_CLOB6      ----TVSTFQELKDRGEKITMLTAYDYSMAKLIDSSGINGILVGDSLGMVCLGYENTLSVTMEDMIHHTK
PANB_STRCO      ----TVRDITAAKERGEKWPMLTAYDAMTASVFDESGIPVMLVGDSAGNCHLGYETTVPVTLDEMTMLSA
PANB_IGNH4      MKKVTIRDIMKKYKNGEKIVMVTAYDYPFAKLVDEAGVDMILVGDSLGMVVLGYPSTNQVTMKDMLHHVA
PANB_LEIXX      ---------QAAKEEGSRFTGLTSYDTLTAQIFDEAGIDFLLVGDSAANTVLGYDTTLPMTVDELIPLTX
PANB_ARTAT      --------LQQAKDNGEHFAMLTAYEQYTAEIFDQAGIEVLLVGDSASNNVYGNETSLPVTVDELLPLTR
PANB_SALRD      MPRVTTKTVQEMKEEGVPIAALTAYDYTSARLLDRAGADVLLVGDSAANVMAGHETTLPMTLDQMIYHAQ
PANB_GRAFK      -KRITVKSLVDMKSNGEKISMLTAYDFTMAQIVDGAGIDVILVGDSASNVMAGHETTLPITLDQMIYHAT
PANB_CARHZ      MDRVTVSSLKEMKEAGQKIAMITAYDYPSA-LFAEEGAEVLLVGDSLGMVVLGYDSTVPVTMEEMLHHVK
PANB_STRAW      ------------KERGEKWPMLTAYDAMTASVFDEAGIPVMLVGDSAGNCHLGYETTVPVTLDEMTMLSA
PANB_SILST      --------------------SLTAYTTPMAQLM-DEHCDFVLVGDSVGMVLHGLPSTLGVTMEMMILHGA
PANB_CHLPB      ----TTRRLLDMKEQGEKIAMLTAYDYTTARILDRSGVDVILVGDSVSNVFSGHNTTLPITIEEMIYHAK
PANB_PROA2      ----TTRRLHDMKSEGEKISMLTAYDYTTARILDRAGVDVILVGDSASNVFAGHNTTLPITIDQMIYHAR
PANB_CHLP8      ------------KERGEKIAVLTAYDYTMARILDRSGVDAILVGDSASNVFSGHNTTLPITVDEMIYHAK
PANB_BORPD      -----------------KVVALTAYTAPMARQL-DPHADLLLVGDSLGMVVYGLPSTLGVTLDMMIAHGA
PANB_ACIAC      -RPVSLPRLAQMREAGEKITMLXXXXXXXXXXXXXXGVECLLVGDSLGMVCQGLPSTVGVSLDTMAYHTA
PANB_SULIN      MKKVTIRDFIKKKSTKEKITMLTAYDYPTAKIISNTGLDSILVGDSLGMVVLGYPNTLNVTMRDMISHTR
PANB_AQUAE      -----LQTLFKKKREGKKITMVSTYDYWSAKLCDEVGIDCILVGDSLGTVVKGEGDTLSVTLEEIIYHTK
PANB_SULIY      MKKVTIRDFIKKKSTKEKITMLTAYDYPTAKIISNTGLDSILVGDSLGMVVLGYANTLNVTMRDMISHTR
PANB_SULIL      MKKVTIRDFIKKKSTKEKITMLTAYDYPTAKIISNTGLDSILVGDSLGMVVLGYANTLNVTMRDMISHTR
PANB_FRATW      ---------KKAKVTQEKISMVTCYDYTLAKIINSTDIDCILVGDSGGMVLLGKKNTTYTTLDDMQFMTQ
PANB_FRATN      ---------KKAKANREKISMVTCYDYTLAKIINSTDIDCILVGDSGGMVLLGKKNTTYTTLDDMQFMTQ
PANB_FRATM      ---------KKAKVTQEKISMVTCYDYTLAKIINSTDIDCILVGDSGGMVLLGKKNTTYTTLDDMQFMTQ
PANB_FRAAA      ----TVRDVAAAKSRGERWSMLTAYDFTTATVFDEAEIPVLLVGDSAANVVYGYDTTVPVTVDELIPLVR
PANB_FRATO      ---------KKAKVTQEKISMVTCYDYTLAKIINSTDIDCILVGDSGGMVLLGKKNTTYTTLDDMQFMTQ
PANB_FRATH      ---------KKAKVTQEKISMVTCYDYTLAKIINSTDIDCILVGDSGGMVLLGKKNTTYTTLDDMQFMTQ
PANB_FRATF      ---------KKAKVTQEKISMVTCYDYTLAKIINSTDIDCILVGDSGGMVLLGKKNTTYTTLDDMQFMTQ
PANB_COXBU      ---------QRMKKDNKKISMVTCYDYWSACIISQSNVDCILVGDSLAMVMYGHSTTLPATVEIMAQHIQ
PANB_COXBN      ---------QRMKKDNKKISMVTCYDYWSACIISQSNVDCILVGDSLAMVMYGHSTTLPATVEIMAQHIQ
PANB_COXB2      ---------QRMKKDNKKISMVTCYDYWSACIISQSNVDCILVGDSLAMVMYGHSTTLPATVEIMAQHIQ
PANB_COXB1      ---------QRMKKDNKKISMVTCYDYWSACIISQSNVDCILVGDSLAMVMYGHSTTLPATVEIMAQHIQ
PANB_CORDI      -RPVRLQDLRDYKKNNRPWAMLTTYDYSTTRAFVDAGIEVFLVGDSAANTMLGYSGTNQVSFEEMVMLTA
PANB_SYNJA      MAALSIHHFRQAKQAGQPLVALTAADYATAQILDRAGIDLILVGDSLAMTSLGHSSTLPLTLEQMIHHAQ
PANB_SULTO      ---------------------LTAYDYPSAKIISQTNLDGILVGDSLGMVVLGKENTLKVTMRDMLIHLD
PANB_THENN      ---------------------VTAYDAPSARIAQDAGIDIILVGDSLGNNVLGYENTIPVTMEEMLIHVA
PANB_PYRAE      ---------------KGPYVWVTAYDYPTAKIVDEAGVDGILVGDSLGMVVLGLPNTLGVTLADMIRHTQ
PANB_ANAD2      -KHVTIHELRRMKESGERIAMVTAYDATXXXXXXXXXXXXXXXXXSLGMAVQGHESTLPVTLDQMVYHSA
PANB_ALKMQ      -KKKSILDLMKMKKAEEQVAWVTAYDFPTASFAEQAGMEMILVGDSLGMVVLGYQGTIPVTMEDCISHCQ
PANB_STAAM      ----TVSLLIDMKQKQTKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHGR
PANB_STAA1      ----TVSLLIDMKQKQTKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHGR
PANB_ANASK      -KHVTIHELRRMKESGERIAMVTAYDATXXXXXXXXXXXXXXXXXSLGMAVQGHESTLPVTLDQMVYHSA
PANB_SULSO      MKKVTIRDFIKKKSMKEKITMLTAYDYPTAKIISNTTLDSILVGDSLGMVVLGYTNTLNVTMRDMISHTR
PANB_PYRCJ      ----------------RKLAMVTAYDYPTARLVDEAGVDGILVGDSLGMVVLGYENTLRVTLRDMXXXXX
PANB_METS5      ------------KKGKEKITMLTVYDYSMAKILSETEVDGFLVGDSLGMNVLGFPSTLQVTMDHMIHHTR
PANB_CYAP4      ----TIPQLQQWKRSGRAIAVLTAWDWLWASLLDQAGVDLILVGDSLAMVALGHKNTLPLSLDEMLHHTR
PANB_FRATT      ----------------EKISMVTCYDYTLAKIINSTDIDCILVGDSGGMVLLGKKNTTYTTLDDMQFMTQ
PANB_FRAT1      ----------------EKISMVTCYDYTLAKIINSTDIDCILVGDSGGMVLLGKKNTTYTTLDDMQFMTQ
PANB_MAGSM      --------LVRMKQQGEPIVALTAYDYTLARXXXXXXXXXXXXXXXXXXXXQGHETTLPVTLDEMIYHTR
PANB_CHLPD      ---TTRKLLDM-KQQGEKISVLTAYDYTMARILDRAGIDVILVGDSASNVFSGHATTLPITIEEMIYHAK
PANB_STAAW      ----TVSQLIDMKQKQTKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHGR
PANB_STAAT      ----TVSQLIDMKQKQTKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHGR
PANB_STAAS      ----TVSQLIDMKQKQTKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHGR
PANB_STAAN      ----TVSQLIDMKQKQTKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHGR
PANB_STAAC      ----TVSQLIDMKQKETKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHGR
PANB_STAAB      ----TVSQLIDMKQKQTKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHGR
PANB_STAA9      ----TVSQLIDMKQKQTKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHGR
PANB_STAA8      ----TVSQLIDMKQKQTKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHGR
PANB_STAA3      ----TVSQLIDMKQKQTKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHGR
PANB_STAA2      ----TVSQLIDMKQKQTKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHGR
PANB_CHLL2      ----TTRRLLDMKEKGEKISVLTAYDFTTARILDRAGVDVILVGDSASNVFSGHNTTLPITIDEMIYHAK
PANB_AGRVS      LTPTTIAALK----HQRPIVSLTAYTTPMARLM-DAHCDLLLVGDSLGMVLYGLDTTVGVTLEMMIAHGQ
PANB_THENV      ------------------YVWITAYDYPTAKAVDEAGVDGILVGDSLGMVLLGLPNTLGVTMEDMVRHTE
PANB_STAAR      ----TVSQLIDMKQKQTKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHGR
PANB_LEPCP      -KPLTLPALRAMQQRGEKIAMLTAYESTLARVADEAGVDTILVGDSLGMVVQGHASTLPVTLDEMAYHTR
PANB_GLOVI      ----SIHSLRKLKERAQPIVALTATEYAMARILDQAGVDLLLVGDSLSMVALGHTSTLPVTVDELLHHCR
PANB_AZOPC      IRKITIQHLIEMKSYCEKISMITAYDYSMASIIDKTGMDIVLVGDSASNVMAGNTTTLPITLDQMIWYAQ
PANB_PELLD      ----TTRRLYDMKQNGEKISVLTAYDYTMARILDRAGIDVILVGDSASNVFSGHNTTLPITVDELIYHAK
PANB_DEIRA      ---------------------VTAYDYPGARHAEAAGVDLILVGDSLGNVVLGYDSTAPVTLADMIHHGK
PANB_STAMF      MKKITIRDILKMKG-KKKIVMVTAYDYPFAKLVDEAGVDIILVGDSAGMVVHGLPSTIPVTMDMMLLHVS
PANB_MESSB      ---------------KAPIVCLTAYTTPIARLL-DPHCDVVLVGDSVGMVMHGLPSTLGVTLDMMIMHGK
PANB_XANP2      --------------------SLTSYHSHTARLL-DRHVDVILVGDSLGMVMHGMETTVPVTVEMMIVHGR
PANB_RHOFD      ------------------------------------GVECILVGDSLGMVCQGLSSTMGVTLQAMCYHAR
PANB_HALHL      ----TVSRMRAMKREGRPLACLTAYDYGFAAACERAGVDLLLIGDSLGMVVQGHETTLPVTVDDMVYHTX
PANB_STAAE      ----TVSQLIDMKQKQTKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESIVQVTLADMIHHGR
