[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF67339.1

[Show Plain Result]


## Summary of Sequence Search
    1::135
    1::135     3e-76 100%  135 aa  LGUL_SALTY RecName: Full=Lactoylglutathione lyase;       
    1::135     3e-76 100%  135 aa  LGUL_SALTI RecName: Full=Lactoylglutathione lyase;       
    1::135     4e-71  92%  135 aa  LGUL_SHIFL RecName: Full=Lactoylglutathione lyase;       
    1::135     4e-71  92%  135 aa  LGUL_ECOLI RecName: Full=Lactoylglutathione lyase;       
    1::135     4e-71  92%  135 aa  LGUL_ECO57 RecName: Full=Lactoylglutathione lyase;       
    1::135     4e-54  71%  135 aa  LGUL_HAEIN RecName: Full=Lactoylglutathione lyase;       
    5::136     5e-51  68%  138 aa  LGUL_VIBPA RecName: Full=Probable lactoylglutathione lyase;        
    1::127     7e-51  69%  138 aa  LGUL_NEIMB RecName: Full=Lactoylglutathione lyase;       
    1::127     7e-51  69%  138 aa  LGUL_NEIMA RecName: Full=Lactoylglutathione lyase;       
    5::136     2e-49  67%  138 aa  LGUL_VIBCH RecName: Full=Probable lactoylglutathione lyase;        
    1::125     4e-45  62%  131 aa  LGUL_SYNY3 RecName: Full=Probable lactoylglutathione lyase;        
   17::140     1e-41  59%  282 aa  LGUL_BRAOG RecName: Full=Putative lactoylglutathione lyase;        
   24::148     1e-35  53%  291 aa  LGUL_ORYSJ RecName: Full=Lactoylglutathione lyase;       
  185::320     2e-25  51%  326 aa  LGUL_YEAST RecName: Full=Lactoylglutathione lyase;       
   32::179     2e-23  50%  186 aa  LGUL_CICAR RecName: Full=Lactoylglutathione lyase;       
   31::183     1e-22  48%  185 aa  LGUL_BRAJU RecName: Full=Lactoylglutathione lyase;       
   26::176     2e-22  50%  176 aa  LGUL_PSEAE RecName: Full=Lactoylglutathione lyase;       
   28::175     5e-22  46%  185 aa  LGUL_SOLLC RecName: Full=Lactoylglutathione lyase;       
   31::178     2e-21  46%  185 aa  LGUL_ARATH RecName: Full=Lactoylglutathione lyase;       
   32::175     1e-20  45%  184 aa  LGUL_RAT RecName: Full=Lactoylglutathione lyase;       
   32::175     4e-20  44%  184 aa  LGUL_MACFA RecName: Full=Lactoylglutathione lyase;       
   32::175     6e-20  44%  184 aa  LGUL_HUMAN RecName: Full=Lactoylglutathione lyase;       
   32::175     8e-20  43%  184 aa  LGUL_MOUSE RecName: Full=Lactoylglutathione lyase;       
  166::302     7e-19  43%  302 aa  LGUL_SCHPO RecName: Full=Lactoylglutathione lyase;       
   27::169     1e-16  45%  173 aa  LGUL_PSEPU RecName: Full=Lactoylglutathione lyase;       
    4::134     6e-16  38%  281 aa  GLOD4_CAEEL RecName: Full=Glyoxalase 1;       
    4::134     5e-15  38%  281 aa  GLOD4_CAEBR RecName: Full=Glyoxalase 1;AltName: Full=Glyoxalase
    5::127     3e-13  38%  298 aa  GLOD4_RAT RecName: Full=Glyoxalase domain-containing protein 4;
    5::127     3e-12  38%  298 aa  GLOD4_MOUSE RecName: Full=Glyoxalase domain-containing protein 4;
    4::125     9e-11  39%  126 aa  YWBC_BACSU RecName: Full=Uncharacterized protein ywbC;
    5::142     3e-10  38%  313 aa  GLOD4_HUMAN RecName: Full=Glyoxalase domain-containing protein 4;
