[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF67435.1

[Show Plain Result]


## Summary of Sequence Search
    1::302
    1::293     3e-53  36%  299 aa  YHJC_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    6::291     5e-41  37%  304 aa  YAFC_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    1::281     9e-38  33%  288 aa  Y1364_HAEIN RecName: Full=Uncharacterized HTH-type transcriptional
    1::292     5e-36  34%  309 aa  AAER_ECOLI RecName: Full=HTH-type transcriptional activator aaeR;
    1::292     5e-36  34%  309 aa  AAER_ECOL6 RecName: Full=HTH-type transcriptional activator aaeR;
    1::292     5e-36  34%  309 aa  AAER_ECO57 RecName: Full=HTH-type transcriptional activator aaeR;
   11::292     1e-31  28%  310 aa  TTDR_ECO57 RecName: Full=HTH-type transcriptional activator ttdR;
   11::292     2e-31  28%  310 aa  TTDR_ECOUT RecName: Full=HTH-type transcriptional activator ttdR;
   11::292     2e-31  28%  310 aa  TTDR_ECOLI RecName: Full=HTH-type transcriptional activator ttdR;
   11::292     2e-31  28%  310 aa  TTDR_ECOL6 RecName: Full=HTH-type transcriptional activator ttdR;
   11::292     4e-31  28%  310 aa  TTDR_ECOL5 RecName: Full=HTH-type transcriptional activator ttdR;
    1::288     2e-30  29%  302 aa  YCAN_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    4::295     3e-30  31%  307 aa  YEAT_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    1::295     2e-26  27%  309 aa  LTRA_KLEPN RecName: Full=Probable HTH-type transcriptional
   19::302     3e-24  31%  312 aa  PTXR_PSEAE RecName: Full=HTH-type transcriptional regulator ptxR;
   12::293     3e-21  24%  299 aa  YCJZ_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   17::305     1e-20  28%  311 aa  DSDC_ECOLI RecName: Full=HTH-type transcriptional regulator
    4::288     4e-18  24%  305 aa  GCVA_ECOLI RecName: Full=Glycine cleavage system transcriptional
    4::288     4e-18  24%  305 aa  GCVA_ECOL6 RecName: Full=Glycine cleavage system transcriptional
    4::288     4e-18  24%  305 aa  GCVA_ECO57 RecName: Full=Glycine cleavage system transcriptional
   12::293     1e-17  22%  306 aa  OPRR_PSEAE RecName: Full=Putative transcriptional regulator;
    6::178     7e-16  33%  299 aa  CYNR_ECOLI RecName: Full=HTH-type transcriptional regulator
    6::127     1e-15  33%  285 aa  YOFA_BACSU RecName: Full=HTH-type transcriptional regulator yofA;
    8::260     2e-15  26%  301 aa  GCVA_HAEIN RecName: Full=Glycine cleavage system transcriptional
    8::234     2e-15  28%  294 aa  AMPR_YEREN RecName: Full=HTH-type transcriptional activator ampR;
   12::290     3e-15  25%  293 aa  YFIE_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    6::124     4e-15  36%  299 aa  CYNR_ECO57 RecName: Full=HTH-type transcriptional regulator
    3::293     8e-15  26%  300 aa  GLTC_BACSU RecName: Full=HTH-type transcriptional regulator gltC;
    8::234     8e-15  32%  296 aa  AMPR_PSEAE RecName: Full=HTH-type transcriptional activator ampR;
    8::288     2e-14  26%  291 aa  AMPR_CITFR RecName: Full=HTH-type transcriptional activator ampR;
   15::299     4e-14  24%  315 aa  SINR_SALTY RecName: Full=Probable HTH-type transcriptional
    8::251     4e-14  26%  289 aa  AMPR_RHOCA RecName: Full=HTH-type transcriptional activator ampR;