PANB_BARQU      ----------RSRKGQEPIVSLTAYQAYSARI-ADPYCDFLLVGDSVGMVVHGFETTLPVSLDMMILHGQ
PANB_ACIF5      -------------QDKKKRAVVTAYDYPFARLAAEAGVHGILVGDSLGMVVGGGSDTLGVTLEQMAYHTG
PANB_ACIF2      -------------QDKKKRAVVTAYDYPFARLAAEAGVHGILVGDSLGMVVGGGSDTLGVTLEQMAYHTG
PANB_STAES      ----TLNHLNKMKASQQKISMVTAYDYPSAKQAQQAEIDMILVGDSLGMTVLGYDSTVQVTLNDMIHHGK
PANB_STAEQ      ----TLNHLNKMKASQQKISMVTAYDYPSAKQAQQAEIDMILVGDSLGMTVLGYDSTVQVTLNDMIHHGK
PANB_WOLSU      MKNITVSSIKKKKNQEK-ITMITAYDALFARLFDGE-VDILLVGDSLAMSFGGEEDTLPIGMDEMIYHTK
PANB_CLOB1      ----TVSTFQELKNKGEKITMLTAYDYSMAKLIDSSGINGILVGDSLGMVCLGYENTLSVTMEDMLHHTK
PANB_BART1      ----------RARKGQQPIVSLTAYQAYTARI-ADPYCDILLVGDSVGMVVYGFETTLPVNLDMMILHGQ
PANB_ARCB4      ---------------------ITAYDALFAKLF-EEIADMILVGDSLNMSFAGRPDTLSATLEQMIYHTN
PANB_PROVI      ----TTRRLLDMKQNGEKIAVLTGYDYTIARILDRAGIDVILVGDSASNVFSGHTTTLPITVDEMIYHAR
PANB_HALMA      ---------------------LTAYDAVTASIVDDTGVDVILVGDSMGNAVLGHDDTLPVTLDEMASRVG
PANB_SYNJB      MAALSIHHFRQAKQAGQPLVALTAADYATAQILDQAGIDLILVGDSLAMTHLGYTSTLPLTLEQMLHHAQ
PANB_STAHJ      -----LAKLVEMKQDKTKISMITAYDFPSAKQAQDANIDMILVGDSLGMTVLGYETTTQVTLEDMIHHGK
PANB_PELPB      ----TTRRLLDMKHNGEKISMLTAYDYTMARILDRAGLDVLLVGDSASNVFAGHSTTLPITIEEMVYHAK
PANB_CHLTE      ------------KERGEKIAMLTAYDYTMARILDRSGVDAILVGDSASNVFAGHSTTLPMTVDEMIYHAK
PANB_ACISJ      -RPVSLPRLAQMREAGEKITMLXXXXXXXXXXXXXXGVECILVGDSLGMVCQGLPSTVGVTLEHMAYHTA
PANB_CYAP8      ----TLPYLIQAKQQGRPLVALTAWDYAIAQLLDGAGVDIILVGDSLAMVALGHRTTLPITLDEMIHHAK
PANB_FRASC      ----TVRDVAAAKNRGEKWSMLTAYDATTAAVFDEAEIPVLLVGDSAANVVYGYDTTVPITVDELLPLVR
PANB_CYTH3      IKKVTTHQLQEMKNRGEKISMLTAYDYSMAKILDAAGVDVILVGDSASNVMAGHETTLPITLDQMIYHAS
PANB_ARTS2      --------LQQAKDKGEHFAMLTAYEQYTAEIFDEAGIEVLLVGDSASNNVFGNETSLPVTVDELLPLCR
PANB_ANAMM      ----------QAKKGLEKIACLTAYTFPMARIL-DEHCDLILVGDSVGQTVYGMESTLSVTLDMMIAHGK
PANB_ANAMF      ----------QAKKGLEKIACLTAYTFPMARIL-DEHCDLILVGDSVGQTVYGMESTLSVTLDIMIAHGK
PANB_STACT      -----LSNLFDMKKNSEKITMVTSYDYPSAKQAEAAEIDTILVGDSLGMTVLGYDSTVQVTLNDMIHHGK
PANB_CAMFF      MKKVTINDLFMMKNREK-IVMITAYDALFARLF-DDYVDMILVGDSLNMSFGGKNETIGLSVDDMIYHTK
PANB_RHOS4      ---------------------LTAYTTPMARL-VDAHCDLTLVGDSLGMVVHGLPTTLGVTMEMMILHGQ
PANB_RHOS1      ---------------------LTAYTTPMARL-VDAHCDLTLVGDSLGMVVHGLPTTLGVTMEMMILHGQ
PANB_NITSB      -KRHTVNTIKSAKNSNK-LVMITAYDALFAKLF-EPIVDMILVGDSLNMVFAGRSDTLSATLDQMIYHAN
PANB_CENSY      ----------------EKITVVACYDYSMAALC--DGADMLLVGDSAGMVVLGYDSTTRVTMDEMCLFTG
PANB_NOCSJ      --------LREMKQRGEKFAMLTAYEQYAAQTFDEAGIEVLLVGDSASNNVFANETSLPVTVDELIPXXX
PANB_VEREI      ------------------------------------GVECILVGDSLGMVCQGLPSTVGVQLDTMAYHSA
PANB_SULIM      -----------------------AYDYPTAKIISNTGLDSILVGDSLGMVVLGYANTLNVTMRDMISHTR
PANB_SULIK      -----------------------AYDYPTAKIISNTGLDSILVGDSLGMVVLGYANTLNVTMRDMISHTR
PANB_SULIA      -----------------------AYDYPTAKIISNTGLDSILVGDSLGMVVLGYANTLNVTMRDMISHTR
PANB_DEIDV      -------------QSEQPLVMVTAYDYPGGLHAEAAGVDMILVGDSLGNVVLGYESTAPVTLSDMIHHSK
PANB_BARHE      ----------RSRKGQEPIVSLTAYQAYSARI-ADPYCDLLLVGDSVGMVVHGFETTLPVSLDMMILHGQ
PANB_SYNP2      --------LQNYKKTARPIVTLTAWDYAIARLVDQAGVDVILVGDSLAMVALGYENTLPVTLEAMIHHTQ
PANB_EMENI      -KKVTMQTLRNLYKKGEPITMLTAHDFPSAHVADAAGMDMILVGDSLAMVALGMQDTSEVTLDDMLVHCR
PANB1_METPP     -KKRTITEIRDSKKSGEKMVYTSVPDYTSAKWAELAGVDVAVVGDSLAMVAHGHSSTVPATMDMMVMHAQ
PANB_DELAS      ------------------------------------GVECILVGDSLGMVCQGLHSTVGVSLQDMCYHTA
PANB_SYNP6      --PITPRHLRQWKQQGRPIVALTAWDFAIASILDEAGIDLVLVGDSLAMVALGHPTTLPLSLEDMIHHVQ
PANB_SYNE7      --PITPRHLRQWKQQGRPIVALTAWDFAIASILDEAGIDLVLVGDSLAMVALGHPTTLPLSLEDMIHHVQ
PANB_SINMW      --------------------SLTAYTTPIARLL-DPHVDFLLVGDSLGMVLYGLDTTVGVTLDMMIAHGQ
PANB_ROSDO      ----------KSRKGGEPIVSLTAYTTPMAQMM-DAHCDIVLVGDSLGMVLHGLPSTLEVTMEMMILHGR
PANB_BARBK      IKRITASEIQ-AKKKQEPIVSLTAYQAYSARI-ADPHCDFLLVGDSVGMIVHGFDTTLPVDVDMMILHGK
PANB_EXIS2      ----TMTPLLKKQQAGEKLVMLTAYDYPSAKLAEAGHVDLLLVGDSLGNVILGYDSTIAVTVDDMVHHAK
PANB1_ZYMMO     ------------------------------------GVDCIMVGDSLGMVCQGRTTTVGVSLEDMLYHTR
PANB_DEIGD      ---------------------VTAYDYPGARHAEAAGVDLILVGDSLGNVVLGYDSTAPVTLDDMIHHAR
PANB_CORGL      ---------REAKVNGQKVSVLTSYDALSARIFDEAGVDMLLVGDSAANVVLGRDTTLSITLDEMIVLAK
PANB_ROSCS      ----TITDIQQMKVRGEPIAMLTAYDAVTAALFDAAGVPMLLVGDSLGDNVLGFGSTIPVTIDDMVRHTA
PANB_RHOP5      ---------------------LTSYHAHTAAL-VDRYCDVILVGDSLGNVMHGFETTVPVTLDMMILQGR
PANB_RHIME      LSPASIEALKG----ERPIVSLTAYTTPIARLL-DPHVDFLLVGDSLGMVLYGLDTTVGVTLDMMIAHGQ
PANB_LEGPH      ------------KQEQKKISMLTCYDYPSACIVAESNIDCVLVGDSVAMAVHGHPTTIMATIEMMELHTQ
PANB_CORGB      ---------REAKVNGQKVSVLTSYDALSARIFDEAGVDMLLVGDSAANVVLGRDTTLSITLDEMIVLAK
PANB_PARDP      ---------------------LTAYTTPMARL-VDAHCDIALVGDSLGMVLHGLPSTIGVSMEMMILHGK
PANB_RHOP2      ---------------------LTSYHAHTASL-VDRYCDVILVGDSLGNVMHGFETTIPVTLEMMILQGH
PANB_METRJ      ----------KRKAEGRKIIALTAYHAHTAGI-VDPYCDFILVGDSLGMVMHGMESTIPVTLEMMILQAQ
PANB_LEGPA      ------------KQEQKKISMLTCYDYPSACIVAESNIDCVLVGDSVAMAVHGHPTTIMATIEMMELHTQ
PANB_CHLCH      ----TTRRLLDMKQQGEKISMLTAYDYTMARILDRAGVDVLLVGDSASNVFSGHSTTLPITIEEMIYHAK
PANB1_BURS3     --------------------SLTAYSAPMAKL-VDEVADVIIVGDSVGMVLYGMPDTLRVTLDMMIAHGA
PANB_RHOPB      ---------------------LTSYHAHTAAL-VDRYCDVILVGDSLGNVMHGFETTVPVTLDMMILQGR
PANB_RHISN      LSPASIEALKG----ERPIVSLTAYTTPIARLL-DPHVDFLLVGDSLGMVLYGLDTTVGVTLDMMIAHGQ
PANB_HELAH      -KKITLNHLQAKKNHEKIIA-ITAYDALFAQMF-DPIVDVILVGDSLNMSFFNQNDTLSASLEMMLYHTK
PANB_RHOCS      ------------RKGREPVAVLTAYTVSMARLL-DPHVEVLLVGDSLGMVLYGFDSTLPVTLDMMIAHGA
PANB_LEGPC      ------------KQEQKKISMLTCYDYPSACIIANSNIHCVLVGDSVAMAVHGHPTTIMATIEMMELHTQ
PANB_ANADF      ---------------------------------------------------QGHESTLPVTLEHMIYHSA
PANB1_HAHCH     -KRITIPQIRSMKG-KGSIVSLTAYTTPMAQMM-DEFVDLIIVGDSTGMVAYGFNSTMSVTLDMMINHGA
PANB_RHOPS      ---------------------LTSYHAHTASL-VDRYCDVILVGDSLGNVMHGFETTVPVTLEMMILQGH
PANB_LEGPL      ------------KQEQKKISMLTCYDYPSACIVAESNIDCVLVGDSVAMAVHGYPTTIMATIEMMELHTQ
PANB_CAMC5      -KKLTVNDIKNKKIKGEPIVMMTAYDALFAKIFNDYA-DIILVGDSLNMSFHLKKETISATMEMMLYHTN
PANB_RHOPT      ---------------------LTSYHAHTASL-VDRYCDAILVGDSLGNVMHGFETTVPVTLEMMILQGH
PANB_PYRKO      ---------------KEKIAMVTAYDYPSALLADKAGMDIVFVGDSLGMVVYGEPNTLNVSMEQMVFHTX
PANB_BACTN      -RKVTTHRLVEMKQRGERISMLTSYDYTMAQIVDGAGMDVILVGDSASNVMAGNVTTLPITLDQMIYHAK
PANB_SULAC      ------------KKGKEKITMLTAYDYPTAKIMSMTNLDGILVGDSLSMVVLGYENTLKVSMKEMLVHLD
PANB_RHOPA      ---------------------LTSYHAHTASL-VDRYCDAILVGDSLGNVMHGFETTVPVTLEMMILQGH
