[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF67239.1

[Show Plain Result]


## Summary of Sequence Search
    1::309
    1::309     e-170 100%  309 aa  HILD_SALTY RecName: Full=Transcriptional regulator hilD;
   33::295     1e-41  36%  295 aa  SIRC_SALTY RecName: Full=Transcriptional regulator sirC;
   33::295     2e-40  36%  295 aa  SIRC_SALTI RecName: Full=Transcriptional regulator sirC;
  140::235     9e-22  46%  249 aa  APPY_ECOLI RecName: Full=HTH-type transcriptional regulator
    3::248     1e-20  26%  260 aa  FAPR_ECOLX RecName: Full=987P fimbrial operon positive regulatory
  129::233     2e-19  39%  242 aa  GADW_SHIFL RecName: Full=HTH-type transcriptional regulator gadW;
  129::233     2e-19  39%  242 aa  GADW_ECOLI RecName: Full=HTH-type transcriptional regulator gadW;
  129::233     2e-19  39%  242 aa  GADW_ECOL6 RecName: Full=HTH-type transcriptional regulator gadW;
  129::233     2e-19  39%  242 aa  GADW_ECO57 RecName: Full=HTH-type transcriptional regulator gadW;
  157::262     3e-19  38%  274 aa  PERA_ECO27 RecName: Full=Transcriptional activator perA;
   11::265     7e-19  26%  296 aa  URER_ECOLX RecName: Full=Urease operon transcriptional activator;
  127::232     2e-18  39%  253 aa  YDEO_ECOLI RecName: Full=HTH-type transcriptional regulator ydeO;
  127::232     2e-17  38%  253 aa  YDEO_SHIFL RecName: Full=HTH-type transcriptional regulator ydeO;
  127::232     2e-17  38%  253 aa  YDEO_ECOL6 RecName: Full=HTH-type transcriptional regulator ydeO;
  127::232     2e-17  38%  253 aa  YDEO_ECO57 RecName: Full=HTH-type transcriptional regulator ydeO;
  171::265     2e-16  37%  293 aa  URER_PROMH RecName: Full=Urease operon transcriptional activator;
  152::259     4e-15  34%  265 aa  AGGR_ECOLX RecName: Full=Transcriptional activator aggR;AltName:
  145::258     2e-14  35%  265 aa  RNS_ECOLX RecName: Full=Regulatory protein rns;
   29::255     2e-14  24%  262 aa  VIRF_SHISO RecName: Full=Virulence regulon transcriptional
   29::255     2e-14  24%  262 aa  VIRF_SHIFL RecName: Full=Virulence regulon transcriptional
   29::255     2e-14  24%  262 aa  VIRF_SHIDY RecName: Full=Virulence regulon transcriptional
  164::258     2e-14  35%  265 aa  CFAD_ECOLX RecName: Full=CFA/I fimbrial subunit D;AltName:
  154::261     3e-14  32%  301 aa  CSVR_ECOLX RecName: Full=HTH-type transcriptional activator csvR;
  134::239     7e-14  31%  274 aa  GADX_ECOL6 RecName: Full=HTH-type transcriptional regulator gadX;
  134::239     7e-14  31%  274 aa  GADX_ECO27 RecName: Full=HTH-type transcriptional regulator gadX;
  154::256     9e-14  34%  265 aa  YBCM_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
  134::239     3e-13  30%  274 aa  GADX_SHIFL RecName: Full=HTH-type transcriptional regulator gadX;
  134::239     3e-13  30%  274 aa  GADX_ECOLI RecName: Full=HTH-type transcriptional regulator gadX;
  134::239     3e-13  30%  274 aa  GADX_ECO57 RecName: Full=HTH-type transcriptional regulator gadX;
  146::244     1e-12  34%  253 aa  ENVY_ECOLI RecName: Full=Porin thermoregulatory protein envY;
  147::244     1e-12  34%  253 aa  ADIY_ECOLI RecName: Full=HTH-type transcriptional regulator adiY;
  157::269     3e-11  24%  276 aa  TCPN_VIBCH RecName: Full=TCP pilus virulence regulatory protein;
  157::269     3e-11  24%  276 aa  TCPN_VIBC3 RecName: Full=TCP pilus virulence regulatory protein;
  263::340     1e-10  41%  344 aa  Y1430_MYCBO RecName: Full=Uncharacterized HTH-type transcriptional
  263::340     1e-10  41%  344 aa  Y1395_MYCTU RecName: Full=Uncharacterized HTH-type transcriptional
  178::286     9e-09  31%  314 aa  YFIF_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
  211::320     3e-08  26%  325 aa  VQSM_PSEAE RecName: Full=HTH-type transcriptional regulator
  168::269     3e-08  28%  276 aa  RHAR_MANSM RecName: Full=HTH-type transcriptional activator
  203::294     4e-08  31%  298 aa  Y1052_HAEIN RecName: Full=Uncharacterized HTH-type transcriptional
  303::383     1e-07  31%  392 aa  XYLR_ECOLI RecName: Full=Xylose operon regulatory protein;
  303::383     1e-07  31%  392 aa  XYLR_ECOL6 RecName: Full=Xylose operon regulatory protein;
  303::383     1e-07  31%  392 aa  XYLR_ECO57 RecName: Full=Xylose operon regulatory protein;
  303::383     8e-07  30%  387 aa  XYLR_HAEIN RecName: Full=Xylose operon regulatory protein;
  195::295     8e-07  25%  303 aa  POCR_SALTY RecName: Full=Regulatory protein pocR;
  233::331     1e-06  31%  340 aa  VIRS_MYCTU RecName: Full=Putative virulence-regulating 38 kDa
  114::206     1e-06  34%  331 aa  RIPA_CORGL RecName: Full=HTH-type transcriptional repressor of iron
  193::266     4e-06  32%  278 aa  RHAS_SALTY RecName: Full=HTH-type transcriptional activator
  193::266     4e-06  32%  278 aa  RHAS_SALTI RecName: Full=HTH-type transcriptional activator
  193::266     4e-06  32%  278 aa  RHAS_SALSV RecName: Full=HTH-type transcriptional activator
  193::266     4e-06  32%  278 aa  RHAS_SALPK RecName: Full=HTH-type transcriptional activator
  193::266     4e-06  32%  278 aa  RHAS_SALPC RecName: Full=HTH-type transcriptional activator
  193::266     4e-06  32%  278 aa  RHAS_SALPB RecName: Full=HTH-type transcriptional activator
  193::266     4e-06  32%  278 aa  RHAS_SALPA RecName: Full=HTH-type transcriptional activator
  193::266     4e-06  32%  278 aa  RHAS_SALNS RecName: Full=HTH-type transcriptional activator
  193::266     4e-06  32%  278 aa  RHAS_SALHS RecName: Full=HTH-type transcriptional activator
  193::266     4e-06  32%  278 aa  RHAS_SALG2 RecName: Full=HTH-type transcriptional activator
  193::266     4e-06  32%  278 aa  RHAS_SALEP RecName: Full=HTH-type transcriptional activator
  193::266     4e-06  32%  278 aa  RHAS_SALDC RecName: Full=HTH-type transcriptional activator
  193::266     4e-06  32%  278 aa  RHAS_SALCH RecName: Full=HTH-type transcriptional activator
  193::266     4e-06  32%  278 aa  RHAS_SALAR RecName: Full=HTH-type transcriptional activator
  193::266     4e-06  32%  278 aa  RHAS_SALA4 RecName: Full=HTH-type transcriptional activator
  212::299     4e-06  32%  304 aa  ARACL_STRLI RecName: Full=Putative araC-like transcription
  166::260     1e-05  29%  271 aa  VIRF_YEREN RecName: Full=Virulence regulon transcriptional
  225::311     1e-05  26%  314 aa  RHRA_RHIME RecName: Full=Transcriptional activator rhrA;
  193::266     1e-05  32%  278 aa  RHAS_SHISS RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_SHIFL RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_SHIF8 RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_SHIDS RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_SHIBS RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_ECOSM RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_ECOLI RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_ECOLC RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_ECOL6 RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_ECOL5 RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_ECOHS RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_ECODH RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_ECOBW RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_ECO8A RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_ECO81 RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_ECO55 RecName: Full=HTH-type transcriptional activator
  193::266     1e-05  32%  278 aa  RHAS_ECO27 RecName: Full=HTH-type transcriptional activator
  166::260     1e-05  29%  271 aa  LCRF_YERPE RecName: Full=Thermoregulatory protein lcrF;
  226::273     1e-05  42%  280 aa  CHBR_ECOLI RecName: Full=HTH-type transcriptional regulator
  193::266     2e-05  32%  278 aa  RHAS_ECOUT RecName: Full=HTH-type transcriptional activator
  193::266     2e-05  32%  278 aa  RHAS_ECOLU RecName: Full=HTH-type transcriptional activator
  193::266     2e-05  32%  278 aa  RHAS_ECOK1 RecName: Full=HTH-type transcriptional activator
  193::266     2e-05  32%  278 aa  RHAS_ECO7I RecName: Full=HTH-type transcriptional activator
  193::266     2e-05  32%  278 aa  RHAS_ECO45 RecName: Full=HTH-type transcriptional activator
  193::266     2e-05  30%  278 aa  RHAS_CITK8 RecName: Full=HTH-type transcriptional activator
  171::264     2e-05  28%  278 aa  EXSA_PSEAE RecName: Full=Exoenzyme S synthesis regulatory protein
  193::266     3e-05  32%  278 aa  RHAS_SHIB3 RecName: Full=HTH-type transcriptional activator
  192::266     3e-05  30%  278 aa  RHAS_KLEP3 RecName: Full=HTH-type transcriptional activator
  193::266     3e-05  32%  278 aa  RHAS_ECO5E RecName: Full=HTH-type transcriptional activator
  193::266     3e-05  32%  278 aa  RHAS_ECO57 RecName: Full=HTH-type transcriptional activator
  129::219     4e-05  31%  335 aa  RIPA_CORDI RecName: Full=HTH-type transcriptional repressor of iron
  192::266     4e-05  30%  278 aa  RHAS_KLEP7 RecName: Full=HTH-type transcriptional activator