    3::141     5e-14  32%  304 aa  BENM_ACIAD RecName: Full=HTH-type transcriptional regulator
    6::124     7e-14  32%  301 aa  YWBI_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    5::126     9e-14  36%  308 aa  YFER_SHIFL RecName: Full=Uncharacterized HTH-type transcriptional
    5::126     9e-14  36%  308 aa  YFER_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   12::288     1e-13  25%  292 aa  HVRB_RHOCA RecName: Full=AHCY transcriptional activator hvrB;
    3::128     2e-13  28%  324 aa  YCGK_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    8::287     2e-13  26%  291 aa  AMPR_ENTCL RecName: Full=HTH-type transcriptional activator ampR;
    5::156     3e-13  28%  317 aa  YBHD_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    3::232     6e-13  24%  296 aa  GLTR_BACSU RecName: Full=HTH-type transcriptional regulator gltR;
    3::187     8e-13  32%  304 aa  TTUA4_AGRVI RecName: Full=HTH-type transcriptional regulator
    6::150     8e-13  30%  304 aa  CMPR_SYNY3 RecName: Full=HTH-type transcriptional activator cmpR;
    7::146     8e-13  28%  302 aa  ABGR_ECOLI RecName: Full=HTH-type transcriptional regulator abgR;
    2::286     1e-12  27%  298 aa  Y4MQ_RHISN RecName: Full=Uncharacterized HTH-type transcriptional
    1::187     1e-12  29%  304 aa  TTUA3_AGRVI RecName: Full=HTH-type transcriptional regulator
    4::136     1e-12  26%  299 aa  CYSL_BACSU RecName: Full=HTH-type transcriptional regulator
   16::231     3e-12  25%  283 aa  MAUR_PARDE RecName: Full=Mau operon transcriptional activator;
    3::128     5e-12  30%  305 aa  NAC_KLEAE RecName: Full=Nitrogen assimilation regulatory protein
    4::290     1e-11  24%  292 aa  YYBE_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    3::95      1e-11  38%  144 aa  YIBL_AZOVI RecName: Full=Uncharacterized HTH-type transcriptional
   38::287     1e-11  23%  297 aa  PERR_ECOLI RecName: Full=HTH-type transcriptional regulator
   10::129     1e-11  35%  312 aa  OXYR_STRVD RecName: Full=Probable hydrogen peroxide-inducible genes
    1::125     2e-11  37%  306 aa  SDSB_PSES9 RecName: Full=SDS degradation transcriptional activation
    3::157     2e-11  28%  303 aa  CATM_ACIAD RecName: Full=HTH-type transcriptional regulator
    6::127     2e-11  29%  288 aa  YOFA_BACA2 RecName: Full=HTH-type transcriptional regulator yofA;
    6::125     4e-11  31%  305 aa  NAC_ECOLI RecName: Full=Nitrogen assimilation regulatory protein
    3::128     4e-11  29%  295 aa  ILVY_SALTY RecName: Full=HTH-type transcriptional activator ilvY;
    3::128     4e-11  29%  295 aa  ILVY_SALTI RecName: Full=HTH-type transcriptional activator ilvY;
    3::128     4e-11  29%  297 aa  ILVY_ECOLI RecName: Full=HTH-type transcriptional regulator ilvY;
   10::306     6e-11  29%  324 aa  RBCR_CYAPA RecName: Full=Probable RuBisCO transcriptional
   10::192     7e-11  33%  292 aa  SMER_SERMA RecName: Full=Carbapenem-hydrolyzing beta-lactamase
    6::153     7e-11  27%  307 aa  RBCR_PHATR RecName: Full=Probable RuBisCO transcriptional
    8::129     7e-11  29%  303 aa  RBCR_CYAME RecName: Full=Probable RuBisCO transcriptional
    3::121     7e-11  27%  288 aa  CZCR_BACCR RecName: Full=HTH-type transcriptional regulator czcR;