PANB_HELHP      ----------KAKKGIEKITAITAYDALMARIFDGE-VDVILVGDSLKMSFGGENETLGASMQEMIYHTK
PANB_ACIBL      -KVTSSTLLDK-KSKHDPITCLTAYDYSTARLVDEAGIDMILVGDSLAQTMLGYENTLPVTMDEMLXXXX
PANB1_PSEAE     ---------------------LTAYSTPMARLL-DPHADLLLVGDSLGMVLYGMPSTLGVSLEMMVAHTL
PANB1_PSEAB     ---------------------LTAYSTPMARLL-DPHADLLLVGDSLGMVLYGMPSTLGVSLEMMVAHTL
PANB_SYNY3      ------------KRQQRPIVALTAWDTAIASVLDAAGVEIILVGDSLGMVALGYETTLPVSLDTMIHHTA
PANB_SULDN      ---------------------ITAYDALFARLL-EPSADMILVGDSLNMSFAGRDDTLSATLSQMIYHTN
PANB_ANAVT      --PVTTQQLIQWKQQGRSIVALTAWDYTIAQILDAAGVDLILVGDSMAVML-GYKTTLPITLEEMLHHAK
PANB_POLSJ      -KPLSLPRLREMHAQGEKITMLXXXXXXXXXXXXXXGVECILVGDSLGMVCQGLTSTVGVTLETMRHHTE
PANB_OLICO      ---------------------LTSYHAHTAAL-VDKYCDIILVGDSLGNVMHGFETTVPVTLEMMILQGH
PANB_METPB      --------LIKRKAEGRKIIALTAYHAHTANI-VDSYCDFVLVGDSLGMVMHGMESTLPVTLEMMILQAQ
PANB_NITHX      ---------------------LTSYHAHTAAL-VDRHCDVILVGDSLGNVMHGFETTVPVTLDMMILQGR
PANB_ANASP      --PVTTQQLIQWKQQGRSIVALTAWDYTIAQILDGAGVDLILVGDSMAVML-GYKTTLPITLEEMLHHAK
PANB2_BURCH     --------------------SLTAYSAPMAKL-VDEVADVIIVGDSVGMVLYGMPDTLRVTLDMMIAHGA
PANB_POLNA      -KPLSLPRLREMHAHGEKITMLXXXXXXXXXXXXXXGVECILVGDSLGMVCQGLSSTVGVTLETMRYHTE
PANB_NOVAD      MKRLTIPAIRQRKKDAQPVVMLTAYTARQAQLL-DAHCDLLLVGDSLGQVIYGLPSSVPVTLDMMAAHGA
PANB_THEEB      -RSVTLPQLQAKKALGEPITMLTAWDYLWARLLDAAGVDVILVGDSLGMVALGYPTTLPVTLDQMIHHAQ
PANB_COREF      --------IHEAKANGTKISVLTSYDAMTAAIFDEAGIDMLLVGDSAANVVLGRETTLSITLDEMIVLAK
PANB_AERPE      ---------------------VTAYDYPTAWIADEAGVDVILVGDSLGMVVLGYPSTLQVTLDDMVRHTA
PANB_ANADE      -KHVNIHELRRMKEAGERIAMVXXXXXXXXXXXXXXXXXXXXXXDSLGMAVQGHESTLPVTLDQMVYHSA
PANB_SILPO      --------------------SLTAYTTPMARLM-DGHCDFVLVGDSVGMVLHGLNSTLGVTMEMMILHGQ
PANB_RHOS5      ---------------------LTAYTTPMARL-VDAHCDITLVGDSLGMVVHGLPTTLGVTMEMMILHGK
PANB_CAMC1      ----------KNKKGAEPIVMITAYDALFAKIF-DDYADVILVGDSLNMSFNMKESTLSADMSTMLYHTK
PANB_TROW8      ----------------RKLVGLTCYDFSTARVLSDCELDFLLVGDSASGVIYGYENTGSVCLDEIIYLAA
PANB_PYRFU      ---------------KEKITMITAYDYPSALLADKAGFDIVFVGDSLGMVVYGEQNTLNVTMDQMIFHTX
PANB_NITWN      ---------------------LTSYHAHTAAL-VDRYCDVILVGDSLGNVMHGFETTVPVTLDMMILQGR
PANB_ACAM1      ----TIHQLRTWKEQGRPISVLTAWDFPFATLLDQAGVDVLLVGDSLAMVALGYPTTLPLTLDEMLYHAQ
PANB_METEP      --------LIKRKAEGRKIISLTAYHAHTAGI-VDAYCDFVLVGDSLGMVMHGMESTLPVTLEMMILQAQ
PANB_METC4      --------LIKRKAEGRKIISLTAYHAHTAGI-VDAYCDFVLVGDSLGMVMHGMESTLPVTLEMMILQAQ
PANB_BORPE      ---------------------LTAYTAPIAGLL-DAHCDLLLVGDSLGMVIYGMETTLPVTVDMMIQHGR
PANB_BORPA      ---------------------LTAYTAPIAGLL-DAHCDLLLVGDSLGMVIYGMETTLPVTVDMMIQHGR
PANB_BORBR      ---------------------LTAYTAPIAGLL-DAHCDLLLVGDSLGMVIYGMETTLPVTVDMMIQHGR
PANB_SPHAL      MKRLTVPRIRQRKGGEP-IVMLTAYTVRMAQLL-DPHCDMLLVGDSLAQVIYGLPHTVGVTMEMMALHGA
PANB_PYRHO      ---------------KEKITMITAYDYPSALLADKAGFDIVFIGDSLGMVVYGEPSTLNVTMEQMIFHTX
PANB_PYRAB      ---------------KEKIAMITAYDYPSALLADKAGFDIVFVGDSLGMVVYGEPNTLNVSMEQMVFHTX
PANB_OCEIH      ----------RMKHEGEKISMLTAYDYPSAKQAEAAEIDMILVGDSLGMTVLGYESTVDVTLDDMKHHAR
PANB_BACV8      -RKVTTHRLVEMKQRGEKISMLTSYDYTTAQIVDGAGIDVILVGDSASNVMAGNVTTLPITLDQMIYHGK
PANB3_BRAJA     ---------------------LTSYHAHTAAL-VDRHCDAILVGDSLGNVMHGFETTVPVTLEMMILQGC
PANB_MARMM      ---------------------LTAYDAPMARIL-DPHCDLLLVGDSVGMVVHGLDSTVGVTLDMMILHGQ
PANB_BRUSU      -KRLTPKVIQAMKGECP-IVSLTAYTTPVARLL-DPHCDLLLVGDSLGMVLYGMESTLAVTLDMMIMHGQ
PANB_BRUME      -KRLTPKVIQAMKGECP-IVSLTAYTTPVARLL-DPHCDLLLVGDSLGMVLYGMESTLAVTLDMMIMHGQ
PANB_BRUMB      -KRLTPKVIQAMKGECP-IVSLTAYTTPVARLL-DPHCDLLLVGDSLGMVLYGMESTLAVTLDMMIMHGQ
PANB_BRUC2      -KRLTPKVIQAMKGECP-IVSLTAYTTPVARLL-DPHCDLLLVGDSLGMVLYGMESTLAVTLDMMIMHGQ
PANB_BRUAB      -KRLTPKVIQAMKGECP-IVSLTAYTTPVARLL-DPHCDLLLVGDSLGMVLYGMESTLAVTLDMMIMHGQ
PANB_BRUA2      -KRLTPKVIQAMKGECP-IVSLTAYTTPVARLL-DPHCDLLLVGDSLGMVLYGMESTLAVTLDMMIMHGQ
PANB_BRUA1      -KRLTPKVIQAMKGECP-IVSLTAYTTPVARLL-DPHCDLLLVGDSLGMVLYGMESTLAVTLDMMIMHGQ
PANB_RHIL3      ----------------KPIVCLTAYTTPMARLL-DEHCDLLLVGDSLGMVLYGMETTIGVTLDMMIAHGK
PANB_BRUSI      -KRLTPKVIQAMKGECP-IVSLTAYTTPVARLL-DPHCDLLLVGDSLGMVLYGMESTLAVTLDMMIMHGQ
PANB_AGRT5      ---TTASIRQM--KGEARIVCLTAYTTPIARLL-DPHCDLLLVGDSLGMVLYGMETTVGVTLDMMIAHGR
PANB_RHOBA      ----TTRTLQRMRDRGERITMLTAYDFPTAKILDEAXXXXXXXXXXXXXXXQGHSTTLPVTMDQMIYHAE
PANB1_PSEF5     ---------------RQKIVSLTAYTSHMARLM-DPFVDFILIGDSTAMVGYGRTSTLDMSLAEIIAHTR
PANB_NATPD      ----------RAKAGDEPITMLTAYDAPTAEIAEAAXXXXXXXXXXXXNTRLGYDSTLPVTVDEMASHTA
PANB2_ZYMMO     ----------RARKGKSPIVALTAYSALTAR-FVDPYADFILVGDSLAMVEHGMATTIGASLDMMILHGQ
PANB_ERYLH      MKRLTVPKIRARKKDGKTLVMLTAYTARQAQLL-DAHCDLLLVGDSLGQVIYGLPSTIPVTLRMMADHAA
PANB_PARD8      -KVTTHRLIEM-KQRGEKISMLTAYDYSMAKLIDQAGMDVILVGDSASNVMAGNVTTLPITLDQMIYHGK
PANB_ACIC1      ----TIHDLQLRKRQHRRWAMLTCYDALTARIFEEAGIDVLLVGDSAANTVLGYPDTLGVDVDELLILNX
PANB_GRABC      ---------------------LTAYTAPMAG-HLDPHVDVLLVGDSLGMVIYGFETTLPVTLEMMIAHAA
PANB_AGRRK      --------------------SLTAYTTPIARLL-DPHCDLLLVGDSLGMVLYGMESTVGVTLEMMIAHGQ
PANB_METS4      -------MLQAWRAEGRRIVMVTAYDAAMARL-VDPVVDVILVGDSVGNVCLGFDNTLPVSLAMMNHHVE
PANB1_PSEE4     ---------------RQKIAALTAYSTPIARLI-DPLVDFILVGDSTAMVAYGRPSTLAMRLDETISHTR
PANB_TROWT      ----------------RKLVGLTCYDFSTARVLSDCELDFLLVGDSASGVIYGYENTGSVCLDEIIYLAA
PANB_YEAST      ----------------------TAYDFITATWVNKANCDLLLVGDSLAMTSLGYDSTITLSLNEFKYHVA
PANB_SYNR3      --------LRQRKQRRQPIAVLTAWDALSASWAEAAGVDLVLVGDSLAMVALGHATTLPVTLEAMVQHTA
PANB_RHORT      ---------------------LTAYTAPMARLL-DPHVDLLLVGDSLGMVIYGLPTTHGVTVEMMIAHGQ
PANB_MAGSA      ----------RARKGAEPLVVLTAYTAPIARLL-DPICDILLVGDSLGMVVYGMETTLAVTLEMMINHGX
PANB_PARL1      ----------RARKGAEPIVSLTAYHAHTAR-YIDPYVDFLLVGDSLGMVMYGMETTLGVTLDMMIAHGA
PANB_HELP2      IKKTTLNHLQAKKNQEKIIA-ITAYDALFAQIF-DPLVDVILVGDSLNMSFFNQNDTLSASVEMMLYHTK
PANB_BACFR      -KVTTHRLIEM-KQRGEKISMLTSYDYTMAQIVDGAGIDVILVGDSASNVMAGNVTTLPITLDQMIYHGK
PANB_BACFN      -KVTTHRLIEM-KQRGEKISMLTSYDYTMAQIVDGAGIDVILVGDSASNVMAGNVTTLPITLDQMIYHGK
PANB_RHILO      ---------------------LTAYTYPVARLL-DPHVDLLLVGDSVSMVLHGHATTLGASLGMMIAHGQ
PANB_PROMT      --------LVRFKKLGKQISVLTAWDAISSSIVEAAGADVVLVGDSLGMVVLGHSTTLPVTLDQMLHHTK
PANB_HELPG      IKKTTLNHLQAKKNQEKIIA-ITAYDALFAQIF-DPLVDVILVGDSLNMSFFNQNDTLSASVEMMLYHTK
PANB_RHIEC      ----------------KPIVCLTAYTTPMARLL-DDHCDLLLVGDSLGMVLYGMETTIGVTLDMMIAHGK
PANB_HELPJ      IKKITLSHLQAKKNQEKIIA-ITAYDALFAQIF-DPLVDVILVGDSLNMSFFNQNDTLSASVKMMLYHTK
PANB_PROM1      --------LVRFKKLGKQITVLTAWDAISSSIVEAAGADVVLVGDSLGMVVLGHSTTLPVTLDQMLHHTK
