[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF67256.1

[Show Plain Result]


## Summary of Sequence Search
    1::303
    1::303     e-161 100%  303 aa  VG08_BPP22 RecName: Full=Scaffolding protein;AltName: Full=Protein
    1::303

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEPTTEIQATEDLTLSGDHAAASADSLVVDNANDNAGQEEGFEIVLKDDETAPKQDPAKNAEFAXXXXXX
VG08_BPP22      MEPTTEIQATEDLTLSGDHAAASADSLVVDNANDNAGQEEGFEIVLKDDETAPKQDPAKNAEFAXXXXXX


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXMEAVKRGELPESLRVNPDLPPQPDINAYLSEEGLAKYDYDNSRALAAFNAANTEWLMKAQD
VG08_BPP22      XXXXXXXXXMEAVKRGELPESLRVNPDLPPQPDINAYLSEEGLAKYDYDNSRALAAFNAANTEWLMKAQD


                         +         .         .         .         .         *         .:210
query           ARSNAVAEQGRKTQEFTQQSAQYVEAARKHYDAAEKLNIPDYQEKEDAFMQLVPPAVGADIMRLFPEKSA
VG08_BPP22      ARSNAVAEQGRKTQEFTQQSAQYVEAARKHYDAAEKLNIPDYQEKEDAFMQLVPPAVGADIMRLFPEKSA


                         .         .         .         +         .         .         .:280
query           ALMYHLGANPEKARQLLAMDGQSALIELTRLSERLTLKPRGKQISSAPPADQPITGDVSAANKDAIRKQM
VG08_BPP22      ALMYHLGANPEKARQLLAMDGQSALIELTRLSERLTLKPRGKQISSAPPADQPITGDVSAANKDAIRKQM


                         .         *         .         .         .         .         +:350
query           DAAASKGDVETYRKLKAKLKGIR
VG08_BPP22      DAAASKGDVETYRKLKAKLKGIR