[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF67354.1

[Show Plain Result]


## Summary of Sequence Search
    1::137
    1::137     3e-66  92%  137 aa  YBDB_ECOLI RecName: Full=Esterase ybdB;         EC=3.1.-.-;AltName:
    1::137     3e-66  92%  137 aa  YBDB_ECOL6 RecName: Full=Esterase ybdB;         EC=3.1.-.-;
    1::136     3e-38  51%  136 aa  YDII_ECOLI RecName: Full=Esterase ydiI;         EC=3.1.-.-;
    1::135     1e-29  44%  139 aa  Y788_PASMU RecName: Full=Putative esterase PM0788;       
    1::136     8e-29  43%  138 aa  Y1161_HAEIN RecName: Full=Putative esterase HI1161;       
    3::136     1e-27  43%  150 aa  Y3380_VIBCH RecName: Full=Putative esterase VC_A0580;       
    3::138     1e-23  40%  145 aa  Y1618_PSEAE RecName: Full=Putative esterase PA1618;       
    4::124     1e-11  39%  126 aa  COMA2_BACSU RecName: Full=Putative esterase comA2;       
   38::149     4e-10  38%  159 aa  Y2406_DEIRA RecName: Full=Putative esterase DR_2406;       
   19::124     1e-06  27%  140 aa  Y1847_MYCTU RecName: Full=Putative esterase Rv1847/MT1895;       
    1::137

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLGSMAG
YBDB_ECOLI      MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTRTHQPFXXXXXXXXXXXXETLGSMAG
YBDB_ECOL6      MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTRTHQPFXXXXXXXXXXXXETLGSMAG
YDII_ECOLI      MIWKRKITLEALNAMGEGNMVGFLDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVVLAESIGSVAG
Y788_PASMU      MIWKKKYTLEQMNLLSQNTAISHLAIQFSAQGENWLEATMPVDQRTIQPMGFLHGGLSVALAETIGSMAG
Y1161_HAEIN     MLWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIEATMPVDHRTMQPFGVLHGGVSVALAETIGSLAG
Y3380_VIBCH     -IWNKPISLEILNATSKNTLIEHLNIIYTEVTENSISATMPVCHFTHQPLGMLHGGASVVLAETLGSVAA
Y1618_PSEAE     -LWRQTPDLEQLNASQKNSIGDLLGIRFEAFDDESLTASMPVDSRTHQPFGLLHGGASVVLAESLGSMAS
COMA2_BACSU     ----------------KHTLLEALGIEIVENTAERCVAVMPVDHRTVQPFGYLHXXXXXXXXXXXXXXXX
Y2406_DEIRA     ------------------TLGARLGIRYVSMARERVVATMPVEGN-RQPAGRLHGGATXXXXXXXXSVGS
Y1847_MYCTU     ---------------------SELGLQFTELGPDGARAQLDVRPKLLQLTGVVHGGVYCAMIESIASMAA


                         .         .         *         .         .         .         .:140
query           YLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCRLGTAVMG
YBDB_ECOLI      FMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQPLHLGRQNQSWEIVVFDEQGRRCCTCRLGTAVLG
YBDB_ECOL6      FMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQPLHLGRQNQSWEIVVFDEQGRRCCTCRLGTAVLG
YDII_ECOLI      YLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFDEKGRLCCSSRLTTAIL-
Y788_PASMU      FCCITENQFVLGLEINANHLRPVKQGIVTARATPIHLGTRTQVWQIEIKDQQDQLCCLSRLTLSV--
Y1161_HAEIN     SLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTEENKLCCVSRLTLSVI-
Y3380_VIBCH     NFSVGEDAYCVGLDINANHVRAMREGLVTGTAVPLHIGVSTQVWQIEIKDEQGRLVCISRLTVAV--
Y1618_PSEAE     YLCVDTSQYCVGLEVNANHLRGLRSGRVTAVARAIHLGRTTHVWDIRLSGDDGKPSCIARLTMAVV-
COMA2_BACSU     QLIDHTTQACVGLEINANHLKSVKEGTVKAIAEPVHIGRTTIVYHIHIYDEQERLICISRCTLAVI-
Y2406_DEIRA     WLLDPQRQVAVGVDLNGTHVRGVSEGHVTAEARLSYRGRSLMVWEIEMKDEKGRTTSLCR-------
Y1847_MYCTU     FAWLNEXXXXXXXXXXTDFVRSISSGMVYGTAEPLHRGRRQQLWLVTITDDTDR-------------