PANB_HELPY      IKKITLNHLQAKKNQEKIIA-ITAYDALFAQIF-DPLVDVILVGDSLNMSFFNQNDTLSASVEMMLYHTK
PANB_HYPNA      ---------------------LTAYDAPTAAIL-DPHCDILLVGDSLGMVVHGLPSTVGVTMEMMILHGQ
PANB_PORGI      -KVTTHRLIEM-KSRGEKISMLTAYDYSMAKLVDEAGMDVILVGDSASNVMAGNVTTLPITLDQMIYHGK
PANB_PORG3      -KVTTHRLIEM-KSRGEKISMLTAYDYSMAKLVDEAGMDVILVGDSASNVMAGNVTTLPITLDQMIYHGK
PANB_HELPH      IKKITLNHLQAKKNQEKIIA-ITAYDALFAQIF-DPLVDVILVGDSLNMSFFNQNDTLSASVKMMLYHTK
PANB_FLAJ1      ---TTKSLIEM-KSNGEKISMLTAYDYTMAKIVDTAGVDVILVGDSASNVMAGHETTLPITLDQMIYHAS
PANB2_BURCM     --------------------SLTAYSAPMAKLVHDVA-DVIIVGDSVGMVLYGMPDTLRVTLDMMIAHGA
PANB_HELPS      IKKITLNHLQAKKNQEKIIA-ITAYDALFAQIF-DPLVDVILVGDSLNMSFFNQNDTLNASVGMMLYHTK
PANB_SYNS3      --------LIRFKQSGRAITMLTAWDALSAALVEEAGADVVLVGDSLAMVVLGHATTLPVTLEHMLHHTQ
PANB_PROMA      --------LVRFKELGNQITILTAWDSLSSAIVEAAGADVVLVGDSLAMFIHGHTTTLPVTLEQMLHHTQ
PANB_PHEZH      ---------------------LTAYTAPVAELL-DEHCDLLLVGDSVGMVVHGLPNTVGVTLDMMILHGQ
PANB_CAUCR      -------------------------------------------GDSVGMVVHGLPNTVGVTMEMMILHGQ
PANB_CAUCN      -------------------------------------------GDSVGMVVHGLPNTVGVTMEMMILHGQ
PANB_SYNS9      --------LIRFKQSGRPITMLTAWDCLSAALVEAAGADVVLVGDSLGMVALGHATTLPVTLDQMLHHTL
PANB_PROMP      ------SELVKYKKKSQKIIALTAWDSISGSLAEHSGADIVLVGDSLAMVCLGYKSTLPVTLENMIYHTN
PANB_PROM5      ------SELVKYKKNSQKIIALTAWDSISGSLAEQSGADIVLVGDSLAMVCLGYKSTLPVTLENMIYHTN
PANB_PROM0      ------------KKKSRKIIALTAWDSISGSIAEQANVDLVLVGDSLAMVCLGYQSTLPITLENIIYHTN
PANB1_BRAJA     ----TIPLLQRWKQDGRRLVMTTAYD-AVAAPIPDPSIDISLVGDSGGNVCLGFENTPPVSVAMMNHHLE
PANB_PROM9      --------LVKYKEQSQKIIALTAWDSISGSIAEQANVDLVLVGDSLAMVCLGYKSTLPLTLENIIYHTN
PANB_PROMS      ------------KKKSRKIIALTAWDSISGSIAEQANVDLVLVGDSLAMVCLGYKSTLPLTLENIIYHTN
PANB_PROMM      MRPSELTQL---KQDGRAISILTAWDGISAALVEAAGADVVLVGDSLAMVALCHATTLPVTVEQMLHHTK
PANB_PROM3      MRPSELTQL---KQDGRAISILTAWDGLSAALVEAAGADVVLVGDSLAMVALCHATTLPVTVEQMLHHTQ
PANB_PROM2      --------LVKYKKNSQKIIALTAWDSISGSIAEQANVDLVLVGDSLAMVCLGYKSTLPLTLGNIIYHTN
PANB_SYNSC      --------LTRFKQKGQPIAVLTXXXXXXXXXXXXXXXXXXXIGDSLAMVALGHATTLPVSLDQMLHHTQ
PANB_HALSA      -------------EETDPVTMLTAYDAPTASVVDDAGVDMILVGDSVGNAKLGYDTTLPVSVDEIXXXXX
PANB_HALS3      -------------EETDPVTMLTAYDAPTASVVDDAGVDMILVGDSVGNAKLGYDTTLPVSVDEIXXXXX
PANB_SYNPX      ------------KQNGRTITILTAWDXXXXXXXXXXXXXXXXXXXXLAMVALGHATTLPVTLDQMRHHTL
PANB_PELUB      -------------------------------------------------------STKKVTLDMMIEHSK


                         .         .         *         .         .         .         .:140
query           AVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PANB_SALTY      AVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PANB_SALPK      AVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PANB_SALPA      AVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PANB_SALNS      AVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PANB_SALHS      AVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PANB_SALG2      AVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PANB_SALEP      AVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PANB_SALDC      AVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PANB_SALPC      AVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PANB_SALCH      AVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PANB_SALA4      AVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PANB_SALTI      AVRRGAPNCLLLSDLPFMAYATPEQAFENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PANB_CITK8      AVRRGAPNCLLLSDLPFMAYATPEQAFENAAVVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PANB_ENT38      AVRRGAPHCLLLSDLPFMAYATPEQAFENAAAVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PANB_KLEP3      AVRRGAPNSLLLADLPFMAYATPEQTFENAAIVMRAGANMVKLEGGAWLADTVKMLAERAVPVCGHLGLT
PANB_ECOSE      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLT
PANB_ECOHS      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLT
PANB_ECO55      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLT
PANB_ECO24      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLT
PANB_ECO8A      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLT
PANB_SALAR      AVRRGAPNCLLLSDLPFMAYATPEQAFANAATMMRAGANMVKIEGGAWLVDTVKMLTERAVPVCAHLGLT
PANB_ECOL5      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLT
PANB_ECO81      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLT
PANB_SHIBS      SVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLT
PANB_SHIB3      SVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLT
PANB_KLEP7      AVRRGAPNSLLLADLPFMAYATPEQTFANAAIVMRAGANMVKLEGGAWLADTVRMLAERAVPVCGHLGLT
PANB_ECOLI      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLT
PANB_ECOLC      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLT
PANB_ECODH      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLT
PANB_ECOBW      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLT
PANB_SHISS      SVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLT
PANB_ESCF3      AVRRGAPNCLLLADLPFMAYSTPEQAFENAATVMRAGANMVKIEGGAWLVETVRMLTERAVPVCGHLGLT
PANB_ECOUT      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLT
PANB_ECOSM      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLT
PANB_ECOL6      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLT
PANB_ECOK1      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLT
PANB_ECO7I      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLT
PANB_ECO45      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLT
PANB_ECO5E      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLT
PANB_ECO57      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLT
PANB_ECOLU      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLT
PANB_ECO27      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLT
PANB_SHIFL      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLT
PANB_SHIF8      AVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLT
PANB_SHIDS      AVRRGAPNGLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLT
PANB_ENTS8      AVRRGAPHCLLLADLPFMAYATPEQAFENSAAVMRAGANMVKIEGGQWLADTVRMLTERAVPVCGHLGLT
PANB_YERE8      AVRRGAPHCLLLADMPFMSYATPEQTFANAAELMRAGANMVKLEGGSWLCDTVRMLAERAVPVCGHLGLT
PANB_YERPY      AVRRGAPHCLLLADMPFMSYATPELAFTHAAELMRAGANMVKLEGGSWLCDTIRMLAERAVPVCGHLGLT
PANB_YERPS      AVRRGAPHCLLLADMPFMSYATPELAFTHAAELMRAGANMVKLEGGSWLCDTIRMLAERAVPVCGHLGLT
PANB_YERPB      AVRRGAPHCLLLADMPFMSYATPELAFTHAAELMRAGANMVKLEGGSWLCDTIRMLAERAVPVCGHLGLT