  193::266     4e-05  30%  278 aa  RHAS_ECOSE RecName: Full=HTH-type transcriptional activator
  193::266     4e-05  30%  278 aa  RHAS_ECO24 RecName: Full=HTH-type transcriptional activator
  262::317     4e-05  32%  324 aa  GLXA_RHIME RecName: Full=HTH-type transcriptional regulator glxA;
  182::279     5e-05  24%  285 aa  YPDC_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   47::104     5e-05  33%  122 aa  PQRA_PROVU RecName: Full=Regulatory protein pqrA;
  193::266     6e-05  32%  278 aa  RHAS_ENT38 RecName: Full=HTH-type transcriptional activator
  205::263     8e-05  29%  529 aa  YBBB_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
  193::266     8e-05  30%  278 aa  RHAS_ESCF3 RecName: Full=HTH-type transcriptional activator
  204::276     8e-05  29%  284 aa  RHAR_ERWCT RecName: Full=HTH-type transcriptional activator
  282::358     1e-04  35%  368 aa  YESN_BACSU RecName: Full=Uncharacterized transcriptional regulatory
  174::253     1e-04  27%  745 aa  Y107_STAAR RecName: Full=Uncharacterized HTH-type transcriptional
  204::276     1e-04  27%  284 aa  RHAR_PECCP RecName: Full=HTH-type transcriptional activator
  166::260     1e-04  28%  271 aa  VIRF_YERE8 RecName: Full=Virulence regulon transcriptional
  189::263     1e-04  27%  268 aa  RHAS_MANSM RecName: Full=HTH-type transcriptional activator
  177::273     1e-04  28%  278 aa  MSMR_STRMU RecName: Full=Msm operon regulatory protein;
    6::117     2e-04  27%  135 aa  AARP_PROST RecName: Full=HTH-type transcriptional activator aarP;
  241::289     2e-04  37%  291 aa  YDEC_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
  202::305     3e-04  24%  318 aa  YQHC_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
  174::253     3e-04  25%  745 aa  Y101_STAAM RecName: Full=Uncharacterized HTH-type transcriptional
  174::253     3e-04  25%  745 aa  Y097_STAAN RecName: Full=Uncharacterized HTH-type transcriptional
  174::253     3e-04  25%  745 aa  Y078_STAAS RecName: Full=Uncharacterized HTH-type transcriptional
  174::253     3e-04  25%  745 aa  Y077_STAAW RecName: Full=Uncharacterized HTH-type transcriptional
   70::126     3e-04  33%  138 aa  TETD_ECOLX RecName: Full=Transposon Tn10 tetD protein;AltName:
  216::274     3e-04  29%  290 aa  RHAR_YERPY RecName: Full=HTH-type transcriptional activator
  216::274     3e-04  29%  290 aa  RHAR_YERPS RecName: Full=HTH-type transcriptional activator
  216::274     3e-04  29%  290 aa  RHAR_YERPP RecName: Full=HTH-type transcriptional activator
  216::274     3e-04  29%  290 aa  RHAR_YERPN RecName: Full=HTH-type transcriptional activator
  216::274     3e-04  29%  290 aa  RHAR_YERPG RecName: Full=HTH-type transcriptional activator
  216::274     3e-04  29%  290 aa  RHAR_YERPE RecName: Full=HTH-type transcriptional activator
  216::274     3e-04  29%  290 aa  RHAR_YERPB RecName: Full=HTH-type transcriptional activator
  216::274     3e-04  29%  290 aa  RHAR_YERPA RecName: Full=HTH-type transcriptional activator
  216::274     3e-04  29%  290 aa  RHAR_YERP3 RecName: Full=HTH-type transcriptional activator
  171::279     3e-04  20%  282 aa  RHAR_SALSV RecName: Full=HTH-type transcriptional activator
  192::281     3e-04  27%  310 aa  ARAC_ERWCH RecName: Full=Arabinose operon regulatory protein;
  174::253     4e-04  25%  745 aa  Y084_STAAC RecName: Full=Uncharacterized HTH-type transcriptional
  197::276     4e-04  30%  281 aa  ARAC_SALTY RecName: Full=Arabinose operon regulatory protein;
  197::276     4e-04  30%  292 aa  ARAC_ECOLI RecName: Full=Arabinose operon regulatory protein;
  197::276     4e-04  30%  292 aa  ARAC_ECO57 RecName: Full=Arabinose operon regulatory protein;
  197::276     4e-04  30%  281 aa  ARAC_CITFR RecName: Full=Arabinose operon regulatory protein;
  160::267     5e-04  25%  283 aa  YIJO_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
  174::253     5e-04  27%  745 aa  YHTH1_STAAU RecName: Full=Uncharacterized HTH-type transcriptional
  192::266     5e-04  28%  273 aa  RHAS_YERPY RecName: Full=HTH-type transcriptional activator
  192::266     5e-04  28%  273 aa  RHAS_YERPS RecName: Full=HTH-type transcriptional activator
  192::266     5e-04  28%  273 aa  RHAS_YERPP RecName: Full=HTH-type transcriptional activator
  192::266     5e-04  28%  273 aa  RHAS_YERPG RecName: Full=HTH-type transcriptional activator
  192::266     5e-04  28%  273 aa  RHAS_YERPB RecName: Full=HTH-type transcriptional activator
  192::266     5e-04  28%  273 aa  RHAS_YERP3 RecName: Full=HTH-type transcriptional activator
  166::256     9e-04  33%  273 aa  YEAM_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    1::309

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MENVTFVSNSHQRPAADNLQKLKSLLTNTRQQIKSQTQQVTIKNLYVSSFTLVCFRSGKLTISNNHDTIY
HILD_SALTY      MENVTFVSNSHQRPAADNLQKLKSLLTNTRQQIKSQTQQVTIKNLYVSSFTLVCFRSGKLTISNNHDTIY
SIRC_SALTY      -----------------------------------------VRDYYVANCLLFKLNKGSLRIENEFEFIE
SIRC_SALTI      -----------------------------------------VRDYYVANCLLFKLNKGSLRIENEFEFIE
APPY_ECOLI      ----------------------------------------------------------------------
FAPR_ECOLX      -----------------------------------------LKNIHLYNYVVIYTKNCEIYINKGNEQVY
GADW_SHIFL      ----------------------------------------------------------------------
GADW_ECOLI      ----------------------------------------------------------------------
GADW_ECOL6      ----------------------------------------------------------------------
GADW_ECO57      ----------------------------------------------------------------------
PERA_ECO27      ----------------------------------------------------------------------
URER_ECOLX      --------------------------------------QMVLKAFYIESAMIAMLTGAKGNIVINGQSIE
YDEO_ECOLI      ----------------------------------------------------------------------
YDEO_SHIFL      ----------------------------------------------------------------------
YDEO_ECOL6      ----------------------------------------------------------------------
YDEO_ECO57      ----------------------------------------------------------------------
URER_PROMH      ----------------------------------------------------------------------
AGGR_ECOLX      ----------------------------------------------------------------------
RNS_ECOLX       ----------------------------------------------------------------------
VIRF_SHISO      -----------------------------------------------------------MTVSSGNETLT
VIRF_SHIFL      -----------------------------------------------------------MTVSSGNETLT
VIRF_SHIDY      -----------------------------------------------------------MTVSSGNETLT
CFAD_ECOLX      ----------------------------------------------------------------------
CSVR_ECOLX      ----------------------------------------------------------------------
GADX_ECOL6      ----------------------------------------------------------------------
GADX_ECO27      ----------------------------------------------------------------------
YBCM_ECOLI      ----------------------------------------------------------------------
GADX_SHIFL      ----------------------------------------------------------------------
GADX_ECOLI      ----------------------------------------------------------------------
GADX_ECO57      ----------------------------------------------------------------------
ENVY_ECOLI      ----------------------------------------------------------------------
ADIY_ECOLI      ----------------------------------------------------------------------
TCPN_VIBCH      ----------------------------------------------------------------------
TCPN_VIBC3      ----------------------------------------------------------------------
Y1430_MYCBO     ----------------------------------------------------------------------
Y1395_MYCTU     ----------------------------------------------------------------------
YFIF_BACSU      ----------------------------------------------------------------------
VQSM_PSEAE      ----------------------------------------------------------------------
RHAR_MANSM      ----------------------------------------------------------------------
Y1052_HAEIN     ----------------------------------------------------------------------
XYLR_ECOLI      ----------------------------------------------------------------------
XYLR_ECOL6      ----------------------------------------------------------------------
XYLR_ECO57      ----------------------------------------------------------------------
XYLR_HAEIN      ----------------------------------------------------------------------
POCR_SALTY      ----------------------------------------------------------------------
VIRS_MYCTU      ----------------------------------------------------------------------
RIPA_CORGL      ----------------------------------------------------------------------
RHAS_SALTY      ----------------------------------------------------------------------
RHAS_SALTI      ----------------------------------------------------------------------