   46::175     2e-07  28%  175 aa  MCEE_BOVIN RecName: Full=Methylmalonyl-CoA epimerase,
   47::176     2e-07  29%  176 aa  MCEE_HUMAN RecName: Full=Methylmalonyl-CoA epimerase,
    8::116     8e-07  32%  140 aa  FOSB_GEOTN RecName: Full=Metallothiol transferase fosB;       
   49::178     1e-06  26%  178 aa  MCEE_MOUSE RecName: Full=Methylmalonyl-CoA epimerase,
    8::117     2e-05  31%  142 aa  FOSB_STAES RecName: Full=Metallothiol transferase fosB;       
    8::116     2e-04  31%  141 aa  FOSB_LYSSC RecName: Full=Metallothiol transferase fosB;       
   11::120     2e-04  31%  154 aa  FOSB_BACLD RecName: Full=Metallothiol transferase fosB;       
    3::132     4e-04  26%  140 aa  YQJC_BACSU RecName: Full=Uncharacterized protein yqjC;
    5::41      4e-04  41%  129 aa  GLOD5_DICDI RecName: Full=Glyoxalase domain-containing protein 5
    8::116     7e-04  29%  139 aa  FOSB_BACCN RecName: Full=Metallothiol transferase fosB;       
  400::442     9e-04  47%  475 aa  RBL_BIGNA RecName: Full=Ribulose bisphosphate carboxylase large
    7::116     9e-04  30%  151 aa  FOSB_STAS1 RecName: Full=Metallothiol transferase fosB;       
    6::116     9e-04  28%  139 aa  FOSB_OCEIH RecName: Full=Metallothiol transferase fosB;       
    1::135

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVESYDMGN
LGUL_SALTY      MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVESYDMGN
LGUL_SALTI      MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVESYDMGN
LGUL_SHIFL      MRLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGT
LGUL_ECOLI      MRLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGT
LGUL_ECO57      MRLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGT
LGUL_HAEIN      MQILHTMLRVGDLDRSIKFYQDVLGMRLLRTSENPEYKYTLAFLGYEDGESAAEIELTYNWGVDKYEHGT
LGUL_VIBPA      -RILHTMLRVGDLDKSIKFYTEVMGMQLLRTNENKEYEYTLAFVGYGDESQGAVIELTYNWGKTEYDLGT
LGUL_NEIMB      MRLLHTMLRVGNLEKSLDFYQNVLGMKLLRRKDYPEGRFTLAFVGYGDETDSTVLELTHNWDTERYDLGN
LGUL_NEIMA      MRLLHTMLRVGNLEKSLDFYQNVLGMKLLRRKDYPEGRFTLAFVGYGDETDSTVLELTHNWDTERYDLGN
LGUL_VIBCH      -RILHTMLRVGDLDKSIEFYTQVMGMSLLRKNENTEYKYTLAFLGYGDESQGAVIELTYNWGVADYEKGN
LGUL_SYNY3      MFLLHTMIRVGDLDKSLQFYCDILGMNLLRKKDYPSGEFTLAFVGYGKESENAVIELTHNWGTDKYDLGN
LGUL_BRAOG      -RFLHVVYRVGDLDRTIQFYTECFGMKVLRKRDVPEEKYSNAFLGFGPETSNFVVELTYNYGVSSYDIGT
LGUL_ORYSJ      -RLLHAVYRVGDLDRTIKCYTECFGMKLLRKRDVPEEKYTNAFLGFGPEDTNFALELTYNYGVDKYDIGA
LGUL_YEAST      ----HTMIRIKNPTRSLEFYQNVLGMKLLRTSEHESAKFTLYFLGYGPKTDESVLELTHNWGTENYHNGN
LGUL_CICAR      -----TMFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFMGYEDTTEKATIELTHNWGTESYHNGN
LGUL_BRAJU      -----TMFRVKDPKASLDFYSRVLGMSLLKRLDFSEMKFSLYFLGYEDTSRPATIELTHNWGTESYHNGN
LGUL_PSEAE      ----HTMLRVKDPKRSLDFYSRVLGMRLLRRLDFEEGRFSLYFLAMGEEVPDAVLELTHNWGSESYHNGN
LGUL_SOLLC      --LQQTMFRIKDPKVSLEFYSKVLGMSLLKRLDFPEMKFSLYFMGYEDTSQKSTLELTHNWGTESYHNGN
LGUL_ARATH      -----TMFRIKDPKASLDFYSRVLGMSLLKRLDFSEMKFSLYFLGYXXXXQPATIELTHNWGTESYHNGN