PANB_YERP3      AVRRGAPHCLLLADMPFMSYATPELAFTHAAELMRAGANMVKLEGGSWLCDTIRMLAERAVPVCGHLGLT
PANB_ERWCT      CVRRGAPLALVLSDMPFMTYATPEQTFSQAAELMRAGANMVKLEGGSWLAPTVKMLTERAVPVCGHLGLT
PANB_YERPP      AVRRGAPHCLLLADMPFMSYATPELAFTHAAELMRAGANMVKLEGGSWLCDTIRMLAERAVPVCGHLGLT
PANB_YERPN      AVRRGAPHCLLLADMPFMSYATPELAFTHAAELMRAGANMVKLEGGSWLCDTIRMLAERAVPVCGHLGLT
PANB_YERPG      AVRRGAPHCLLLADMPFMSYATPELAFTHAAELMRAGANMVKLEGGSWLCDTIRMLAERAVPVCGHLGLT
PANB_YERPE      AVRRGAPHCLLLADMPFMSYATPELAFTHAAELMRAGANMVKLEGGSWLCDTIRMLAERAVPVCGHLGLT
PANB_YERPA      AVRRGAPHCLLLADMPFMSYATPELAFTHAAELMRAGANMVKLEGGSWLCDTIRMLAERAVPVCGHLGLT
PANB_PECCP      CVRRGAPLALVLSDMPFMTYATPEQTFSQAAELMRAGANMVKLEGGSWLAPTVKMLTERAVPVCGHLGLT
PANB_ERWT9      VVRRGXXXXXXXXXXXFMSYATPEQTFDSAARLMRAGANMVKLEGGKWLAETVKQLTERAVPVCGHLGLT
PANB_VIBHB      SVRAGSPNCLLMADMPFMSYATPEQACENAATLMRAGANMVKIEGGDWLVDTVKMLTERAVPVCAHLGLT
PANB_EDWI9      AVRAGAPACLLMADMPFMSYATPELACTNAAELMRAGANLVKMEGGAWLCDSVRMLTERAVPVCGHLGLM
PANB_VIBSL      SVRAGSPNCLLMADMPFMSYATPEQACENAATLMRAGANMVKIEGGSWLIETVKMLTERAVPVCAHLGLT
PANB_SODGM      CVRRGAPSCLLLADLPFMSYATPAQTFENAAALMRAGANMVKLEGGAWLADTVNGLTARAVPVCGHLGLT
PANB_PROMH      CVRAGAPNAFLIADMPFMSYSTPEQACLNAAILMQAGANMVKIEGGSWLIPTVKMLTERAVPVCIHLGLT
PANB_VIBVY      CVRAGSPNCLLMADMPFMSYATPEQACENAAQLMRAGANMVKIEGGDWLVDTVKMLTERAVPVCAHLGLT
PANB_VIBVU      CVRAGSPNCLLMADMPFMSYATPEQACENAAQLMRAGANMVKIEGGDWLVDTVKMLTERAVPVCAHLGLT
PANB_VIBPA      CVRAGSPNCLLMADMPFMSYATPEQACENAAKLMRAGANMVKIEGGDWLVDTVKMLTERAVPVCAHLGLT
PANB_PHOLL      CVRAGTPYTFIIADMPFMSYATPEQSCENAAKLMRAGANMVKLEGGSWLYDTINMLTERSVPVCAHLGLT
PANB_VIBCM      CVRKGSPNCLLMADMPFMSYATPEQACENAAKLVRAGANMVKIEGGDWLVDTVKMLTERAVPVCAHLGLT
PANB_VIBCH      CVRKGSPNCLLMADMPFMSYATPEQACENAAKLVRAGANMVKIEGGDWLVDTVKMLTERAVPVCAHLGLT
PANB_VIBC3      CVRKGSPNCLLMADMPFMSYATPEQACENAAKLVRAGANMVKIEGGDWLVDTVKMLTERAVPVCAHLGLT
PANB1_VIBF1     CVRAGSPNSLLMADMPFMSYATPEQACENAGKLMQAGANMVKIEGGEWIAETVRVLAERAVPVCAHLGLT
PANB_PHOPR      CVRAGSPNTLLMADMPFMSYSTPEQACESAAELMRAGANMVKLEGGAWLAETITKLTERAVPVCAHLGLT
PANB_SCHPO      SVRRGAPNRLLMADLPFMSYSTWEDACKNAATVMRAGANIVKIEGGGWIFEIVQRLTERSVPVAGHLGLT
PANB_ALISL      CVRAGSPNSLLMADMPFMSYATPEQACQNAAKLMQAGANMVKIEGGEWIAETIKLLAERAVPVCAHLGLT
PANB_VIBFM      CVRAGSPNSLVMADMPFMSYATPEQACENAGKLMQAGANMVKIEGGEWIAETVRILAERAVPVCAHLGLT
PANB_SHELP      CVRRGIKRSLLIADMPFMSYATPEQAMTNATALMQAGANMVKLEGGHWLLETVTKLTERGIPVCAHLGLT
PANB_SHEPW      CVRRGVERALLIADMPFMSYATPEQTMTNATTLMQAGANMVKVEGGHWLLESVKMLTERGIPVCAHLGLT
PANB_SHEFN      CVKRGVARALLIADMPFMSYSTPEQTMNNAAILMQAGASMVKLEGGHWLLESVKMLTERGIPVCAHLGLT
PANB_SHEPA      CVRRGIERALLIADMPFMSYATPEQTMINATTLMQAGANMVKVEGGKWLLESVAMLTERGIPVCAHLGLT
PANB_SHEON      CVRRGIERSLLIADMPFMSYATPEQAMENATTLMQAGANMVKLEGGHWLLETVTKLTERGIPVCAHLGLT
PANB_SHESM      CVRRGIERSLLIADMPFMSYATPEQAMENATALMQAGANMVKLEGGHWLLETVTKLTERGIPVCAHLGLT
PANB_PSYIN      AVVSTAKSAFIIADLPFMSYSTPEMSYENAAILMRAGANMVKMEGGEWLTDSVKGLVERGIPVCGHLGLT
PANB_AERS4      CVARGASNALIIADMPFMSYATPEQTYQTAARLMAAGARMVKMEGGDWLCDSIRHLTRNGVPVCGHLGLT
PANB_SHESR      CVRRGIERSLLIADMPFMSYATPEQAMENATALMQAGANMVKLEGGHWLLETVTKLTERGIPVCAHLGLT
PANB_SHESA      CVRRGIERSLLIADMPFMSYATPEQAMENATALMQAGANMVKLEGGHWLLETVTKLTERGIPVCAHLGLT
PANB_SHEWM      CVRRGIKRSLLISDMPFMSYATPEQAMRNATALMQAGANMVKVEGGHWLLETVTMLTERGIPVCAHLGLT
PANB_ALTMD      SVRRGTERAFVLADMPFMSYATPEQTYANAAKLMAAGASMVKMEGGSWLCDTIKGLNLRGVPVCGHLGLT
PANB_AERHH      CVVRGTTNALVVTDMPFMSYATPEQTYQNAARLMAAGARMVKMEGGDWLCDSIRHLTRNGVPVCGHLGLT
PANB_SHESW      CVRRGIERALLIADMPFMSYATPEQAMINATELMQAGANMVKVEGGHWLLETVTKLTERGIPVCAHLGLT
PANB_SHEPC      CVRRGIERALLIADMPFMSYATPEQAMINATELMQAGANMVKVEGGHWLLETVTKLTERGIPVCAHLGLT
PANB_SHEHH      CVRRGIEHSLLIADMPFMSYATPEQTMVNATTLMQAGASMVKVEGGHWLLESVAMLTERGIPVCAHLGLT
PANB_SHESH      CVRRGIKRSLLIADMPFMSYATSEQAMTNATALMQAGANMVKLEGGHWLLDTISKLTERGIPVCAHLGLT
PANB_PSEHT      CVRAGSRELFVIADMPFMTYSSPNDTCKNAAELMRAGANMVKLEGGEWLFESIEALTQQGIPVCGHLGLT
PANB_PSEA6      AVRKGVERAFVIADMPFMSYSTPEQTYLNAAKLMAAGASMVKLEGGRWLLESIQGLNERGVPVCGHLGLT
PANB2_VIBF1     CVRAGSPNAFIISDLPFMSYHTPEAACGSAAKLMKAGANMVKIEGGSWLINTVKMLTERAVPVCAHLGLM
PANB_BUCAT      AVRKGAPNTFLISDLPFMSYYDTKQALKNTAKIIRSGANMIKMEGGKWLIEIVRELSNRLILICGHIGLI
PANB_BUCAI      AVRKGAPNTFLISDLPFMSYYDTKQALKNTAKIIRSGANMIKMEGGKWLIEIIRELSNRLILICGHIGLI
PANB_BUCA5      AVRKGAPNTFLISDLPFMSYYDTKQALKNTAKIIRSGANMIKMEGGKWLIEIIRELSNRLILICGHIGLI
PANB_SHEDO      CVRRGISRALLIADMPFMSYATPEQAMTNATTLMQAGANMVKLEGGHWLLETVTMLTQRGIPVCGHLGLT
PANB_TOLAT      NVARGVQNALLIADLPFMSYSDVHSACINAGRLMAAGAKMVKIEGGDWLCDTVKQLNRNGIPVCAHLGLT
PANB_BAUCH      CVRRGAPYCLLIADLPFMCYATLYQAYDNAAALMRAGANIVKLEGGCWVTKIVRCLTDRAVPVCCHLGLT
PANB_BUCAP      AVRRGAPNSFLLSDLPFMSYYSIEETLKNTAKIIQSGANMIKIEGGKWLVETVKELSKRSILVCGHIGLT
PANB_MARMS      AVKRGNTNAFILADMSFMSYSKPEQALDNAAKLMQAGANMVKLEGGSWLADTIKLLSQRGIPVCAHLGLT
PANB_IDILO      CVRRGASNAFVIADMPFMTYSTPEQAYDVAAALMQAGANMVKLEGGHWLVETIEGLKTRGIPVCAHLGLL
PANB_SHEAM      CVRRGISRALLIADLPFMSYATVEXXXXXXXXXXXXXXNMVKLEGGEWLLESVKKLTERGVPVCAHIGLT
PANB_PSEU5      SVKRGNRGAMIVADLPFMANATTEQTLNNSALLMQAGAHMIKLEGTAWLAESIRLLADRGIPVCAHMGLT
PANB_COLP3      CVKRGVEETLIIADMPFMSYXXXXXXXXXXXXXXXXXXSMVKIEGGAWLNGTISALVERGVPVCAHLGLT
PANB_PSEPW      CVKRGNEGALILADLPFMAHATPEQAFANCAMLMQAGAHMIKLEGAAWLAETIRLLAERGVPVCAHMGLT
PANB2_PSEF5     AVKRGNNGALILADLPFMSYATTEQALSSSAQLMQAGAHMLKIEGAAWLAEPVRLLNERGVPVCVHMGLT
PANB_MARAV      CVARGNKGALIMADMPFMSYGTVADALDNAAELMRAGAHMVKLEGTDWMKDTIEALSERGVPVCAHLGLT
PANB_PSEPF      SVKRGNSDALILADLPFMANATLEQTMTNSALLMQAGAHMVKVEGALWLADSIRLLAERGVPVCAHMGLT
PANB2_HAHCH     SVRRGARNAFIIADMPFMSYGTPDQAMAGAKQLMQAGAHMVKLEGGAWLCDAIAHLSRQGVPICAHLGLT
PANB_PSEFS      SVKRGNDGAFIIADLPFMGYATLEQTFQNAGKLMQAGAHMIKVEGAVWLAESIRLLAERGVPVCAHMGLT
PANB_PSEMY      CVKRGNQGALILTDLPFMAYATAEQAMNNSARLMQAGAHMVKLEGAGWLAEPIRLLAERGVPVCAHLGLT
PANB_WIGBR      CVRRGAPSCLIISDLPFMSYNNINDALNNSKKLIQSGANIVKLEGGLWVSDIIHELNTRSIPVCGHIGLT
PANB_PSE14      CVKRGNQGAMILADLPFMANATLEQTFINSATLMQAGAHMIKVEGAAWLGESIRLLAERGIPVCAHMGLT
PANB_PSEU2      CVKRGNQGAMILADLPFMANATLEQTLINSATLMQAGAHMIKVEGAAWLAESIRLLAERGIPVCAHMGLT
PANB_PSESM      CVKRGNQGALILADLPFMANATLEQTFINSTTLMQAGAHMIKVEGAAWLGESIRLLAERGIPVCAHMGLT
PANB_CHRVO      CVARGAKNALILGDMTFGAYQSPQQAFAHAARLLQAGAHMVKLEGGAYMAETTRFLVERGIPVCSHIGLT
PANB_CHRSD      CVARGKQRSLLMVDLPFMSNADTGQLLRDAGALMRAGAELVKIEGAGWMHEGVRELTRRGVPVCAHLGLT
PANB_RALPJ      CVSRGTTKALLVSDLPFGTYGTPEQAFHSAVRVMQAGAQMVKLEGGVWLAPTIKFLVERSIPVCAHIGLT
PANB_SACD2      AVARGNSRSLIIGDLPFMTYATVEQTMINATRVMQAGAHMVKMEGGAWLVDSVRMLSERGIPVCAHLGLT
PANB_PSYA2      NVARSNKQALILADLPFMSYVTLPEAIANSRKLMQVGAHVIKIEGGSELCELVTMLAQAGTPTCVHLGLT