RHAS_SALSV      ----------------------------------------------------------------------
RHAS_SALPK      ----------------------------------------------------------------------
RHAS_SALPC      ----------------------------------------------------------------------
RHAS_SALPB      ----------------------------------------------------------------------
RHAS_SALPA      ----------------------------------------------------------------------
RHAS_SALNS      ----------------------------------------------------------------------
RHAS_SALHS      ----------------------------------------------------------------------
RHAS_SALG2      ----------------------------------------------------------------------
RHAS_SALEP      ----------------------------------------------------------------------
RHAS_SALDC      ----------------------------------------------------------------------
RHAS_SALCH      ----------------------------------------------------------------------
RHAS_SALAR      ----------------------------------------------------------------------
RHAS_SALA4      ----------------------------------------------------------------------
ARACL_STRLI     ----------------------------------------------------------------------
VIRF_YEREN      ----------------------------------------------------------------------
RHRA_RHIME      ----------------------------------------------------------------------
RHAS_SHISS      ----------------------------------------------------------------------
RHAS_SHIFL      ----------------------------------------------------------------------
RHAS_SHIF8      ----------------------------------------------------------------------
RHAS_SHIDS      ----------------------------------------------------------------------
RHAS_SHIBS      ----------------------------------------------------------------------
RHAS_ECOSM      ----------------------------------------------------------------------
RHAS_ECOLI      ----------------------------------------------------------------------
RHAS_ECOLC      ----------------------------------------------------------------------
RHAS_ECOL6      ----------------------------------------------------------------------
RHAS_ECOL5      ----------------------------------------------------------------------
RHAS_ECOHS      ----------------------------------------------------------------------
RHAS_ECODH      ----------------------------------------------------------------------
RHAS_ECOBW      ----------------------------------------------------------------------
RHAS_ECO8A      ----------------------------------------------------------------------
RHAS_ECO81      ----------------------------------------------------------------------
RHAS_ECO55      ----------------------------------------------------------------------
RHAS_ECO27      ----------------------------------------------------------------------
LCRF_YERPE      ----------------------------------------------------------------------
CHBR_ECOLI      ----------------------------------------------------------------------
RHAS_ECOUT      ----------------------------------------------------------------------
RHAS_ECOLU      ----------------------------------------------------------------------
RHAS_ECOK1      ----------------------------------------------------------------------
RHAS_ECO7I      ----------------------------------------------------------------------
RHAS_ECO45      ----------------------------------------------------------------------
RHAS_CITK8      ----------------------------------------------------------------------
EXSA_PSEAE      ----------------------------------------------------------------------
RHAS_SHIB3      ----------------------------------------------------------------------
RHAS_KLEP3      ----------------------------------------------------------------------
RHAS_ECO5E      ----------------------------------------------------------------------
RHAS_ECO57      ----------------------------------------------------------------------
RIPA_CORDI      ----------------------------------------------------------------------
RHAS_KLEP7      ----------------------------------------------------------------------
RHAS_ECOSE      ----------------------------------------------------------------------
RHAS_ECO24      ----------------------------------------------------------------------
GLXA_RHIME      ----------------------------------------------------------------------
YPDC_ECOLI      ----------------------------------------------------------------------
PQRA_PROVU      ----------------------------------------------------------------------
RHAS_ENT38      ----------------------------------------------------------------------
YBBB_BACSU      ----------------------------------------------------------------------
RHAS_ESCF3      ----------------------------------------------------------------------
RHAR_ERWCT      ----------------------------------------------------------------------
YESN_BACSU      ----------------------------------------------------------------------
Y107_STAAR      ----------------------------------------------------------------------
RHAR_PECCP      ----------------------------------------------------------------------
VIRF_YERE8      ----------------------------------------------------------------------
RHAS_MANSM      ----------------------------------------------------------------------
MSMR_STRMU      ----------------------------------------------------------------------
AARP_PROST      ----------------------------------------------------------------------
YDEC_BACSU      ----------------------------------------------------------------------
YQHC_ECOLI      ----------------------------------------------------------------------
Y101_STAAM      ----------------------------------------------------------------------
Y097_STAAN      ----------------------------------------------------------------------
Y078_STAAS      ----------------------------------------------------------------------
Y077_STAAW      ----------------------------------------------------------------------
TETD_ECOLX      ----------------------------------------------------------------------
RHAR_YERPY      ----------------------------------------------------------------------
RHAR_YERPS      ----------------------------------------------------------------------
RHAR_YERPP      ----------------------------------------------------------------------
RHAR_YERPN      ----------------------------------------------------------------------
RHAR_YERPG      ----------------------------------------------------------------------
RHAR_YERPE      ----------------------------------------------------------------------
RHAR_YERPB      ----------------------------------------------------------------------
RHAR_YERPA      ----------------------------------------------------------------------
RHAR_YERP3      ----------------------------------------------------------------------
RHAR_SALSV      ----------------------------------------------------------------------
ARAC_ERWCH      ----------------------------------------------------------------------
Y084_STAAC      ----------------------------------------------------------------------
ARAC_SALTY      ----------------------------------------------------------------------
ARAC_ECOLI      ----------------------------------------------------------------------
ARAC_ECO57      ----------------------------------------------------------------------
ARAC_CITFR      ----------------------------------------------------------------------
YIJO_ECOLI      ----------------------------------------------------------------------
YHTH1_STAAU     ----------------------------------------------------------------------
RHAS_YERPY      ----------------------------------------------------------------------
RHAS_YERPS      ----------------------------------------------------------------------
RHAS_YERPP      ----------------------------------------------------------------------
RHAS_YERPG      ----------------------------------------------------------------------
RHAS_YERPB      ----------------------------------------------------------------------
RHAS_YERP3      ----------------------------------------------------------------------
YEAM_ECOLI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           CDEPGMLVLKKEQVVNVTLEEVNGHMDFDILEIPTQRLGALYALIPNEQQTKMAVPTEKAQKIIYTPDFP
HILD_SALTY      CDEPGMLVLKKEQVVNVTLEEVNGHMDFDILEIPTQRLGALYALIPNEQQTKMAVPTEKAQKIFYTPDFP
SIRC_SALTY      RSAPCLFLLEKDQTITLSMSEIEGHIDFSSLEVSYDLMQKFYKVFRNYNDRELSLKT-KPKYFFHADLLP
SIRC_SALTI      QSALCLFLLEKDQTITLSMSEIEGHIDFSSLEVSYDLMQKFYKVFRNYNDRELSLKT-KPKYFFHADLLP
APPY_ECOLI      ----------------------------------------------------------------------
FAPR_ECOLX      IPPRMVAIFEKNISFNIETIRKGDGVLYESFDMKHELLTSLRRVI--EPSVKFAAESYTNKRSFKERIFK