    6::125     9e-11  26%  292 aa  YVBU_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    3::127     9e-11  29%  308 aa  YTLI_BACSU RecName: Full=HTH-type transcriptional regulator ytlI;
    5::285     9e-11  20%  293 aa  YEIE_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    5::285     9e-11  20%  293 aa  YEIE_ECOL6 RecName: Full=Uncharacterized HTH-type transcriptional
    5::285     9e-11  20%  293 aa  YEIE_ECO57 RecName: Full=Uncharacterized HTH-type transcriptional
    7::140     9e-11  30%  307 aa  RBCR_THAPS RecName: Full=Probable RuBisCO transcriptional
    8::129     9e-11  33%  309 aa  RBCR_GRATL RecName: Full=Probable RuBisCO transcriptional
    3::121     9e-11  27%  288 aa  CZCR_BACHK RecName: Full=HTH-type transcriptional regulator czcR;
    3::121     9e-11  27%  288 aa  CZCR_BACCZ RecName: Full=HTH-type transcriptional regulator czcR;
    3::121     9e-11  27%  288 aa  CZCR_BACC1 RecName: Full=HTH-type transcriptional regulator czcR;
    3::121     9e-11  27%  288 aa  CZCR_BACAN RecName: Full=HTH-type transcriptional regulator czcR;
   13::131     9e-11  27%  298 aa  CZCR_BACAH RecName: Full=HTH-type transcriptional regulator czcR;
    6::143     9e-11  30%  323 aa  CMPR_SYNP6 RecName: Full=HTH-type transcriptional activator cmpR;
    6::143     9e-11  30%  323 aa  CMPR_SYNE7 RecName: Full=HTH-type transcriptional activator cmpR;
   10::162     1e-10  28%  311 aa  OXYR_MYCLE RecName: Full=Probable hydrogen peroxide-inducible genes
    4::298     2e-10  24%  324 aa  YIAU_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    3::153     2e-10  26%  289 aa  SOXR_ARTST RecName: Full=HTH-type transcriptional regulator soxR;
    8::129     2e-10  29%  310 aa  RBCR_GUITH RecName: Full=Probable RuBisCO transcriptional
    8::129     2e-10  34%  314 aa  RBCR_EMIHU RecName: Full=Probable RuBisCO transcriptional
    3::241     2e-10  28%  301 aa  ARAB_STRAT RecName: Full=HTH-type transcriptional regulator araB;
   10::243     3e-10  23%  317 aa  CFXR_RALEH RecName: Full=HTH-type transcriptional regulator
    3::123     3e-10  31%  290 aa  BUDR_KLETE RecName: Full=HTH-type transcriptional regulator
    8::129     4e-10  36%  313 aa  RBCR_CHLAT RecName: Full=Probable RuBisCO transcriptional
    4::289     4e-10  25%  298 aa  IRGB_VIBC3 RecName: Full=Iron-regulated virulence regulatory
   11::152     4e-10  33%  292 aa  AMPR_PROST RecName: Full=HTH-type transcriptional activator ampR;
    5::131     5e-10  30%  302 aa  RBCR_CHRVI RecName: Full=RuBisCO operon transcriptional regulator;
    8::129     5e-10  34%  337 aa  RBCR_ANAVT RecName: Full=Probable RuBisCO transcriptional
    8::129     5e-10  34%  337 aa  RBCR_ANASP RecName: Full=Probable RuBisCO transcriptional
    8::129     6e-10  32%  345 aa  RBCR_SYNY3 RecName: Full=Probable RuBisCO transcriptional
    6::145     6e-10  27%  292 aa  ILVY_HAEIN RecName: Full=HTH-type transcriptional activator ilvY;
   10::147     8e-10  37%  295 aa  NMCR_ENTCL RecName: Full=Carbapenem-hydrolyzing beta-lactamase
    8::155     1e-09  30%  317 aa  RBCR_PORYE RecName: Full=Probable RuBisCO transcriptional
    8::155     1e-09  30%  317 aa  RBCR_PORPU RecName: Full=Probable RuBisCO transcriptional
    4::289     1e-09  25%  298 aa  IRGB_VIBCH RecName: Full=Iron-regulated virulence regulatory