PANB2_PSEE4     SVKRGNNGALILTDLPFMAHATPELAFTNAAQLMRAGAHMVKIEGAAWLAETIRLLAERGVPVCAHMGLT
PANB_PSEPK      SVKRGNDGALILTDLPFMAHATPEQAFANSATLMQAGAHMVKIEGAAWLAETIRLLAERGVPVCAHMGLT
PANB_PSEP1      SVKRGNDGALILTDLPFMAHATPEQAFANSATLMQAGAHMVKIEGAAWLAETIRLLAERGVPVCAHMGLT
PANB_PSYWF      NVSRSNKHALILADLPFMSYVTVEDAIANTRKVMQAGAQVIKLEGGAELSEMVTTLTKAGAPICVHLGLT
PANB_PSYCK      NIARSNKQALILADLPFMSYVTLPEAVVNSRKLMQAGAHVIKIEGGCELCELITTLAQAGTPTCVHLGLT
PANB_NEIMF      CVARGAKNAMIVSDLPFGAYQSKEQXXXXXXXXXXXXXHMVKLEGGVWMAETTEFLQMRGIPVCAHIGLT
PANB_ALCBS      CVARGNQGSLIIADIPFMGAATLERTLNAATALMQAGANMVKLEGSAWLAEAIEVLNRNGVPVCAHMGLT
PANB1_BURCM     CVARAQPRALIIADLPFGTYGTPAEAFASAVKLMRAGAQMIKLEGGEWLAETIRFLVERAVPVCAHVGLT
PANB_ACIBS      AVRRGNQHALIMTDLPFMSYATLKDALQNAKTVMQAGAQMIKIEGGAWLSETVQVLTRNGVPVCVHLGLT
PANB_BURVG      CVARVQPRALVVADLPFGTYGTPAEAFAHSVALMRAGAQMVKLEGGEWLADTIRFLVERSVPVCAHLGLT
PANB_ACIBY      AVRRGNQHALIMTDLPFMSYATLNDALQNAKTVMQAGAQMIKIEGGAWLSETVQVLTRNGVPVCVHLGLT
PANB_ACIBC      AVRRGNQHALIMTDLPFMSYATLNDALQNAKTVMQAGAQMIKIEGGAWLSETVQVLTRNGVPVCVHLGLT
PANB_ACIB5      AVRRGNQHALIMTDLPFMSYATLNDALQNAKTVMQAGAQMIKIEGGAWLSETVQVLTRNGVPVCVHLGLT
PANB_ACIB3      AVRRGNQHALIMTDLPFMSYATLNDALQNAKTVMQAGAQMIKIEGGAWLSETVQVLTRNGVPVCVHLGLT
PANB_BURCA      CVARAQPRALVVADLPFGTYGTPVDAFANAVKLMRAGAQMVKLEGGEWLADTIRFLVERSVPVCAHLGLT
PANB1_BURCH     CVARAQPRALVVADLPFGTYGTPVDAFANAVKLMRAGAQMVKLEGGEWLADTIRFLVERSVPVCAHLGLT
PANB2_BURS3     CVARAQPRALIMADLPFGTYGTPAEAFASSVKLMRAGAQMVKLEGGEWLAETIRFLVERAVPVCAHVGLT
PANB_BURPP      SVARARPAALIVADLPFGTYGTPEDAFRSSVELMRAGAQMVKLEGGEWLADTVRFLVERSIPVCAHVGLT
PANB_BURTA      CVARAQPRALIVADLPFGTYGTPADAFASAVKLMRAGAQMVKFEGGEWLAETVRFLVERAVPVCAHVGLT
PANB_BURXL      SVARARPAALIVADLPFGTYGTPEDAFRSSVELMRAGAQMVKLEGGEWLADTVRFLVERSIPVCAHVGLT
PANB_NEIMB      CVARGAKNAMIVSDLPFGAYQSKEQXXXXXXXXXXXXXHMVKLEGGVWMAETTEFLQMRGIPVCAHIGLT
PANB_BURPS      CVARAQPRGLVVADLPFGTYGTPADAFASAVKLMRAGAQMVKLEGGEWLAETVRFLVERAVPVCAHVGLT
PANB_BURP6      CVARAQPRGLVVADLPFGTYGTPADAFASAVKLMRAGAQMVKLEGGEWLAETVRFLVERAVPVCAHVGLT
PANB_BURP1      CVARAQPRGLVVADLPFGTYGTPADAFASAVKLMRAGAQMVKLEGGEWLAETVRFLVERAVPVCAHVGLT
PANB_BURP0      CVARAQPRGLVVADLPFGTYGTPADAFASAVKLMRAGAQMVKLEGGEWLAETVRFLVERAVPVCAHVGLT
PANB_BURMS      CVARAQPRGLVVADLPFGTYGTPADAFASAVKLMRAGAQMVKLEGGEWLAETVRFLVERAVPVCAHVGLT
PANB_BURMA      CVARAQPRGLVVADLPFGTYGTPADAFASAVKLMRAGAQMVKLEGGEWLAETVRFLVERAVPVCAHVGLT
PANB_BURM9      CVARAQPRGLVVADLPFGTYGTPADAFASAVKLMRAGAQMVKLEGGEWLAETVRFLVERAVPVCAHVGLT
PANB_BURM7      CVARAQPRGLVVADLPFGTYGTPADAFASAVKLMRAGAQMVKLEGGEWLAETVRFLVERAVPVCAHVGLT
PANB_XANAC      XXXXXXXXXXXXXXXXFQADATPERALDAATQLLQAGAEMVKIEGAGHKLEVIRYLVEREIPVCSHLGLT
PANB_ACIAD      AVRRGNQHSFIMTDLPFMSYATLPDALNNAKKVMQAGAQMIKIEGGAWLSESIRVLTQNGIPVCVHLGLT
PANB_XANC5      XXXXXXXXXXXXXXXSFQADATPERALDAATQLLQAGAEMVKIEGAGHKLEVIRYLVEREIPVCSHLGLT
PANB_JANMA      CVARGSKTAFVMSDMPFGSYATKEEAFKNAVKLVQAGAQMVKIEGGAWMADTVRFLTERAIPVMVHLGLT
PANB_ALHEH      CVTAARPSALVMADMPFMSYATLEDGLRNAARLMQGGAQMIKLEGAGEQAELVARLARAGIPVCAHLGLQ
PANB_BURP8      CVARAKPSALIVSDMPFGTYGTPADAYANAVKLMQSGAQMIKLEGGEWLADTVRFLVERSVPVCAHVGLT
PANB_CLOBA      SVKKGAKNALIVSDMPFLSYHTSEEAVKNAGMIKEGGANAVKLEGGASVIKQIKAIVDAQIPVMGHLGLT
PANB_RALME      CVSRGNQTALLVSDLPFGTYPTPEKAFESAAALMRAGAQMVKLEGGDWLAPTVKFLVERSIPVCAHIGLT
PANB_NITMU      CVKRGASTAFIMTDMPFTSQVSPEETFRNAAELMAAGANMVKIEGGSVMAETVEFLTQRGIPVCAHIGLT
PANB2_PSEAB     CVKRGNKGSLIVTDLAFESSHSVAQTLADAVRLMQAGAHMVKLEGGAWLAEPIARLAQMGVPVCAHLGLT
PANB_STRMK      AVARVLQRALLVADLPFGADATPERALDASLQLLQAGAEMVKIEGAGFKVDIIRYLVEREIPVCAHLGLT
PANB_STRM5      AVARVLQRALLVADLPFGADATPERALDASLQLLQAGAEMVKIEGAGFKVDIIRYLVEREIPVCAHLGLT
PANB2_PSEAE     CVKRGNKGSLIVTDLAFESSHSVAQTLADAVRLMQAGAHMVKLEGGVWLAEPIARLAQMGVPVCAHLGLT
PANB_XYLFA      CVARGVRQAMLVVDLPFQADASPERALEAATPLLRVGAQMIKIEGAGHKLEVISYLVEREIPVCSHLGLT
PANB_XANOM      XXXXXXXXXXXXXXXSFQADATPERALDAATQLLQAGAEMVKIEGAGHKLEVIRYLVEREIPVCSHLGLT
PANB_DECAR      AVKRGCDRAFIVADMPFGSYQSPEQAFRNAATLMAAGAQMVKLEGGADMAPTVRFMVSRGIPVCGHIGLT
PANB_XANOR      XXXXXXXXXXXXXXXSFQADATPERALDAATQLLQAGAEMVKIEGAGHKLEVIRYLVEREIPVCSHLGLT
PANB_XANOP      XXXXXXXXXXXXXXXSFQADATPERALDAATQLLQAGAEMVKIEGAGHKLEVIRYLVEREIPVCSHLGLT
PANB_RALEJ      CVARANQTALLVTDLPFGTYGTPEMAFASAVTLMRAGAHMVKLEGGDWLAPTVKFLVERSIPVCAHIGLT
PANB_CLOB8      AVKKGAKNALIVSDMPFLSYVSIEQAVLNAGLIKEGGANAVKLEGGANVAAQIKAIVDAQIPVMGHIGLT
PANB_BURM1      CVARAQPRALVVADLPFGTYGTPADAFANAVELMRAGAQMVKLEGGEWLAETIRFLVERSVPVCAHLGLT
PANB_RALSO      CVARGTTKALLMSDLPFGTYGTPEQAFHSAVRVMQAGAQMVKLEGGEWLAPTLRFLVERSIPVCAHIGLT
PANB_RALEH      CAARGNQTSLLLTDLPFGTYPTPEAAFASAVTLMKAGAQMVKLEGGDWLAPIVKFLVERSIPVCAHIGLT
PANB_NITEC      CVERGTHSVFILADMPFGTFVSPQEAFRNAVRLMAAGAQMVKVEGGRHMAETIEFLTCRGIPVCAHIGLI
PANB_XANCP      XXXXXXXXXXXXXDLSFQADATPERALDAATQLLQAGAEMVKIEGAGHKLDVIRYLVEREIPVCSHLGLT
PANB_XANCB      XXXXXXXXXXXXXDLSFQADATPERALDAATQLLQAGAEMVKIEGAGHKLDVIRYLVEREIPVCSHLGLT
PANB_XANC8      XXXXXXXXXXXXXDLSFQADATPERALDAATQLLQAGAEMVKIEGAGHKLDVIRYLVEREIPVCSHLGLT
PANB_THICR      MVQRKNHQAWCIADIPFMSDMNLSSVLDSAARLMKEGANMVKLEGGQRVVEMVQALSDLGVPVCGHLGLL
PANB_METFK      CVANGTQHAFIVTDMPFGSFQTPEQAFENAVLLMAAGAQMVKVEGGAIMLETVRFLVERGIPVCGHLGLT
PANB_CUPTR      CAARGNQTALLLTDLPFGTYPTPEAAFASAVTLMKAGAQMVKLEGGDWLAPIVKFLVERSIPVCAHIGLT
PANB_PELPD      AVARAKPQAVLVTDMPFMSYVSVEEACRNCGMIQEGGAQAVKIEGGMNMSHVIRAVTSIDIPVMGHIGLT
PANB_SYNWW      TVVRASKNAMVVGDMPFLSYISKKEAVRNAGFIQEAGCSAVKLEGGSERVDTVKAILDAQIPVMGHIGLT
PANB_XYLFT      CVARGVRHAMLVVDLPFQADASPXXXXXXXXXXXXVGAQMIKIEGAGHKLEVISYLVEREIPVCSHLGLT
PANB_XYLF2      CVARGVRHAMLVVDLPFQADASPXXXXXXXXXXXXVGAQMIKIEGAGHKLEVISYLVEREIPVCSHLGLT
PANB_THEPX      AVSRAVNRAFIVADMPFMSYISKEQAMTNAALIAEGGAHAVKLEGGEEIASIVKAIVDAGIPVVGHLGLT
PANB_THEP3      AVSRAVNRAFIVADMPFMSYISKEQAMTNAALIAEGGAHAVKLEGGEEIASIVKAIVDAGIPVVGHLGLT
PANB_METCA      CVQXXXXXXLVLADLPFLSYCTPEQAVRSAARLIRGGAQVVKLEGGRERLDVVRFLTEQNVPVCGHLGLQ
PANB_GEOTN      AVRRGAPNTFIVTDMPFMSYASKEEALQNARIMQQSGANAVKVEGADEVVETIAALTKAGVPVVAHLGLT
PANB_XYLFM      CVARGVRQAMLVVDLPFQADASPXXXXXXXXXXXXVGAQMIKIEGAGHKLEVISYLVEREIPVCSHLGLT
PANB_BACC7      AVRRGAKETFIVTDMPFMSYVSPQDTMVNARIVQESGAHALKVEGAGEVISTIHYLTSAGIPVVAHLGLT
PANB_NITEU      CVERGTHRVFIMADMPFGTFVSPQEAFGNAVRLMAAGAQMVKIEGGQHMAETVEFLSCRGIPVCAHIGLM
PANB_AZOSE      CVVRGSTRPFIVTDMPFGAYESPSQAMHNAASLLAAGAQMVKLEGGTFMAETVRFLVERGIPVCAHIGLT
PANB_CLONN      AVSRGVKNTLVVGDMPFMSYSSVYDAVVNAGLIKEGGATAVKLEGGATVIEQIKAIVNAQIPVMAHIGLT
PANB_CLOD6      AVKNGVKNALIVSDMPFLSYVSIEDAVKNAGLIKEGGAHAVKLEGGSNVIKQIESIVNAQIPVMGHLGLT
PANB_GEOSW      AVRRGAPNTFIVTDMPFMSYLSMEEALRNAQRIMQSGANAVKVEGADDVVNVIRAFTKAGVPVVAHLGLT