GADW_SHIFL      ----------------------------------------------------------------------
GADW_ECOLI      ----------------------------------------------------------------------
GADW_ECOL6      ----------------------------------------------------------------------
GADW_ECO57      ----------------------------------------------------------------------
PERA_ECO27      ----------------------------------------------------------------------
URER_ECOLX      IESDVTLIIPKYSQVNIVCNTVKQPLELHTLSMSAEELQAVFLLL--KTLMKSGAPLTSHQPIYHISPPE
YDEO_ECOLI      ----------------------------------------------------------------------
YDEO_SHIFL      ----------------------------------------------------------------------
YDEO_ECOL6      ----------------------------------------------------------------------
YDEO_ECO57      ----------------------------------------------------------------------
URER_PROMH      ----------------------------------------------------------------------
AGGR_ECOLX      ----------------------------------------------------------------------
RNS_ECOLX       ----------------------------------------------------------------------
VIRF_SHISO      IDEGQIAFIERNIQINVSIKKSDSINPFEIISLDRNLLLSIIRIMEPIYSFQHSYSEEKRKKIFLLSEEE
VIRF_SHIFL      IDEGQIAFIERNIQINVSIKKSDSINPFEIISLDRNLLLSIIRIMEPIYSFQHSYSEEKRKKIFLLSEEE
VIRF_SHIDY      IDEGQIAFIERNIQINVSIKKSDSINPFEIISLDRNLLLSIIRIMEPIYSFQHSYSEEKRKKIFLLSEEE
CFAD_ECOLX      ----------------------------------------------------------------------
CSVR_ECOLX      ----------------------------------------------------------------------
GADX_ECOL6      ----------------------------------------------------------------------
GADX_ECO27      ----------------------------------------------------------------------
YBCM_ECOLI      ----------------------------------------------------------------------
GADX_SHIFL      ----------------------------------------------------------------------
GADX_ECOLI      ----------------------------------------------------------------------
GADX_ECO57      ----------------------------------------------------------------------
ENVY_ECOLI      ----------------------------------------------------------------------
ADIY_ECOLI      ----------------------------------------------------------------------
TCPN_VIBCH      ----------------------------------------------------------------------
TCPN_VIBC3      ----------------------------------------------------------------------
Y1430_MYCBO     ----------------------------------------------------------------------
Y1395_MYCTU     ----------------------------------------------------------------------
YFIF_BACSU      ----------------------------------------------------------------------
VQSM_PSEAE      ----------------------------------------------------------------------
RHAR_MANSM      ----------------------------------------------------------------------
Y1052_HAEIN     ----------------------------------------------------------------------
XYLR_ECOLI      ----------------------------------------------------------------------
XYLR_ECOL6      ----------------------------------------------------------------------
XYLR_ECO57      ----------------------------------------------------------------------
XYLR_HAEIN      ----------------------------------------------------------------------
POCR_SALTY      ----------------------------------------------------------------------
VIRS_MYCTU      ----------------------------------------------------------------------
RIPA_CORGL      ----------------------------------------------------------------------
RHAS_SALTY      ----------------------------------------------------------------------
RHAS_SALTI      ----------------------------------------------------------------------
RHAS_SALSV      ----------------------------------------------------------------------
RHAS_SALPK      ----------------------------------------------------------------------
RHAS_SALPC      ----------------------------------------------------------------------
RHAS_SALPB      ----------------------------------------------------------------------
RHAS_SALPA      ----------------------------------------------------------------------
RHAS_SALNS      ----------------------------------------------------------------------
RHAS_SALHS      ----------------------------------------------------------------------
RHAS_SALG2      ----------------------------------------------------------------------
RHAS_SALEP      ----------------------------------------------------------------------
RHAS_SALDC      ----------------------------------------------------------------------
RHAS_SALCH      ----------------------------------------------------------------------
RHAS_SALAR      ----------------------------------------------------------------------
RHAS_SALA4      ----------------------------------------------------------------------
ARACL_STRLI     ----------------------------------------------------------------------
VIRF_YEREN      ----------------------------------------------------------------------
RHRA_RHIME      ----------------------------------------------------------------------
RHAS_SHISS      ----------------------------------------------------------------------
RHAS_SHIFL      ----------------------------------------------------------------------
RHAS_SHIF8      ----------------------------------------------------------------------
RHAS_SHIDS      ----------------------------------------------------------------------
RHAS_SHIBS      ----------------------------------------------------------------------
RHAS_ECOSM      ----------------------------------------------------------------------
RHAS_ECOLI      ----------------------------------------------------------------------
RHAS_ECOLC      ----------------------------------------------------------------------
RHAS_ECOL6      ----------------------------------------------------------------------
RHAS_ECOL5      ----------------------------------------------------------------------
RHAS_ECOHS      ----------------------------------------------------------------------
RHAS_ECODH      ----------------------------------------------------------------------
RHAS_ECOBW      ----------------------------------------------------------------------
RHAS_ECO8A      ----------------------------------------------------------------------
RHAS_ECO81      ----------------------------------------------------------------------
RHAS_ECO55      ----------------------------------------------------------------------
RHAS_ECO27      ----------------------------------------------------------------------
LCRF_YERPE      ----------------------------------------------------------------------
CHBR_ECOLI      ----------------------------------------------------------------------
RHAS_ECOUT      ----------------------------------------------------------------------
RHAS_ECOLU      ----------------------------------------------------------------------
RHAS_ECOK1      ----------------------------------------------------------------------
RHAS_ECO7I      ----------------------------------------------------------------------
RHAS_ECO45      ----------------------------------------------------------------------
RHAS_CITK8      ----------------------------------------------------------------------
EXSA_PSEAE      ----------------------------------------------------------------------
RHAS_SHIB3      ----------------------------------------------------------------------
RHAS_KLEP3      ----------------------------------------------------------------------
RHAS_ECO5E      ----------------------------------------------------------------------
RHAS_ECO57      ----------------------------------------------------------------------
RIPA_CORDI      ----------------------------------------------------------------------
RHAS_KLEP7      ----------------------------------------------------------------------
RHAS_ECOSE      ----------------------------------------------------------------------
RHAS_ECO24      ----------------------------------------------------------------------
GLXA_RHIME      ----------------------------------------------------------------------
YPDC_ECOLI      ----------------------------------------------------------------------
PQRA_PROVU      ----------------------------------------------------------------------
RHAS_ENT38      ----------------------------------------------------------------------
YBBB_BACSU      ----------------------------------------------------------------------
RHAS_ESCF3      ----------------------------------------------------------------------
RHAR_ERWCT      ----------------------------------------------------------------------
YESN_BACSU      ----------------------------------------------------------------------
Y107_STAAR      ----------------------------------------------------------------------
RHAR_PECCP      ----------------------------------------------------------------------