LGUL_RAT        --LQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPSMKFSLYFLAYEDKNDKATLELTHNWGTESYHNGN
LGUL_MACFA      --LQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPAMKFSLYFLAYEDKNDKATLELTHNWGTESYHNGN
LGUL_HUMAN      --LQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDKATLELTHNWGTESYHNGN
LGUL_MOUSE      --LQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDKATLELTHNWGTESYHNGN
LGUL_SCHPO      -RFNHTMVRVKDPEPSIAFYEK-LGMKVIDKADHPNGKFTNYFLAYPSDLREGLLELTHNWGTEKYHNGN
LGUL_PSEPU      ----HTMLRVKDIEKSLDFYTRVLGFKLVDKRDFVEAKFSLYFLAVDPATIPAVLELTHNHGTEAYHHGN
GLOD4_CAEEL     -RALHYVFKVANRAKTIDFFTNVLNMKVLRHEENGPYRWSKTMIGYGSEDEHFVLEITYNYPIHKYELGN
GLOD4_CAEBR     -RALHYVFKVANRAKTIDFYTKILEMKVLRHEENGPYRWSKTMIGYGSEDEHFVLELTYNYPIHKYELGN
GLOD4_RAT       -RALHFVFKVGNRFQTVHFFRDVLGMQVLRHEENGPYKWSKTMVGFGPEDDHFVAELTYNYGIGDYKLGN
GLOD4_MOUSE     -RALHFVFKVKNRFQTVHFFRDVLGMQVLRHEENGPYKWSKTMVGFGPEDDHFVAELTYNYGIGDYKLGN
YWBC_BACSU      -RIDHTGIMVRDINASITFYEEVLGMKLKDRITHTNGVIELAFLGFGPETE---IELIQGYSSELPAEGK
GLOD4_HUMAN     -RALHFVFKVGNRFQTARFYRDVLGMKVTRITEDSDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGN
MCEE_BOVIN      -RLNHVAVAVPDLEKARAFYKNVLGAEVGEPVPLPEHGVSVVFVNLGNTKMELLHPLGSDSPIAGFLKKN
MCEE_HUMAN      -RLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKN
FOSB_GEOTN      ----HLTFSVSDLEKSIHFYQNVFGAKLLVKGRNLAYF----------DLNGIWLALNVQQDIPRNDIQH
MCEE_MOUSE      -RLNHVAVAVPDLEKASSFYRDVLGAQVSEVVPLPEHGVSVVFVNLGNTKMELLHPLGSDSPITGFLQKN
FOSB_STAES      ----HICFSVSDLNTSIQFYKDILHGDLLVSGRTTAY----LTIGH------TWIALNQEKNIPRNEISH
FOSB_LYSSC      ----HLLFSVSDLEKSIAFYENVFGAKLLVKGNSTAYF----------DVNGLWLALNVEKDIPRNDIQY
FOSB_BACLD      ----HLLFSVSDLSVSISFYEKVFDAKWLVKAEKTAY-FDLNGIWLAFNEEK---------DIKRQEIHD
YQJC_BACSU      -RLDHIGIAVFSIKDARSFYENVLGLAFLHQETVEEQKVNVAFFQAGSVKLELIEPLTADSPVHLFKKGQ
GLOD5_DICDI     -RLDHLVLTVSDIEKTCNFYENILGMKVITFGKDNERK--------------------------------
FOSB_BACCN      ----HICFSVSNLETSIAFYEKVLGELLVKGRKLAYFRICGTWVALNEETD-----------IPRKEIHQ
RBL_BIGNA       --------------------------------------------------------LQFGGGTLGHPWGN
FOSB_STAS1      ----HVTYSVSDISKSINFYKDILKAKILVESDKTAY-----FILGG-----LWLALNEEKDIPRNEIRY
FOSB_OCEIH      --LNHLLFSVSNLEQSIDFYQQVFDAKLLVKGRSTAY-FDLNGIWLALNEEK---------HIPRNEINE


                         .         .         *         .         .         .         .:140
query           AYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYKIELIEAKDAGRGLGN
LGUL_SALTY      AYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYKIELIEAKDAGRGLGN
LGUL_SALTI      AYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYKIELIEAKDAGRGLGN
LGUL_SHIFL      AYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIEEKDAGRGLGN
LGUL_ECOLI      AYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIEEKDAGRGLGN
LGUL_ECO57      AYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIEEKDAGRGLGN
LGUL_HAEIN      AYGHIAIGVDDIYATCEAVRASGGNVTREAGPVKGGSTVIAFVEDPDGYKIEFIENKSTKSGLGN
LGUL_VIBPA      AFGHIAIGVDDIYATCDAIKAAGGNVTREAGPVKGGTTHIAFVKDPDGYMIELIQNKQASAGL--