    3::141     1e-09  29%  296 aa  HCAR_ECOLI RecName: Full=Hca operon transcriptional activator;
    3::79      1e-09  32%  303 aa  CATR_ACILW RecName: Full=Probable cat1 operon transcriptional
    5::149     4e-09  30%  295 aa  TRPI_PSEAE RecName: Full=HTH-type transcriptional regulator
   11::97      4e-09  37%  311 aa  PCAQ_RHIRD RecName: Full=HTH-type transcriptional regulator
   11::97      4e-09  37%  311 aa  PCAQ_AGRT5 RecName: Full=HTH-type transcriptional regulator
    6::83      4e-09  41%  294 aa  CLCR_PSEPU RecName: Full=HTH-type transcriptional regulator
    7::148     4e-09  32%  292 aa  BLAA_PROVU RecName: Full=HTH-type transcriptional regulator
    7::136     7e-09  33%  309 aa  RBCR_ODOSI RecName: Full=Probable RuBisCO transcriptional
    8::129     9e-09  32%  317 aa  RBCR_CYACA RecName: Full=Probable RuBisCO transcriptional
   27::189     1e-08  24%  296 aa  Y300_METJA RecName: Full=Uncharacterized HTH-type transcriptional
    8::293     1e-08  25%  309 aa  RBCR_THIFE RecName: Full=RuBisCO operon transcriptional regulator;
    3::121     1e-08  25%  288 aa  CZCR_BACSU RecName: Full=HTH-type transcriptional regulator czcR;
    7::147     1e-08  28%  285 aa  AMPR_CITDI RecName: Full=HTH-type transcriptional activator ampR;
   14::126     2e-08  27%  289 aa  YRAN_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    3::64      2e-08  39%  228 aa  TFDT_RALEJ RecName: Full=HTH-type transcriptional regulator tfdT;
   13::160     3e-08  24%  307 aa  YDCI_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    6::125     3e-08  24%  295 aa  YUST_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    6::92      3e-08  36%  291 aa  CITR_BACSU RecName: Full=HTH-type transcriptional regulator
    9::124     6e-08  29%  323 aa  CYSB_HAEIN RecName: Full=HTH-type transcriptional regulator
    8::99      7e-08  30%  310 aa  YAHB_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    1::134     1e-07  30%  290 aa  YOAU_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   24::130     1e-07  23%  136 aa  YAGP_ECOLI RecName: Full=Uncharacterized protein yagP;
   10::145     1e-07  27%  305 aa  OXYR_ECOLI RecName: Full=Hydrogen peroxide-inducible genes
   10::145     1e-07  27%  305 aa  OXYR_ECOL6 RecName: Full=Hydrogen peroxide-inducible genes
   10::145     1e-07  27%  305 aa  OXYR_ECO57 RecName: Full=Hydrogen peroxide-inducible genes
    3::124     1e-07  27%  324 aa  CYSB_ECOLI RecName: Full=HTH-type transcriptional regulator
    3::124     1e-07  27%  324 aa  CYSB_ECOL6 RecName: Full=HTH-type transcriptional regulator
    3::124     1e-07  27%  324 aa  CYSB_ECO57 RecName: Full=HTH-type transcriptional regulator
    3::156     2e-07  28%  309 aa  NTCB_SYNE7 RecName: Full=Probable nitrogen assimilation
    3::124     2e-07  27%  324 aa  CYSB_SALTY RecName: Full=HTH-type transcriptional regulator
   10::145     2e-07  26%  302 aa  OXYR_PECCC RecName: Full=Hydrogen peroxide-inducible genes
   10::129     2e-07  27%  189 aa  OXYR_MYCXE RecName: Full=Probable hydrogen peroxide-inducible genes
   10::145     2e-07  26%  305 aa  OXYR_ERWCH RecName: Full=Hydrogen peroxide-inducible genes
   17::120     2e-07  29%  317 aa  METR_SALTY RecName: Full=HTH-type transcriptional regulator metR;