VIRF_YERE8      ----------------------------------------------------------------------
RHAS_MANSM      ----------------------------------------------------------------------
MSMR_STRMU      ----------------------------------------------------------------------
AARP_PROST      ----------------------------------------------------------------------
YDEC_BACSU      ----------------------------------------------------------------------
YQHC_ECOLI      ----------------------------------------------------------------------
Y101_STAAM      ----------------------------------------------------------------------
Y097_STAAN      ----------------------------------------------------------------------
Y078_STAAS      ----------------------------------------------------------------------
Y077_STAAW      ----------------------------------------------------------------------
TETD_ECOLX      ----------------------------------------------------------------------
RHAR_YERPY      ----------------------------------------------------------------------
RHAR_YERPS      ----------------------------------------------------------------------
RHAR_YERPP      ----------------------------------------------------------------------
RHAR_YERPN      ----------------------------------------------------------------------
RHAR_YERPG      ----------------------------------------------------------------------
RHAR_YERPE      ----------------------------------------------------------------------
RHAR_YERPB      ----------------------------------------------------------------------
RHAR_YERPA      ----------------------------------------------------------------------
RHAR_YERP3      ----------------------------------------------------------------------
RHAR_SALSV      ----------------------------------------------------------------------
ARAC_ERWCH      ----------------------------------------------------------------------
Y084_STAAC      ----------------------------------------------------------------------
ARAC_SALTY      ----------------------------------------------------------------------
ARAC_ECOLI      ----------------------------------------------------------------------
ARAC_ECO57      ----------------------------------------------------------------------
ARAC_CITFR      ----------------------------------------------------------------------
YIJO_ECOLI      ----------------------------------------------------------------------
YHTH1_STAAU     ----------------------------------------------------------------------
RHAS_YERPY      ----------------------------------------------------------------------
RHAS_YERPS      ----------------------------------------------------------------------
RHAS_YERPP      ----------------------------------------------------------------------
RHAS_YERPG      ----------------------------------------------------------------------
RHAS_YERPB      ----------------------------------------------------------------------
RHAS_YERP3      ----------------------------------------------------------------------
YEAM_ECOLI      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ARREVFEHLKTAFSCTKDTSKGCSNCNNKSCIENEELIPYXXXXXXXXXXXXPESYEIILSSAQITLKER
HILD_SALTY      ARREVFEHLKTAFSCTKDTSKGCSNCNNKSCIENEELIPYXXXXXXXXXXXXPESYEIILSSAQITLKER
SIRC_SALTY      GMSDTFDSILHGVACPRV----CSNVS----IDDHDYSYFSLMYLISAFVRKPGGFDFLERAIKITTKEK
SIRC_SALTI      GMSDTFDSILHGVACPRV----CSNVS----IDDHDYSYFSLMYLISAFVRKPGGFDFLERAIKITTKEK
APPY_ECOLI      ---------------------------------------------------------------------K
FAPR_ECOLX      VKSDLFKRLKDEFTAIYELAFLVSKCEN------------------------PSMFAISLSSVAVTFSER
GADW_SHIFL      ----------------------------------------------------------LLFNSISTVSGK
GADW_ECOLI      ----------------------------------------------------------LLFNSISTVSGK
GADW_ECOL6      ----------------------------------------------------------LLFNSISTVSGK
GADW_ECO57      ----------------------------------------------------------LLFNSISTVSGK
PERA_ECO27      ---------------------------------------------------------VILSASSKSIVDR
URER_ECOLX      TVRDNFSLLKQCLPLKKQSA-------------SQEALLMKQSLYFILMAIYQEGIDILRFNYDEPKNQA
YDEO_ECOLI      ----------------------------------------------------------LLTNGVLSVSGK
YDEO_SHIFL      ----------------------------------------------------------LLTNGVLSVSGK
YDEO_ECOL6      ----------------------------------------------------------LLTNGVLSVSGK
YDEO_ECO57      ----------------------------------------------------------LLTNGVLSVSGK
URER_PROMH      --------------------------------------------------------------------QA
AGGR_ECOLX      --------------------------------------------------------ESIYISAVSFFSDK
RNS_ECOLX       -----------------------------------------------------ENNEKIIESIYISFSDK
VIRF_SHISO      VSIDLFKSIKEMFGKRKIYSLACL----LSAVSDEEAL-----------------YTXXXXXXXXXXXXX
VIRF_SHIFL      VSIDLFKSIKEMFGKRKIYSLACL----LSAVSDEEAL-----------------YTXXXXXXXXXXXXX
VIRF_SHIDY      VSIDLFKSIKEMFGKRKIYSLACL----LSAVSDEEAL-----------------YTXXXXXXXXXXXXX
CFAD_ECOLX      --------------------------------------------------------------------DK
CSVR_ECOLX      --------------------------------------------------------ESLYMSSITFFTDK
GADX_ECOL6      ---------------------------------------------------------LLLNVLQPNMRTR
GADX_ECO27      ---------------------------------------------------------LLLNVLQPNMRTR
YBCM_ECOLI      ---------------------------------------------------------LLLSYSKQSLISR
GADX_SHIFL      ---------------------------------------------------------LLLNVLQPNMRTR
GADX_ECOLI      ---------------------------------------------------------LLLNVLQPNMRTR
GADX_ECO57      ---------------------------------------------------------LLLNVLQPNMRTR
ENVY_ECOLI      -----------------------------------------------------------------SVRDS
ADIY_ECOLI      ------------------------------------------------------------------VSDS
TCPN_VIBCH      -----------------------------------------------------KKYNSIFITDDLDAMEK
TCPN_VIBC3      -----------------------------------------------------KKYNSIFITDDLDAMEK
Y1430_MYCBO     ----------------------------------------------------------------------
Y1395_MYCTU     ----------------------------------------------------------------------
YFIF_BACSU      ----------------------------------------------------PKQKQPIHTSSALLTEVK
VQSM_PSEAE      -----------------------------------------------------ESFNALLEVEMGGLRQR
RHAR_MANSM      --------------------------------------------------------------SDISKLES
Y1052_HAEIN     ----------------------------------------------------------------------
XYLR_ECOLI      ----------------------------------------------------------------------
XYLR_ECOL6      ----------------------------------------------------------------------
XYLR_ECO57      ----------------------------------------------------------------------
XYLR_HAEIN      ----------------------------------------------------------------------
POCR_SALTY      --------------------------------------------------------------------KK
VIRS_MYCTU      -----------------------------------------------------------------TLSER
RIPA_CORGL      ----------------------------------------------------------------------
RHAS_SALTY      ----------------------------------------------------------------------
RHAS_SALTI      ----------------------------------------------------------------------
RHAS_SALSV      ----------------------------------------------------------------------
RHAS_SALPK      ----------------------------------------------------------------------
RHAS_SALPC      ----------------------------------------------------------------------
RHAS_SALPB      ----------------------------------------------------------------------
RHAS_SALPA      ----------------------------------------------------------------------
RHAS_SALNS      ----------------------------------------------------------------------
RHAS_SALHS      ----------------------------------------------------------------------
RHAS_SALG2      ----------------------------------------------------------------------
RHAS_SALEP      ----------------------------------------------------------------------
RHAS_SALDC      ----------------------------------------------------------------------
RHAS_SALCH      ----------------------------------------------------------------------
RHAS_SALAR      ----------------------------------------------------------------------
RHAS_SALA4      ----------------------------------------------------------------------
ARACL_STRLI     ----------------------------------------------------------------------
VIRF_YEREN      -------------------------------------------------------------------EER
RHRA_RHIME      ----------------------------------------------------------------------
RHAS_SHISS      ----------------------------------------------------------------------