PANB_GEOLS      AVVRARPKALVVADMPFMACQSGEEALKNCGMLQEGGAEAVKIEGGSNMAPIIRAVTEMDIPVMGHVGLT
PANB_ENTFA      AVTRGAKNTLVVADMPFMSYQTSYDSVVNAGRLIKEGAQVVKLEGGIEVCDKIEAIVKASIPVMAHIGLT
PANB_BACC1      AVRRGAKETFIVTDMPFMSYVSPQDTMVNARIVQESGAHALKVEGAGEVISTIHYLTSAGIPVVAHLGLT
PANB_NEIMA      CVARGAKNAMIVSDLPFGAYQSKEQXXXXXXXXXXXXXHMVKLEGGVWMAETTEFLQMRGIPVCAHIGLT
PANB_BACWK      AVRRGAKETFIVTDMPFMSYSLQDTMINARRIVQESGAHALKVEGAGEVISTIHYLTNAGIPVVAHLGLT
PANB_GEOKA      AVRRGAPNTFIVTDMPFMSYASKEEALQNARRIMQSGANAVKVEGADEVVDMIAALTKAGVPVVAHLGLT
PANB_DESAA      LVARAAKRAMVVGDMPFMSYQTSKDAVINAGFIKEAGAAAVKLEGGAAVADRIKAISQAGIPVQAHIGLT
PANB_BACHD      AVKRGAKNTFIVTDMPYLTYSFNETLVGAKRLMQEAGADALKLEGNGDIIDTIERLTLAGVPIVAHLGLT
PANB_NITOC      NVSRGSQCTFILSDMPFMSYATPNQAMDNAARLMRGGAQMVKLEGGRLLGEIVEHLTARGIPVCAHLGLL
PANB_LEPBL      VVRRGAPDKFIIADLPFLSYQTSEEGIRSAGRMMKTDCDAVKIEGGSFICELVAILKQIGIPVMGHLGLT
PANB_CALS8      AVARGTKYSMVVADMPFLSYTTPEEAVRNAGRLIRAGAYAVKIEGCDDVIDKIEAVIKAQIPVMGHLGLT
PANB_ANATD      AVSRGAKYSMVVADMPFLSYTTIEEAVKNAGRLIRAGAYAVKMEGCDDVYDKIEAVIKAQIPVMGHLGLT
PANB_MYCUA      GVVRGAPHALVVADLPFGSYESGPSAALAAAFMKEAGAHAVKLEGGERVAEQIACLTAAGIPVMAHIGFT
PANB_MYCMM      GVVRGAPHALVVADLPFGSYESGPSAALAAAFMKEAGAHAVKLEGGERVAEQIACLTAAGIPVMAHIGFT
PANB_BACHK      AVRRGAKETFIVTDMPFMSYVSLQDTMVNARIVQESGAHALKVEGAGEVISTIHYLTNAGIPVVAHLGLT
PANB_BACCZ      AVRRGAKETFIVTDMPFMSYVSLQDTMVNARIVQESGAHALKVEGAGEVISTIHYLTNAGIPVVAHLGLT
PANB_BACCR      AVRRGAKETFIVTDMPFMSYSLQETMVNARRIVQESGAHALKVEGAGEVISTIQYLTNAGIPVVAHLGLT
PANB_BACC4      AVRRGAKETFIVTDMPFMSYSLQETMVNARRIVQESGAHALKVEGAGEVISTIQYLTNAGIPVVAHLGLT
PANB_BACC3      AVRRGAKETFIVTDMPFMSYVSLQDTMVNARIVQESGAHALKVEGAGEVISTIHYLTNAGIPVVAHLGLT
PANB_BACC2      AVRRGAKETFIVTDMPFMSYSLQETMMNARRIVQESGAHALKVEGAGEVISTIQYLTNAGIPVVAHLGLT
PANB_BACC0      AVRRGAKETFIVTDMPFMSYVSLQDTMVNARIVQESGAHALKVEGAGEVISTIHYLTNAGIPVVAHLGLT
PANB_BACAN      AVRRGAKETFIVTDMPFMSYVSLQDTMVNARIVQESGAHALKVEGAGEVISTIHYLTNAGIPVVAHLGLT
PANB_BACAH      AVRRGAKETFIVTDMPFMSYVSLQDTMVNARIVQESGAHALKVEGAGEVISTIHYLTNAGIPVVAHLGLT
PANB_BACAC      AVRRGAKETFIVTDMPFMSYVSLQDTMVNARIVQESGAHALKVEGAGEVISTIHYLTNAGIPVVAHLGLT
PANB_BACAA      AVRRGAKETFIVTDMPFMSYVSLQDTMVNARIVQESGAHALKVEGAGEVISTIHYLTNAGIPVVAHLGLT
PANB_NEIG2      CVARGAKNAMIVSDLPFGAYQSKEQXXXXXXXXXXXXXHMVKLEGGVWMAETTEFLQMRGIPVCAHIGLT
PANB_NEIG1      CVARGAKNAMIVSDLPFGAYQSKEQXXXXXXXXXXXXXHMVKLEGGVWMAETTEFLQMRGIPVCAHIGLT
PANB_HELMI      PVVRGAPNTLVVADMPFGSYVSKEDAIRNARMLKESGIEAVKVEGGTRMAPTVRALVDAGIPVMGHIGLT
PANB_BACLD      AVKRGAKDTFVVTDMPFMSYCSLESALKNAAIVQESGADALKLEGGDGVFETITALTRGGIPVVSHLGLT
PANB_GEOSL      AVTRARPKALVVTDMPFLSYQTDRDARINAGLVKEGGAEAVKLEGGAHVTDTIRAIVDMDIPVMAHIGLT
PANB_PELCD      AVARGLGQAFLVADMPFLSYQVDREARLNAGRLVKEGAQAVKLEGGEPVAEVIRTLVDMDIPVVGHIGLT
PANB_MYXXD      XXXXXXXXXXXXXDLPFMSYVSNQEAVRNAGLVAEGGAGSIKLEGGAEFADTVRAIVRASIPVMGHLGLT
PANB_CLOK5      AVTRGAKDALVVGDMPFMSYQTSYDAVKNAGRIIQEGAGAVKLEGGVSVYEQVKAIVKAQIPVMGHIGLT
PANB_BACCN      AVRRGAKDTFVVTDMPFMSYSLAETMHHARRIVQEGGAHALKVEGAGEVISTIHYLTNAGIPVVAHLGLT
PANB_VESOH      AVAKGTQNALRIADMPYQSYTYAEQTLTNAKRLIMAGAQMVKLEGGCEHEASFRILQGNDISVCGHLGLQ
PANB_THIDA      CVAAGTTRAFIVADLPFGSYPSPERXXXXXXXXXXXXXHMIKLEGGAVMVDTVAFLAARGIPVCAHLGLL
PANB_THEM4      AVRRGAPNSFIVADMPFLSYGSIEEAVKNAGILIKNGANAVKIEGGKFHCNLIEKCINIGIPVMGHLGFT
PANB_BACA2      AVKRGAKNTFIVTDMPFMSYLSKEDTLKNAAIIQESGADALKLEGGDGVFESIRALTLGGIPVVSHLGLT
PANB_AZOSB      CVVRGSSRPFVVTDMPFGSYQSPEQAMRNAARLMAAGAEMVKLEGGAFMAETVRFLVERGVPVCAHIGLT
PANB_MYCSS      GVVRGAPHALVVADLPFGSYEEPRQALATATFLKETGAHAVKLEGGERVAEQIATLSAAGIPVMAHIGFT
PANB_MYCSK      GVVRGAPHALVVADLPFGSYEEPRQALATATFLKETGAHAVKLEGGERVAEQIATLSAAGIPVMAHIGFT
PANB_MYCSJ      GVVRGAPHALVVADLPFGSYEEPRQALATATFLKETGAHAVKLEGGERVAEQIATLSAAGIPVMAHIGFT
PANB_RHOSR      GVVRGAPHALVVADLPFGSYSSPEQALASATRFMKEGAHAVKLEGGERVAPQIAAITAAGIPVMAHVGFT
PANB_CLOAB      AVVRGAKSTLIVADLPFMSYQTSYDAVFNAGLVKEAGATAIKLEGGALVCDRIKAIVDAQIPVMGHIGLT
PANB_LEPBJ      VVRRGAPDKFIIADLPFLSYQTSEEGIRSAGRMMKTDCDAVKIEGGSFICELVAILKQIGIPVMGHLGLT
PANB_BACSU      AVKRGAPNTFIVTDMPFMSYLSKEDTLKNAAIVQESGADALKLEGGEGVFESIRALTLGGIPVVSHLGLT
PANB_GEOBB      AVMRARPKAFVVADLPFLSYQTDKSARLNAGLLVKGGAAAVKIEGGVNVEETITAITDMDIPVVGHIGLT
PANB_KOSOT      AVRRGAPNTFVIADMPFLSYVSEEKAIENAGRFIKVGANAVKLEGGAEVAGLVKKLVDFGIPVMGHLGLT
PANB_GEOMG      AVVRARPKALVVADMPFLSYQTDRDARLNAGLVKDGGAEAVKLEGGSHVADTIRAIVDMDIPVMAHIGLT
PANB_LEPIN      AVRRGAPDKFLIADLPFLSYQTSEEGIRSAGKIMKSDCDAVKIEGGSFICELVSILKQIGVPVMGHLGLT
PANB_LEPIC      AVRRGAPDKFLIADLPFLSYQTSEEGIRSAGKIMKSDCDAVKIEGGSFICELVSILKQIGVPVMGHLGLT
PANB_RUTMC      AVTKGAQNALRISDMPYQSYTNSEQALTNAKLLIIAGAQMVKFEGGCEHEASFKIFQNNDIPVCGHLGLQ
PANB_CHLAD      AVVRGARNALIIGDLPFLTYASPEQAVISAGMLQEAGAQAVKLEGGVHIAPTIARLVHLGIPVMGHIGFT
PANB_BDEBA      AVVRGAGDKFVIADLPFMSYRKGLTANMTAVKVMKAGAHAVKLEGAAGNLKLVRHLVDSGVPVMGHLGLT
PANB_DEHSC      AVVRGSQKALIIADMPFMTYLSPEQALLNAGFIQEGGAQAVKLEGGVNVADKVKRIVDCGIPVMGHIGLT
PANB_DEHSB      AVVRGSQKALIIADMPFMTYLSPEQALLNAGFIQEGGAQAVKLEGGVNVADKVKRIVDCGIPVMGHIGLT
PANB_MYCPA      GVVRGAPHALVVADLPFGSYXXXXXXXXXTRFMKEGGAHAVKLEGGERVAEQIAHLTAAGIPVMAHIGFT
PANB_GEOUR      AVMRANPKALVVSDMPFLSYQIDLATARLNALIKEAGAAAVKLEGGLNVVATIEAIVAMDVPVMGHIGLT
PANB_THEAB      AVRRGAPNSFIVADLPFLSYGSIEESVKNAGLLIKNGANAVKIEGGAQNCEIIQKCLNIGIPVMGHIGFT
PANB_MOOTA      AVVRANPAALVVADLPFLSYQTPDAVYNAGRLIKEGGADAVKLEGGQAVVPTVRAIVNAGIPVMGHLGLT
PANB_BACP2      AVKRGAKDTFIVTDMPFMSYYSLAETLKNAARIMQSGADALKLEGGDGVFESIQALTRGGIPVVSHLGLT
PANB_THELT      AVRRGAPEAFIIADMPFLSYCSSDEAVRNAGFLKEAGANAVKLEGGSFFSTTIERIVKSGIPVMGHLGLT
PANB2_METPP     STSRGTKAAFLIADMPFGSYQNPVQALRNAGTLMAAGAQMVKLEGGGWTPETVNFLVERGVPVCAHLGLT
PANB_MYCVP      GVVRGAPHALVVADLPFGSYAGPQQALATATRMLKTGAHAVKLEGGERVADQIAAVSAAGIPVMAHIGFT
PANB_DESPS      AVRRGAPDAFVVGDMPFGSYQTARDAVLNARLLKEGGCDVVKLEGGEVVCPVVKAIVDAGIPVMGHLGLT
PANB_THESQ      AVKRGAPDAFIVADMPFLSYQTSEKAVENAGKFLKVGANAVKIEGGEEFGELVQKLVESGIPVMGHIGLT
PANB_THEMA      AVKRGAPDAFIVADMPFLSYQTSEKAVENAGKFLKVGANAVKIEGGEEFGELVQKLVESGIPVMGHIGLT
PANB_NOCFA      GVVRGAPHALVVADLPFGTYGSAQQALAAATRFMKGGAHAVKLEGGERVAEQIALLTAAGIPVMAHIGFT
PANB_MYCTU      GVVRGAPHALVVADLPFGSYAGPTXXXXXXTRFLKGGAHAVKLEGGERVAEQIACLTAAGIPVMAHIGFT
PANB_MYCBP      GVVRGAPHALVVADLPFGSYAGPTXXXXXXTRFLKGGAHAVKLEGGERVAEQIACLTAAGIPVMAHIGFT
PANB_MYCBO      GVVRGAPHALVVADLPFGSYAGPTXXXXXXTRFLKGGAHAVKLEGGERVAEQIACLTAAGIPVMAHIGFT
PANB_MYCA1      GVVRGAPHALVVADLPFGSYXXXXXXXXXTRFMKEGGAHAVKLEGGERVAEQIAHLTAAGIPVMAHIGFT
PANB_CHLSY      AVVRGTQKALVIGDLPFLTYTSPEQAMQSAGMLQEAGAQAVKLEGGVHIAPTIARLVQAGIPVMGHIGFT
PANB_CHLAA      AVVRGTQKALVIGDLPFLTYTSPEQAMQSAGMLQEAGAQAVKLEGGVHIAPTIARLVQAGIPVMGHIGFT