LGUL_NEIMB      AYGHIAVEVDDAYEACERVKRQGGNVVREAGPMKHGTTVIAFVEDPDGYKIEFIQKK--------
LGUL_NEIMA      AYGHIAVEVDDAYEACERVKRQGGNVVREAGPMKHGTTVIAFVEDPDGYKIEFIQKK--------
LGUL_VIBCH      AYGHIAIGVDDIYATCDTIKAAGGIVTREPGPVKGGTTHIAFVKDPDGYMIELIQNKQAHAGL--
LGUL_SYNY3      GFGHIALGVEDIYSTCDKIRDKGGKVVREPGPMKHGTTVIAFVEDPDGYKIELIQ----------
LGUL_BRAOG      GFGHFAISTQDVSKMVEAVRAKGGNVTREPGPVKGGGSVIAFVKDPDGYTFELIQ----------
LGUL_ORYSJ      GFGHFAIATEDVYKLAEKIKSSCCKITREPGPVKGGSTVIAFAQDPDGYMFELIQ----------
LGUL_YEAST      SYGHICISCDDAGALCKEIEVKYGDKIQWSPKFQGRMKNIAFLKDPDGYSIEVV-----------
LGUL_CICAR      SFGHIGITVDDTYKACERFQNLGVEFVKK--PDDGKMKGIAFIKDPDGYWIELFDRKTIG-----
LGUL_BRAJU      SFGHIGVTVDDVHKACERFEQLGVEFVKK--PHDGKMKNIAFIKDPDGYWIEIFDLKTIGTTAGN
LGUL_PSEAE      GFGHICFSVPDLVAACERFETLGVNFVK---PLDRGMKNVAFISDPDGYWVEIVQASEMGRG---
LGUL_SOLLC      SFGHIGVTVDDVYKACERFESLGVEFVKK--PLDGKMKGIAFIKDPDGYWIEIFDTK--------
LGUL_ARATH      SFGHIGVTVDDVHKACERFEELGVEFAKK--PNDGKMKNIAFIKDPDGYWIEIFDLKTIG-----
LGUL_RAT        SFGHIGIAVPDVYEACKRFEELGVKFVKK--PDDGKMKGLAFVQDPDGYWIEIL-----------
LGUL_MACFA      SFGHIGIAVPDVHSACKRFEELGVKFVKK--PDDGKMKGLAFIQDPDGYWIEIL-----------
LGUL_HUMAN      SFGHIGIAVPDVYSACKRFEELGVKFVKK--PDDGKMKGLAFIQDPDGYWIEIL-----------
LGUL_MOUSE      SFGHIGIAVPDVYSACKRFEELGVKFVKK--PDDGKMKGLAFIQDPDGYWIEIL-----------
LGUL_SCHPO      GYGHVCISVDNINAACSKFEAEGLPFKKKL--TDGRMKDIAFLLDPDNYWVEVIEQK--------
LGUL_PSEPU      GFGHICVSVPDVVAACERF--EALQVPFQKRLSDGRMNHLAFIKDPDGYWVEVIQ----------
GLOD4_CAEEL     DYRAIVIDSDQLFEKVEKINHRKSGCGRLA------------VKDPDGHEFKIGKADQSPKVL--
GLOD4_CAEBR     DYRAIVIDSDQLFDKISRIDHRKSGCGRLA------------VKDPDGHEFKIGKADHAPKVL--
GLOD4_RAT       DFMGLTLASSQAV----------SNARRLEWPLSKVAEGVFETEAPGGYKFYL------------
GLOD4_MOUSE     DFMGITLASSQAV----------SNARKLEWPLSKVAEGIFETEAPGGYKFYL------------
YWBC_BACSU      VH-HIALLTDDAAEYTKAEKMNAKFIDEEITTLPNGYRYF-YIEGPDGEWIEFFQ----------
GLOD4_HUMAN     DFMGITLASSQAV----------SNARKLEWPLTEVAEGVFETEAPGGYKFYL------------
MCEE_BOVIN      KAGHVCIEVDNINVAVMDLKEKKIRILSEEAKIGAHGKPVIFLHPSDGVLVELEQA---------
MCEE_HUMAN      KAGHICIEVDNINAAVMDLKKKKIRSLSEEVKIHGKPVIFLHPKDCGGVLVELEQA---------
FOSB_GEOTN      SYTHIAFSVEDFDHVVEKLKELGVNILPGRERDERDKRSVYFT-DPDGHKFE-------------
MCEE_MOUSE      KAGHVCIEVDNISAAVMDLKKKKIRSLSDEAKIHGKPVIFLHPKDCGGVLVELEQA---------
FOSB_STAES      SYTHIAFSIDEEQQWIQWLKENQVNILKRPRDIKDKKSI--YFTDPDGHKIEL------------
FOSB_LYSSC      SYTHIAISEDEFDKMYDKLVQLKVLILDGRQRDERDKKSIYFT-DPDGHKFE-------------
FOSB_BACLD      SYTHIAFSIQQEDLPFKKLHDLGVNVLKGRKRHEGDRDSIYF-SDPDGHKFEL------------
YQJC_BACSU      GLHHIAFLCNCLSEQLQALSDQHVQLIDRFPRQGANGKKIAFIRETNGVLVELCEPK--------
GLOD5_DICDI     -----------------------------------------------------------------
FOSB_BACCN      SYTHIAFSIEDFERLLQRLKENDVHILQRKRDVRDCKSI--YFTDPDGHKFE-------------
RBL_BIGNA       APGAVANRV--ALEACIKIRNQGQNVLREGG----------------------------------
FOSB_STAS1      SYTHMAFTIEESEEWYQWLNDNNVNITRDVRDKKS-----IYFTDPDGHKFEL------------
FOSB_OCEIH      SYTHTAFSIDESESAIQHLKALNVNILEGRERAEQDKQSIYFT-DPDGHKFE-------------