RHAS_SHIFL      ----------------------------------------------------------------------
RHAS_SHIF8      ----------------------------------------------------------------------
RHAS_SHIDS      ----------------------------------------------------------------------
RHAS_SHIBS      ----------------------------------------------------------------------
RHAS_ECOSM      ----------------------------------------------------------------------
RHAS_ECOLI      ----------------------------------------------------------------------
RHAS_ECOLC      ----------------------------------------------------------------------
RHAS_ECOL6      ----------------------------------------------------------------------
RHAS_ECOL5      ----------------------------------------------------------------------
RHAS_ECOHS      ----------------------------------------------------------------------
RHAS_ECODH      ----------------------------------------------------------------------
RHAS_ECOBW      ----------------------------------------------------------------------
RHAS_ECO8A      ----------------------------------------------------------------------
RHAS_ECO81      ----------------------------------------------------------------------
RHAS_ECO55      ----------------------------------------------------------------------
RHAS_ECO27      ----------------------------------------------------------------------
LCRF_YERPE      -------------------------------------------------------------------EER
CHBR_ECOLI      ----------------------------------------------------------------------
RHAS_ECOUT      ----------------------------------------------------------------------
RHAS_ECOLU      ----------------------------------------------------------------------
RHAS_ECOK1      ----------------------------------------------------------------------
RHAS_ECO7I      ----------------------------------------------------------------------
RHAS_ECO45      ----------------------------------------------------------------------
RHAS_CITK8      ----------------------------------------------------------------------
EXSA_PSEAE      --------------------------------------------------------------------ER
RHAS_SHIB3      ----------------------------------------------------------------------
RHAS_KLEP3      ----------------------------------------------------------------------
RHAS_ECO5E      ----------------------------------------------------------------------
RHAS_ECO57      ----------------------------------------------------------------------
RIPA_CORDI      ----------------------------------------------------------------------
RHAS_KLEP7      ----------------------------------------------------------------------
RHAS_ECOSE      ----------------------------------------------------------------------
RHAS_ECO24      ----------------------------------------------------------------------
GLXA_RHIME      ----------------------------------------------------------------------
YPDC_ECOLI      ------------------------------------------------------------------LYHS
PQRA_PROVU      ----------------------------------------------------------------------
RHAS_ENT38      ----------------------------------------------------------------------
YBBB_BACSU      ----------------------------------------------------------------------
RHAS_ESCF3      ----------------------------------------------------------------------
RHAR_ERWCT      ----------------------------------------------------------------------
YESN_BACSU      ----------------------------------------------------------------------
Y107_STAAR      ----------------------------------------------------------------------
RHAR_PECCP      ----------------------------------------------------------------------
VIRF_YERE8      -------------------------------------------------------------------EER
RHAS_MANSM      ----------------------------------------------------------------------
MSMR_STRMU      ---------------------------------------------------------------------Q
AARP_PROST      ----------------------------------------------------PISYSRKHTQFQSSIISE
YDEC_BACSU      ----------------------------------------------------------------------
YQHC_ECOLI      ---------------------------------------------------------LVSRQTHFSLISR
Y101_STAAM      ----------------------------------------------------------------------
Y097_STAAN      ----------------------------------------------------------------------
Y078_STAAS      ----------------------------------------------------------------------
Y077_STAAW      ----------------------------------------------------------------------
TETD_ECOLX      ----------------------------------------------------------------------
RHAR_YERPY      ----------------------------------------------------------------------
RHAR_YERPS      ----------------------------------------------------------------------
RHAR_YERPP      ----------------------------------------------------------------------
RHAR_YERPN      ----------------------------------------------------------------------
RHAR_YERPG      ----------------------------------------------------------------------
RHAR_YERPE      ----------------------------------------------------------------------
RHAR_YERPB      ----------------------------------------------------------------------
RHAR_YERPA      ----------------------------------------------------------------------
RHAR_YERP3      ----------------------------------------------------------------------
RHAR_SALSV      ------------------------------------------------------------ATSRETLLDK
ARAC_ERWCH      ----------------------------------------------------------------------
Y084_STAAC      ----------------------------------------------------------------------
ARAC_SALTY      ----------------------------------------------------------------------
ARAC_ECOLI      ----------------------------------------------------------------------
ARAC_ECO57      ----------------------------------------------------------------------
ARAC_CITFR      ----------------------------------------------------------------------
YIJO_ECOLI      --------------------------------------------------------QIQTASRSQALFEA
YHTH1_STAAU     ----------------------------------------------------------------------
RHAS_YERPY      ----------------------------------------------------------------------
RHAS_YERPS      ----------------------------------------------------------------------
RHAS_YERPP      ----------------------------------------------------------------------
RHAS_YERPG      ----------------------------------------------------------------------
RHAS_YERPB      ----------------------------------------------------------------------
RHAS_YERP3      ----------------------------------------------------------------------
YEAM_ECOLI      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VYNIISSSPSRQWKLTDVADHIFMSTSTLKRKLAEEGTSFSDIYLSARMNQAAKLLRIGNHNVNAVALKC
HILD_SALTY      VYNIISSSPSRQWKLTDVADHIFMSTSTLKRKLAEEGTSFSDIYLSARMNQAAKLLRIGNHNVNAVALKC
SIRC_SALTY      VYNIIISDLTRKWSQAEVAGKLFMSVSSLKRKLAAEEVSFSKIYLDARMNQAIKLLRMGAGNISQVATMC
SIRC_SALTI      VYNIIISDLTRKWSQAEVAGKLFMSVSSLKRKLAAEEVSFSKIYLDARMNQAIKLLRMGAGNISQVATMC
APPY_ECOLI      ITGIISFNIERQWHLKDIAELIYTSESLIKKRLRDEGTSFTEILRDTRMRYAKKLITSNSYSINVVAQKC
FAPR_ECOLX      IVTLLFSDLTRKWKLSDIAEEMHISEISVRKRLEQECLNFNQLILDVRMNQAAKFIIRSDHQIGMIASLV
GADW_SHIFL      VERLISFDIAKRWYLRDIAERMYTSESLIKKKLQDENTCFSKILLASRMSMARRLLELRQIPLHTIAEKC
GADW_ECOLI      VERLISFDIAKRWYLRDIAERMYTSESLIKKKLQDENTCFSKILLASRMSMARRLLELRQIPLHTIAEKC
GADW_ECOL6      VERLISFDIAKRWYLRDIAERMYTSESLIKKKLQDENTCFSKILLASRMSMARRLLELRQIPLHTIAEKC
GADW_ECO57      VERLISFDIAKRWYLRDIAERMYTSESLIKKKLQDENTCFSKILLASRMSMARRLLELRQIPLHTIAEKC
PERA_ECO27      VIKVIELDISKNWKLGDVSSSMFMSDSCLRKQLNKENLTFKKIMLDIKMKHASLFLRTTDKNIDEISCLV
URER_ECOLX      ITHLITQEPQKKWHLDDVAKALFTTPSTLRRHLNREGVSFRQLLLDVRMGMALNYLTFSNYSVFQISHRC
YDEO_ECOLI      VRNIVNMKPAHPWKLKDICDCLYISESXXXXXXXQEQTTFSQILLDARMQHAKNLIRV-EGSVNKIAEQC
YDEO_SHIFL      VRNIVNMKLAHPWKLKDICDCLYISESXXXXXXXQEQTTFSQILLDARMQHAKNLIRV-EGSVNKIAEQC
YDEO_ECOL6      VRNIVNMKLAHPWKLKDICDCLYISESXXXXXXXQEQTTFSQILLDARMQHAKNLIRV-EGSVNKIAEQC
YDEO_ECO57      VRNIVNMKLAHPWKLKDICDCLYISESXXXXXXXQEQTTFSQILLDARMQHAKNLIRV-EGSVNKIAEQC
URER_PROMH      ITHLITQDPQRKWHLEDVAKTLYTTPSTLRRHLSKEGVSFCQLLLDVRMPIALNYLTFSNYSVFQISHRC
AGGR_ECOLX      VRNTIEKDLSKRWTLAIIADEFNVSEITIRKRLESEYITFNQILMQSRMSKAALLLLDNSYQISQISNMI
RNS_ECOLX       VRNLIEKDLSRKWTLGIIADAFNASEITIRKRLESENTNFNQILMQLRMSKAALLLLENSYQISQISNMI
VIRF_SHISO      XRKIVEKNIEKRWRLSDISNNLNLSEIAVRKRLESEKLTFQQILLDIRMHHAAKLLLNSQSYINDVSRLI
VIRF_SHIFL      XRKIVEKNIEKRWRLSDISNNLNLSEIAVRKRLESEKLTFQQILLDIRMHHAAKLLLNSQSYINDVSRLI
VIRF_SHIDY      XRKIVEKNIEKRWRLSDISNNLNLSEIAVRKRLESEKLTFQQILLDIRMHHAAKLLLNSQSYINDVSRLI
CFAD_ECOLX      VRNVIEKDLSRKWTLGIIADAFNVSEITIRKRLESENTNFNQILMQLRMSKAALLLLENSYQISQISNMI
CSVR_ECOLX      VRGVIEKDLSRKWTLAIIADVFNVSEITIRKRLESEDTNFNQILMQSRMSKAALLLLENSYQISQISNMI