PANB_GEOSF      AVVRAQPKALVVADMPFLSYQTDMVSARLNALIKEGGAAAVKIEGGVNVAPVIEAITSMDIPVVAHIGLT
PANB_DEHE1      AVVRGSQKAMVIADMPFMTYLSPEQALLNAGRFMQGGAQAVKLEGGVNVADKVKRIVDCGIPVMGHIGLT
PANB_BACSK      AVKRGAPNTFVVTDMPFLTYSFSETAGHVRRLLQEAGADAVKLEGGTDIASTVQRLTAAGVPVVGHIGLT
PANB_MYCLE      GVVRGAGHALVVADLPFGSYEPPTAALAVATRFMKGGAHAVKLEGGQRVAEQIACLTAAGIPVMAHIGFT
PANB_LEPBP      AVCKGAPDKTIIADLPFLSYQTSEEGIRSAGRVLKTNASCVKLEGDSFIIELTKRMTESGIPVFAHLGLT
PANB_LEPBA      AVCKGAPDKTIIADLPFLSYQTSEEGIRSAGRVLKTNASCVKLEGDSFIIELTKRMTESGIPVFAHLGLT
PANB_CAMJE      AVSRGAKKSFVLADMPFMSYQSSDRAILNASFIKESHANGVKVEGGIEIASKIKLISQSGIPVVAHLGLT
PANB_CAMJ8      AVSRGAKKSFVLADMPFMSYQSSDRAILNASFIKESHANGVKVEGGIEIASKIKLISQSGIPVVAHLGLT
PANB_CLOTH      AVVRGVKRAMVVADMPFLSYHTKNDSVRNAGLVSEGGCKAVKLEGGEDIIENVKAIISAGIPVVGHLGYT
PANB_CAMJR      AVSRGAKKSFVLADMPFMSYQSSDRAILNASFIKESHANGVKVEGGIEIASKIKLISQSGIPVVAHLGLT
PANB_CAMJJ      AVSRGAKKSFVLADMPFMSYQSSDRAILNASFIKESHANGVKVEGGIEIASKIKLISQSGIPVVAHLGLT
PANB_SYNFM      AVARGAKRALVIGDMPFMSYVSVEEALYNAGLFLKAKAQAVKLEGGRRVAPQVKAMVEAGIPVQGHLGLT
PANB_THET2      AARRGAPETFLVADLPYLAYXXXXXXXXXXXXXXXXXXDAVKLEGGEEVAEIVRGLVRAGVPVLGHVGLT
PANB_THET8      AARRGAPETFLVADLPYLAYXXXXXXXXXXXXXXXXXXDAVKLEGGEEVAEIVQGLVRAGVPVLGHVGLT
PANB_EXISA      AVRRGAQHTFVVVDMPFASYGDFDRTLQAASRLFQEGADAIKLEGAGDVLQTIERLTQVGMPCVAHLGLT
PANB_CAMJD      AVSRGAKKSFVLADMPFMSYGSDRDAILNASFIKESHANGVKVEGGIEIASKIKLISQSGIPVVAHLGLT
PANB_SYNAS      AVSRGANNAMVVADLPFMSYCSVEEAVRNAGFLQEAGAHAVKLEGGREIAESVKRMTVSGIPVVGHLGLT
PANB2_BRAJA     AVARTRPHALLVADMPFLSFHVSEDTIRNAGGFLQRGADAVKLEGGAKRIEMVRALVDCDIPVMGHLGLT
PANB_HERA2      AVMRGSSKALVVGDLPFLSYTSPEQAIQNAGKLMQGGCGAVKLEGGVNLAPTVRRLVDLGIPVMGHLGFT
PANB_THEFY      AVSRATKRALVVADLPFGSYAGPEQALESAARLMKGGAQAVKLEGGHRVIAQVEALVSAGIPVMGHIGLT
PANB_DESAH      MVTRACNRAMVVGDMPFMSYSSINQAVDNAGFLKEADASAVKLEGGADVCPVIQAIAKAGIPVQAHIGLT
PANB_CALMQ      AVARAKPKALLVADMPFMTYETPRDALKNASKLIRAGAEAVKPEGGLEIVRIVERLTKAGIPVMGHIGLN
PANB_UNCTG      SVKRGNDGALLITDMPFMSYITVEDAVKNAAIXXXXXXXXXXXXXXIEIVDRVKAISDAKVPIVGHLGLT
PANB_LISW6      AVKRGAPNTFVVTDMPFMTYGSVDETIQNAQIIQESGAHAVKLEGAGEVVNKIARLTEAGAPVVAHLGLT
PANB_PYRIL      AVARAKPRALVVADMPFMSYETPEDALKNAARLIRAGADAVKLEGGAEYAHIVERLVKAGIPVMGHIGLT
PANB_GLUDA      AVVRGTSRALVVADLPFLTYATEADAIASARRVMQAGVQALKLEGGATIAPTVRRLTELGVPVMGHLGLT
PANB_DESHD      AAKRGAPNTFIVADMPFMSLSIRDTLLNGARLIQETGAQAVKVEGADEMIPHIKALVRAGIPVVSHLGLT
PANB_LISMH      AVKRGAPDTFVVTDMPFMTYGSVDETIQNAKIIQESGAHAVKLEGAGEVVNKIARLTEAGAPVVAHLGLT
PANB_DESVV      AVVRGTRHAMVVADMPFMTYETGDALLNGARLFRESGVRAVKLEGAGPVLPQVRALVDAGIPVMGHLGLT
PANB_DESVH      AVVRGTRHAMVVADMPFMTYETGDALLNGARLFRESGVRAVKLEGAGPVLPQVRALVDAGIPVMGHLGLT
PANB_HYPBU      AVARAQPRALIVADMPFMSYASTRDAVLNAGRLIAAGADAVKIEGGASYSDTIRALVRAGIPVVAHVGLT
PANB_DESDG      AVTRGASRALVVGDLPFMTYEQPDQAMHSAARLFRGGVRAVKLEGGKEVAPQVEALVKAGIPVMGHIGLT
PANB_LISIN      AVKRGAPNTFVVTDMPFMTYGSVDETIQNAKIIQESGAHAVKLEGAGEVVNKIARLTEAGAPVVAHLGLT
PANB_DESHY      AAKRGAPNTFIVADMPFMSLSIRDTLLNGARLIQETGAQAVKVEGADEMIPHIRALVRAGIPVVSHLGLT
PANB_NITMS      AVSRARNNALLVADLPFMSYASIEDAINNSGKLIKAGADAVKLEGGSIMAETISAIVDVGIPVMGHIGLQ
PANB_LISMF      AVKRGAPDTFVVTDMPFMTYGSVDETIQNAKIIQESGAHAVKLEGAGEVVNKIARLTEAGAPVVAHLGLT
PANB_LISMC      AVKRGAPDTFVVTDMPFMTYGSVDETIQNAKIIQESGAHAVKLEGAGEVVNKIARLTEAGAPVVAHLGLT
PANB_SACEN      AVTRGARSALVVADLPFGSYASPEQALATAVRFMKGGAHAVKLEGGRPFARHVEALVNAGIPVMGHIGFT
PANB_ROSS1      AVARGAQSALIVADMPFLTYATLEMAVAAARRLMQGGAQAVKLEGGQAMVPIVRRLVECGVPVMGHLGYT
PANB_PYRAR      AVARAAPKALVVADMPFMTYETPRDALRNAARLIRAGAEAVKLEGGSEYAHVVEKLVKAGIPVMGHIGLN
PANB_STAS1      AVRRGAPNTYLIVDVPFGAVGVNDQYDLEIAVKLETDANAIKAE-GAHLTQYIKNCSNMGIPVVSHLGLT
PANB_LISMO      AVKRGATDTFIVTDMPFMTYGSVNETIQNAKIIQESGAHAVKLEGAGEVVNKIARLTEAGAPVVAHLGLT
PANB_CLOBM      AVVRGTSNALVVGDMPFMSYQTSYDAVYNAGFIKEAGAHAVKLEGGATVAEEIKAIVKAQIPVMGHIGLT
PANB_TRIEI      AVRRAVKQALMVVDLPFLTYESPQQAIHSAGILKETGAQAVKLEGNEAIAQTVKKLTSIGIPVMGHIGLI
PANB_CORJK      XXXXXXXXXXXXXDLPFGTYASDEQAVKAASEMLRTGAHAVKIEGGVRIADRIRAITDAGISVCAHIGFT
PANB_CLOBL      AVVRGTSNALVVGDMPFMSYQTSYDAVYNAGFIKEAGAHAVKLEGGATVAEEIKAIVKAQIPVMGHIGLT
PANB_CLOBK      AVVRGTSNALVVGDMPFMSYQTSYDAVYNAGFIKEAGAHAVKLEGGATVAEEIKAIVKAQIPVMGHIGLT
PANB_CLOBJ      AVVRGTSNALVVGDMPFMSYQTSYDAVYNAGFIKEAGAHAVKLEGGATVAEEIKAIVKAQIPVMGHIGLT
PANB_LYSSC      ATRRGAKDTFVVVDMPFGSYHGDVNETLKTAIYMETGADALKVEGAGDIIPVIQKLTTAGIPVVAHLGLL
PANB_CLOB6      AVVRGTSNALVVGDMPFMSYQTSYDAVYNAGFIKEAGAHAVKLEGGATVAEEIKAIVKAQIPVMGHIGLT
PANB_STRCO      AVVRGTSRALIVGDLPFGSYQEPVQALRSATLVKEAGVGAVKLEGGERSHRQIELLVESGIPVMAHIGLT
PANB_IGNH4      AVARANPKAMIVGDMPFGSYVSEEEAVRNAVELVRAGAEAVKLEGGKEVADKVEAIVKAGIPVMGHLGLT
PANB_LEIXX      XXXXXXXXXXXXXDLPFGSYETPQEALRTAVRFMKTGAHAVKLEGGERSAEQIRRIVDAGVPVMGHIGFT
PANB_ARTAT      AVSRSAKRALIVADLPFGSYVSPGQAVATGVRFLKEGAHAVKIEGTAYYADTVRAMVQAGIPVMAHIGFT
PANB_SALRD      CVVRGIDRSLVVVDLPFGAYGDPTEALDSAIRVMKAGAHAVKLEGGAPVVEAVERMVTAGIPVMGHLGLT
PANB_GRAFK      SVVRAITRSLVVVDLPFGSYQSPKEALRSAIRIMKSGGHAVKLEGGKEVKESIKRIIHAGIPVMGHLGLT
PANB_CARHZ      AVVRGSKRSMVVADMPFMSYASYTDALYNAGFLKEGGAQAVKLEGGGEIAELVAKLVTAGIPVMGHIGLT
PANB_STRAW      AVVRGTSRALIVGDLPFGSYQEPVQALRSATLVKEAGVGAVKLEGGERSHRQIELLVESGIPVMAHIGLT
PANB_SILST      AVARGLKRAMMVIDMPFGSYESPAQAFANAARLMETGAAAVKLEGGEEMADTIRFLVKRGIPVMAHIGLT
PANB_CHLPB      AVVRGTSRSMVVIDMPFMSYLSSEEALRNAGKIMKDNCDAVKMEGGKVVVDTVKRITDVGIPVMGHLGLI
PANB_PROA2      AVVRGTSRAMVVIDMPFMSYLSSEEALRNAGKIMKENCDAVKIEGGNVIVDTVKRITDVGIPVMGHLGLI
PANB_CHLP8      AVVRGVQRAMVIVDMPFMSYQSPEDAVRNAGKIMKEHCDAVKMEGGKVIAEAVKRITDIGIPVMGHLGLM
PANB_BORPD      AVVRGSTQACVVVDLPFGSYASPMQAFESAARVLETGAQAVKLEGGVEMAETVQFLTARGVPVVSHIGLM
PANB_ACIAC      SVARGLHRAWLIADLPYGSYAEPEQAMRSACTLMQAGAHMVKLEGGGWTAPTVRFLVERGVPVCAHLGLT
PANB_SULIN      AVARANPPQLIVADMPFLSYIDTKSAVKNAGLLVKAGSDAIKLEGGEEMKDTVKAIVKAGIPVMGHIGLT
PANB_AQUAE      CVMRGVKNAFVIADMPFMSYVSMEKAVENCGVIKETKAKAVKLEGGEEIAELVYKLTRIGIPVVGHVGFT
PANB_SULIY      AVARANPPQLIVADMPFLSYIDTKSAVKNAGLLVKAGSDAIKLEGGEEMKDTVKAIVKAGIPVMGHIGLT
PANB_SULIL      AVARANPPQLIVADMPFLSYIDTKSAIKNAGLLVKAGSDAIKLEGGEEMKDTVKAIVKAGIPVMGHIGLT
PANB_FRATW      AVANGATDKFIVADLPFMSYRQSLETTMQAVMALQSGAHAIKLEGSSGNLDIIKHIVDSGVPVMGHIGMT
PANB_FRATN      AVANGATDKFIVADLPFMSYRQSEITMQAVTTLIQSGAHAIKLEGSSGNLDIIKHIVNSGVPVMGHIGMT
PANB_FRATM      AVANGATDKFIVADLPFMSYRQSLETTMQAVMALQSGAHAIKLEGSSGNLDIIKHIVDSGVPVMGHIGMT
PANB_FRAAA      AVVRGAPHAMVVADLPFGSYAGPEQALATATRFLKGGAQAVKLEXXXXXXXXXXXXXXXXXXXXXHLGLT
PANB_FRATO      AVANGATDKFIVADLPFMSYRQSLETTMQAVMALQSGAHAIKLEGSSGNLDIIKHIVDSGVPIMGHIGMT
PANB_FRATH      AVANGATDKFIVADLPFMSYRQSLETTMQAVMALQSGAHAIKLEGSSGNLDIIKHIVDSGVPIMGHIGMT
PANB_FRATF      AVANGATDKFIV