GADX_ECOL6      VCTVINNNIAHEWTLARIAXXXXXXXXXXXXXXREEGTSYSQLLTECRMQRALQLIVIYGVSIKRVAVSC
GADX_ECO27      VCTVINNNIAHEWTLARIAXXXXXXXXXXXXXXREEGTSYSQLLTECRMQRALQLIVIYGVSIKRVAVSC
YBCM_ECOLI      CYNLLLSEPGTKWTANKVARYLYISVSTLHRRLASEGVSFQSILDDVRLNNALSAIQTTVKPISEIAREN
GADX_SHIFL      VCTVINNNIAHEWTLARIAXXXXXXXXXXXXXXREEETSYSQLLTECRMQRALQLIVIHGFSIKRVAVSC
GADX_ECOLI      VCTVINNNIAHEWTLARIAXXXXXXXXXXXXXXREEETSYSQLLTECRMQRALQLIVIHGFSIKRVAVSC
GADX_ECO57      VCTVINNNIAHEWTLARIAXXXXXXXXXXXXXXREEETSYSQLLTECRMQRALQLIVIHGFSIKRVAVSC
ENVY_ECOLI      VCRIIQSDIQHYWNLRIVAXXXXXXXXXXXXXXXNENTSYSQIVTECRMRYAVQMLLMDNKNITQVAQLC
ADIY_ECOLI      VYQIIESDIHKDWNLSMVAXXXXXXXXXXXXXXXXENTSYSQIITTCRMRYAVNELMMDGKNISQVSQSC
TCPN_VIBCH      ISCLVKSDITRNWRWADICGELRTNRMILKKELESRGVKFRELINSIRISYSISLMKTGEFKIKQIAYQS
TCPN_VIBC3      ISCLVKSDITRNWRWADICGELRTNRMILKKELESRGVKFRELINSIRISYSISLMKTGEFKIKQIAYQS
Y1430_MYCBO     ---------------TDVAGELDMHPRTLRRRLAEEGTSFRALLGEARSTVAVDLLRNVGLTVQQVSTRL
Y1395_MYCTU     ---------------TDVAGELDMHPRTLRRRLAEEGTSFRALLGEARSTVAVDLLRNVGLTVQQVSTRL
YFIF_BACSU      LH--IKDNLSQPLKLTDVASHFHISGRHLSRLFAAEGVSYSEFVQNEKINKAAELLKSTNLSIKEIAEEI
VQSM_PSEAE      IELFLDSIPDQYPSLVTTAKYLRMNERTVRRRLADEGCTYRQIVDKARKERAIALLLNSSIPVDRISDIL
RHAR_MANSM      LFSALNQSISQEFYLADFCRQHQLAVSSVRRIFKQQTNMTIAQYLQKRLCRAATLLRNTSESVANIAIRC
Y1052_HAEIN     ----ILQQPQNDWHIEQLAELATMSRANFIRIFQQHGMSPGRFLTKVRLQSAAFLLKQSQQSVLAIALEV
XYLR_ECOLI      -------------KVDQVLDAVGISRSNLEKRFKEEGETIHAMIHAEKLEKARSLLISTTLSINEISQMC
XYLR_ECOL6      -------------KVDQVLDAVGISRSNLEKRFKEEGETIHAMIHAEKLEKARSLLISTTLSINEISQMC
XYLR_ECO57      -------------KVDQVLDAVGISRSNLEKRFKEEGETIHAMIHAEKLEKARSLLISTTLSINEISQMC
XYLR_HAEIN      -------------KVGQVLDHLETSRSNLEQRFKNENKTIHQVIHEEKISRAKNLLQQTDISIKEITEIC
POCR_SALTY      ALRYIDAHLSDDLRLEDVASHVYLSPYYFSKLFKKQGIGFNAWVNRQRMVSARELLCHSDWSIASIARNL
VIRS_MYCTU      VVGLARRLPTGQCSAEAIADQLDMHPRTLQRRLAAEGLRCHDLIERERRAQAARYLAQPGLYLSQIAVLL
RIPA_CORGL      VAQVLVSNPADQTSLEEFAEIQGVSARTLQRQLKSTGYSFSEWRAAQRVCVAASLLA-HDFSISVVANLV
RHAS_SALTY      -----------------VAEQFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHSDHSVTEIAYRC
RHAS_SALTI      -----------------VAEQFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHSDHSVTEIAYRC
RHAS_SALSV      -----------------VAEQFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHSDHSVTEIAYRC
RHAS_SALPK      -----------------VAEQFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHSDHSVTEIAYRC
RHAS_SALPC      -----------------VAEQFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHSDHSVTEIAYRC
RHAS_SALPB      -----------------VAEQFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHSDHSVTEIAYRC
RHAS_SALPA      -----------------VAEQFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHSDHSVTEIAYRC
RHAS_SALNS      -----------------VAEQFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHSDHSVTEIAYRC
RHAS_SALHS      -----------------VAEQFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHSDHSVTEIAYRC
RHAS_SALG2      -----------------VAEQFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHSDHSVTEIAYRC
RHAS_SALEP      -----------------VAEQFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHSDHSVTEIAYRC
RHAS_SALDC      -----------------VAEQFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHSDHSVTEIAYRC
RHAS_SALCH      -----------------VAEQFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHSDHSVTEIAYRC
RHAS_SALAR      -----------------VAEQFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHSDHSVTEIAYRC
RHAS_SALA4      -----------------VAEQFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHSDHSVTEIAYRC
ARACL_STRLI     --------PARSWTVADLADTAAVSRSTLAARFATVGQGPLEYLTRWRIELAARQLREGNATLASIAHSV
VIRF_YEREN      LQKFMEENYLQGWKLSKFAREFGMGLTTFKELFGTVGISPRAWISERRILYAHQLLLNGKMSIVDIAMEA
RHRA_RHIME      ------------FSITDVAEAERITPRAIQKFFSREGTTFSRYVLGRRLSLAKSLILAEGESISQIAYNV
RHAS_SHISS      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_SHIFL      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_SHIF8      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_SHIDS      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_SHIBS      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECOSM      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECOLI      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECOLC      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECOL6      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECOL5      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECOHS      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECODH      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECOBW      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECO8A      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECO81      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECO55      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECO27      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
LCRF_YERPE      LQKFMEENYLQGWKLSKFAREFGMGLTTFKELFGTVGISPRAWISERRILYAHQLLLNGKMSIVDIAMEA
CHBR_ECOLI      -----------------------------------------------RINFAKKQLEMTNYSVTDIAFEA
RHAS_ECOUT      -----------------VADQFSLSLRTLHRQLKQKTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECOLU      -----------------VADQFSLSLRTLHRQLKQKTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECOK1      -----------------VADQFSLSLRTLHRQLKQKTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECO7I      -----------------VADQFSLSLRTLHRQLKQKTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECO45      -----------------VADQFSLSLRTLHRQLKQKTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_CITK8      -----------------IADKFSLSLRTLHRQLKQQTGLTPQRYLNRRLIKARHLLRHSDESVTDIAYRC
EXSA_PSEAE      LQLFMEKHYLNEWKLSDFSREFGMGLTTFKELFGSVGVSPRAWISERRILYAHQLLLNSDMSIVDIAMEA
RHAS_SHIB3      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_KLEP3      ----------------EVAAQFSLSLRTLHRQLKQQTGLTPQRYLNVRLMKARHLLRHSDESVTDIAFRC
RHAS_ECO5E      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYHC
RHAS_ECO57      -----------------VADQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYHC
RIPA_CORDI      --------PADQTPLLEFAQLHNISSRTLQRQVASTGFTFSEWRAALRVSVAADLLA-HDFRIGQVSQMV
RHAS_KLEP7      ----------------EVAAQFSLSLRTLHRQLKQQTGLTPQRYLNVRLMKARHLLRHSDESVTDIAYRC
RHAS_ECOSE      -----------------VAEQFSLSLRTLHRQLKQQTGLTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
RHAS_ECO24      -----------------VAEQFSLSLRTLHRQLKQQTGVTPQRYLNRRLMKARHLLRHSEASVTDIAYRC
GLXA_RHIME      ------------------------------------GTGFLDTYREIRLRHARRLLQQSPLSIPEIAYAT
YPDC_ECOLI      ICNWVQDNYAQPLTRESVAQFFNITPNHLSKLFAQHGTMFIEYVRWVRMAKARMILQKYHLSIHEVAQRC
PQRA_PROVU      -----------------------------------KGCTLGEYVRKRRLLEAAKSLQEKDMSILDIALMY
RHAS_ENT38      -----------------VADVFSLSLRTLHRQLKQHTGLTPQRYLNRRLIKARHLLRHTDESVTDIAYRC
YBBB_BACSU      ------------------------------------GQSVTEFITKTRITKAKRLMAKSNCKLKEIAHQT
RHAS_ESCF3      -----------------IADRFALSLRTLHRQLKQHTGLTPQRYLNRRLVKARHLLRHSDDSVTHIAFSC
RHAR_ERWCT      --------------------HHFSARSLRSRFKEQTGMSVPHYLRQLRLCKAMELLRYDLQTIGDVAALC
YESN_BACSU      -------------------DMLFMNPDYLGKLFKQEGEKFSQYVTRVRLEHAMKQMKIRRDSVSEIAEEI
Y107_STAAR      --------------LSELSEYVGWSESHLSKKFAESGVGFQHFLNTTRIEHAKLDLTYTDETITDIALQN
RHAR_PECCP      --------------------HHFSARSLRSRFKEQTGMSVPHYLRQLRLCKAMELLRYDLQTIGDIAALC
VIRF_YERE8      LQKFMEENYLQGWKLSKFAREFGMGLTTFKELFGTVGISPRAWISERRILYAHQLLLNCKMSIVDIAMEA
RHAS_MANSM      ----------------ELAEKFALPIRTLHRYISQTGHTPQNYVTKLRLAQAYYQLKYTEKNIINIAYDC
MSMR_STRMU      VKKIIHSQYGSSLRVNDIAKKLNLSRSYLY-KIFRKSTNLSEYILQVRMKRSQYLLENPKLSIAEISNSV
AARP_PROST      ILVWIEGNLTNRLSLDDIAQHSGYTKWHLQRVFRKVGMPLGEYIRRRRICEAAKELQTTNLQVIDIALKY
YDEC_BACSU      -----------------------------------------------RIQKSLLLLQHPESNVTEVSYQV
YQHC_ECOLI      VLKRIENKYTENLSVEQLAAEANMSVSAFHHNFKSVTSTSPLQYLNYRLHKARMMIIHDGMKASAAAMRV
Y101_STAAM      --------------LSELSEYVGWSESHLSKKFTESGVGFQHFLNTTRIEHAKLDLTYTDETITDIALQN
Y097_STAAN      --------------LSELSEYVGWSESHLSKKFTESGVGFQHFLNTTRIEHAKLDLTYTDETITDIALQN
Y078_STAAS      --------------LSELSEYVGWSESHLSKKFTESGVGFQHFLNTTRIEHAKLDLTYTDETITDIALQN
Y077_STAAW      --------------LSELSEYVGWSESHLSKKFTESGVGFQHFLNTTRIEHAKLDLTYTDETITDIALQN
TETD_ECOLX      ------------------------------------GVTLASYIRARRLTKAAVELRLTKKTILEIALKY
RHAR_YERPY      ----------------------------------QTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAARC
RHAR_YERPS      ----------------------------------QTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAARC
RHAR_YERPP      ----------------------------------QTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAARC
RHAR_YERPN      ----------------------------------QTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAARC
RHAR_YERPG      ----------------------------------QTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAARC
RHAR_YERPE      ----------------------------------QTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAARC
RHAR_YERPB      ----------------------------------QTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAARC
RHAR_YERPA      ----------------------------------QTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAARC
RHAR_YERP3      ----------------------------------QTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAARC
RHAR_SALSV      LITALANSLERPFALDAFCQQEQCSERVLRQQFAQTGMTINQYLRQVRICHAQYLLQHSPLMISEISMQC
ARAC_ERWCH      ----ITSNLAGELRIDEVARHVCLSPSRLAHLFREQGINILRWREDQRVIRAKLLLQTTQESIANIGRVV
Y084_STAAC      --------------LSELSEYVGWSESHLSKKFTESGVGFHHFLNTTRIEHAKLDLTYTDETITDIALQN
ARAC_SALTY      --------------IASVAQHVCLSPSRLSHLFRQQGISVLSWREDQRISQAKLLLSTTRMPIATVGRNV
ARAC_ECOLI      --------------IASVAQHVCLSPSRLSHLFRQQGISVLSWREDQRISQAKLLLSTTRMPIATVGRNV
ARAC_ECO57      --------------IASVAQHVCLSPSRLSHLFRQQGISVLSWREDQRISQAKLLLSTTRMPIATVGRNV
ARAC_CITFR      --------------IASVAQHVCLSPSRLSHLFRQQGISVLSWREDQRISQAKLLLSTTRMPIATVGRNV
YIJO_ECOLI      IRDYIDERYASALTRESVAQAFYISPNYLSHLFQKTGAIGFNEYLNTRLEHAKTLLKGYDLKVKEVAHAC
YHTH1_STAAU     --------------LSELSEYVGWSESHLSKKFAESGVGFQHFLNTTRIEHAKLDLTYTDEMITDIALQN
RHAS_YERPY      ----------------ELADRFALPLRTLHRQLKNKTGMTPQRYLTRRLLQARHQLCYSDNSVTDIAYLC
RHAS_YERPS      ----------------ELADRFALPLRTLHRQLKNKTGMTPQRYLTRRLLQARHQLCYSDNSVTDIAYLC
RHAS_YERPP      ----------------ELADRFALPLRTLHRQLKNKTGMTPQRYLTRRLLQARHQLCYSDNSVTDIAYLC
RHAS_YERPG      ----------------ELADRFALPLRTLHRQLKNKTGMTPQRYLTRRLLQARHQLCYSDNSVTDIAYLC
RHAS_YERPB      ----------------ELADRFALPLRTLHRQLKNKTGMTPQRYLTRRLLQARHQLCYSDNSVTDIAYLC
RHAS_YERP3      ----------------ELADRFALPLRTLHRQLKNKTGMTPQRYLTRRLLQARHQLCYSDNSVTDIAYLC
YEAM_ECOLI      ---MMAKGPVEWGALGQWAGFFAMSERNLARLIVKEGLSFRQWRQQLQLIMALQGLVKGD-TVQKVAHTL


                         .         *         .         .         .         .         +:350
query           GYDSTSYFIQCFKKYFKTTPSTFIKMANH
HILD_SALTY      GYDSTSYFIQCFKKYFKTTPSTFIKMANH
SIRC_SALTY      GYDTPSYFIAIFKRHFKITPLSFMRTMNH
SIRC_SALTI      GYDTPSYFIAIFKRHFKITPLSFMRTMNH
APPY_ECOLI      GYNSTSYFICAFKDYYGVTPSHYFE----
FAPR_ECOLX      GYTSVSYFIKTFKEYYGVTPKKF------
GADW_SHIFL      GYSSTSYFINTFRQYYGVTPHQF------
GADW_ECOLI      GYSSTSYFINTFRQYYGVTPHQF------
GADW_ECOL6      GYSSTSYFINTFRQYYGVTPHQF------
GADW_ECO57      GYSSTSYFINTFRQYYGVTPHQF------
PERA_ECO27      GFNSTSYFIKVFKEYYNTTPKKY------
URER_ECOLX      GFGSNAYFCDVFKRKYNMTPSQF------
YDEO_ECOLI      GYASTSYFIYAFRKHFGNSPKRVSK----
YDEO_SHIFL      GYASTSYFIYAFRKHFGNSPKRVSK----
YDEO_ECOL6      GYASTSYFIYAFRKHFGNSPKRVSK----
YDEO_ECO57      GYASTSYFIYAFRKHFGNSPKRVSK----
URER_PROMH      GFGSNAYFCDAFKRKYGMTPSQF------
AGGR_ECOLX      GFSSTSYFIRLFVKHFGITPKQFL-----
RNS_ECOLX       GISSASYFIRIFNKHYGVTPKQF------
VIRF_SHISO      GISSPSYFIRKFNEYYGITPKKF------
VIRF_SHIFL      GISSPSYFIRKFNEYYGITPKKF------
VIRF_SHIDY      GISSPSYFIRKFNEYYGITPKKF------
CFAD_ECOLX      GISSASYFIRVFNKHYGVTPKQF------
CSVR_ECOLX      GISSASYFIRIFNKHFGVTRSSFL-----
GADX_ECOL6      GYHSVSYFIYVFRNYYGMTPTEY------
GADX_ECO27      GYHSVSYFIYVFRNYYGMTPTEY------
YBCM_ECOLI      GYKCPSRFTERFHNRFNITP---------
GADX_SHIFL      GYHSVSYFIYVFRNYYGMTPTEY------
GADX_ECOLI      GYHSVSYFIYVFRNYYGMTPTEY------
GADX_ECO57      GYHSVSYFIYVFRNYYGMTPTEY------
ENVY_ECOLI      GYSSTSYFISVFKAFYGLTPLNYL-----
ADIY_ECOLI      GYNSTSYFISVFKDFYGMTPLHYV-----
TCPN_VIBCH      GFASVSYFSTVFKSTMNVAPSEYLFM---
TCPN_VIBC3      GFASVSYFSTVFKSTMNVAPSEYLFM---
Y1430_MYCBO     GYTEVSTFSHAFKRWYGVAPSEY------
Y1395_MYCTU     GYTEVSTFSHAFKRWYGVAPSEY------
YFIF_BACSU      GF-SVHYFTRVFSAKIGSSPGLF------
VQSM_PSEAE      GYSETASFRHAFRRWTGQSTTEF------
RHAR_MANSM      GYSDSNYFSSVFGKTFSCTPTEY------
Y1052_HAEIN     GYQSEAHFCKVFKNYYQLSPSQYRK----
XYLR_ECOLI      GYPSLQYFYSVFKKAYDTTPKEY------
XYLR_ECOL6      GYPSLQYFYSVFKKAYDTTPKEY------
XYLR_ECO57      GYPSLQYFYSVFKKAYDTTPKEY------
XYLR_HAEIN      GYPSIQYFYSVFKKEFEMTPKEF------
POCR_SALTY      GFSQTSYFCKVFRQTYQVTPQAYRQQIN-
VIRS_MYCTU      GYSEQSALNRSCRRWFGMTPRQY------
RIPA_CORGL      GFAATSSLTRAFRRHTGATPSTF------
RHAS_SALTY      GFGDSNHFSTLFRREFNWSP---------
RHAS_SALTI      GFGDSNHFSTLFRREFNWSP---------
RHAS_SALSV      GFGDSNHFSTLFRREFNWSP---------
RHAS_SALPK      GFGDSNHFSTLFRREFNWSP---------
RHAS_SALPC      GFGDSNHFSTLFRREFNWSP---------
RHAS_SALPB      GFGDSNHFSTLFRREFNWSP---------
RHAS_SALPA      GFGDSNHFSTLFRREFNWSP---------
RHAS_SALNS      GFGDSNHFSTLFRREFNWSP---------
RHAS_SALHS      GFGDSNHFSTLFRREFNWSP---------
RHAS_SALG2      GFGDSNHFSTLFRREFNWSP---------
RHAS_SALEP      GFGDSNHFSTLFRREFNWSP---------
RHAS_SALDC      GFGDSNHFSTLFRREFNWSP---------
RHAS_SALCH      GFGDSNHFSTLFRREFNWSP---------
RHAS_SALAR      GFGDSNHFSTLFRREFNWSP---------
RHAS_SALA4      GFGDSNHFSTLFRREFNWSP---------
ARACL_STRLI     GYGSESALSVAFKRVLGMPPGDYRK----
VIRF_YEREN      GFSSQSYFTQSYRRRFGCTPS--------
RHRA_RHIME      GFNDLSYFNRTFRSRYGVRPSDLRRLA--
RHAS_SHISS      GFSDSNHFSTLFRREFNWSP---------
RHAS_SHIFL      GFSDSNHFSTLFRREFNWSP---------
RHAS_SHIF8      GFSDSNHFSTLFRREFNWSP---------
RHAS_SHIDS      GFSDSNHFSTLFRREFNWSP---------
RHAS_SHIBS      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECOSM      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECOLI      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECOLC      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECOL6      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECOL5      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECOHS      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECODH      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECOBW      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECO8A      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECO81      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECO55      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECO27      GFSDSNHFSTLFRREFNWSP---------
LCRF_YERPE      GFSSQSYFTQSYRRRFGCTPS--------
CHBR_ECOLI      GYSSPSLFIKTFKKLTSFTPKSYRK----
RHAS_ECOUT      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECOLU      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECOK1      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECO7I      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECO45      GFSDSNHFSTLFRREFNWSP---------
RHAS_CITK8      GFGDSNHFSTLFRREFDWSP---------
EXSA_PSEAE      GFSSQSYFTQSYRRRFGCTPS--------
RHAS_SHIB3      GFSDSNHFSTLFHREFNWSP---------
RHAS_KLEP3      GFGDSNHFSTLFRREFDWSP---------
RHAS_ECO5E      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECO57      GFSDSNHFSTLFRREFNWSP---------
RIPA_CORDI      GFSATSSLTRAFKRHTGDTPSSFTSPRMH
RHAS_KLEP7      GFGDSNHFSTLFRREFDWSP---------
RHAS_ECOSE      GFSDSNHFSTLFRREFNWSP---------
RHAS_ECO24      GFSDSNHFSTLFRREFNWSP---------
GLXA_RHIME      GFSSPAHFSNAFKRLFSQTPGS-------
YPDC_ECOLI      GFPDSDYFCRVFRRQFGLTPGEY------
PQRA_PROVU      GFSSQATFTRIFKKHFNTTPAKF------
RHAS_ENT38      GFGDSNHFSTLFRREFSWSP---------
YBBB_BACSU      GYQDEFYFSRIFKKYTGCSPTSYMK----
RHAS_ESCF3      GFADSNHFSTLFRREFGWSP---------
RHAR_ERWCT      GFEDSNYFSVVFHQAFGVSPSAY------
YESN_BACSU      GFDNPKYFSLVFKKYTGLTPSEF------
Y107_STAAR      GFSSAASFARTFKHFTHQTPKQY------
RHAR_PECCP      GFEDSNYFSVVFHQAFGVSPSAY------
VIRF_YERE8      GFSSQSYFTQSYRRRFGCTPS--------
RHAS_MANSM      GFNDSSYFSTCFKNEYSIAP---------
MSMR_STRMU      GFSDSLAFSKAFKNYFGKSPSKFRK----
AARP_PROST      QFDSQQSFAKRFKAYLGISPSLY------
YDEC_BACSU      GFNSTSYFISKFQQAMNMTPLSYKKM---
YQHC_ECOLI      GYESASQFSREFKRYFGVTP---------
Y101_STAAM      GFSSAASFARTFKHFTHQTPKQY------
Y097_STAAN      GFSSAASFARTFKHFTHQTPKQY------
Y078_STAAS      GFSSAASFARTFKHFTHQTPKQY------
Y077_STAAW      GFSSAASFARTFKHFTHQTPKQY------
TETD_ECOLX      QFDSQQSFTRRFKYIFKVTPSYY------
RHAR_YERPY      GFEDSNYFSAVFTREAGMTPRDY------
RHAR_YERPS      GFEDSNYFSAVFTREAGMTPRDY------
RHAR_YERPP      GFEDSNYFSAVFTREAGMTPRDY------
RHAR_YERPN      GFEDSNYFSAVFTREAGMTPRDY------
RHAR_YERPG      GFEDSNYFSAVFTREAGMTPRDY------
RHAR_YERPE      GFEDSNYFSAVFTREAGMTPRDY------
RHAR_YERPB      GFEDSNYFSAVFTREAGMTPRDY------
RHAR_YERPA      GFEDSNYFSAVFTREAGMTPRDY------
RHAR_YERP3      GFEDSNYFSAVFTREAGMTPRDY------
RHAR_SALSV      GFEDSNYFSVVFTRETGMTPSQWRHLSN-
ARAC_ERWCH      GYDDQLYFSRVFRKRVGVSPSDF------
Y084_STAAC      GFSSAASFARTFKHFTHQTPKQY------
ARAC_SALTY      GFDDQLYFSRVFKKCTGASPSEF------
ARAC_ECOLI      GFDDQLYFSRVFKKCTGASPSEF------
ARAC_ECO57      GFDDQLYFSRVFKKCTGASPSEF------
ARAC_CITFR      GFDDQLYFSRVFKKCTGASPSEF------
YIJO_ECOLI      GFVDSNYFCRLFRKNTERSPSEY------
YHTH1_STAAU     GFSSAASFARTFKHITHQTPKQY------
RHAS_YERPY      GFGDSNHFSTLFKREFSQSP---------
RHAS_YERPS      GFGDSNHFSTLFKREFSQSP---------
RHAS_YERPP      GFGDSNHFSTLFKREFSQSP---------
RHAS_YERPG      GFGDSNHFSTLFKREFSQSP---------
RHAS_YERPB      GFGDSNHFSTLFKREFSQSP---------
RHAS_YERP3      GFGDSNHFSTLFKREFSQSP---------
YEAM_ECOLI      GYDSTTAFITMFKKGLGQTPGRYI-----