   17::120     2e-07  29%  317 aa  METR_SALTI RecName: Full=HTH-type transcriptional regulator metR;
    3::124     2e-07  27%  324 aa  CYSB_KLEPN RecName: Full=HTH-type transcriptional regulator
    5::79      2e-07  35%  308 aa  ALLS_SALTY RecName: Full=HTH-type transcriptional activator allS;
    5::79      2e-07  35%  308 aa  ALLS_SALPA RecName: Full=HTH-type transcriptional activator allS;
    5::79      2e-07  35%  320 aa  ALLS_SALCH RecName: Full=HTH-type transcriptional activator allS;
    5::79      3e-07  35%  308 aa  ALLS_ECOLI RecName: Full=HTH-type transcriptional activator allS;
    5::79      3e-07  35%  308 aa  ALLS_ECO57 RecName: Full=HTH-type transcriptional activator allS;
   10::145     5e-07  27%  301 aa  OXYR_HAEIN RecName: Full=Hydrogen peroxide-inducible genes
    5::79      5e-07  35%  308 aa  ALLS_SALTI RecName: Full=HTH-type transcriptional activator allS;
    4::114     6e-07  29%  270 aa  YLAC_STAXY RecName: Full=Uncharacterized HTH-type transcriptional
   18::151     6e-07  26%  342 aa  GBPR_AZOBR RecName: Full=HTH-type transcriptional regulator
    7::81      6e-07  35%  270 aa  ALLS_KLEPN RecName: Full=HTH-type transcriptional activator allS;
    5::79      6e-07  35%  308 aa  ALLS_ECOL6 RecName: Full=HTH-type transcriptional activator allS;
    5::79      6e-07  35%  308 aa  ALLS_ECOL5 RecName: Full=HTH-type transcriptional activator allS;
    3::126     1e-06  24%  293 aa  YKUM_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    3::89      1e-06  35%  309 aa  NTCB_SYNY3 RecName: Full=Probable nitrogen assimilation
    8::140     2e-06  35%  313 aa  CBBR_SINMW RecName: Full=HTH-type transcriptional regulator
    5::79      2e-06  33%  308 aa  ALLS_ECOUT RecName: Full=HTH-type transcriptional activator allS;
    5::79      2e-06  33%  308 aa  ALLS_ECOK1 RecName: Full=HTH-type transcriptional activator allS;
    8::149     3e-06  27%  298 aa  TRPI_PSESY RecName: Full=HTH-type transcriptional regulator
   10::86      4e-06  36%  312 aa  Y2303_MYCBO RecName: Full=Uncharacterized HTH-type
   10::86      4e-06  36%  312 aa  Y2282_MYCTU RecName: Full=Uncharacterized HTH-type
   18::93      4e-06  32%  325 aa  BBUR_BORBR RecName: Full=HTH-type transcriptional regulator bbuR;
    8::140     7e-06  34%  313 aa  CBBR_RHIME RecName: Full=HTH-type transcriptional regulator
   10::154     9e-06  26%  311 aa  OXYR_MYCMR RecName: Full=Probable hydrogen peroxide-inducible genes
    9::258     1e-05  27%  298 aa  YHAJ_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    9::258     1e-05  27%  298 aa  YHAJ_ECO57 RecName: Full=Uncharacterized HTH-type transcriptional
    1::136     2e-05  29%  136 aa  CYSB_THIRO RecName: Full=HTH-type transcriptional regulator
   14::84      2e-05  30%  312 aa  TDCA_SHIFL RecName: Full=HTH-type transcriptional regulator
   14::84      2e-05  30%  312 aa  TDCA_ECOLI RecName: Full=HTH-type transcriptional regulator
   14::84      2e-05  30%  312 aa  TDCA_ECO57 RecName: Full=HTH-type transcriptional regulator
   23::130     2e-05  29%  316 aa  CBL_ECOLI RecName: Full=HTH-type transcriptional regulator cbl;
   15::263     3e-05  26%  298 aa  ICIA_VIBPA RecName: Full=Chromosome initiation inhibitor;AltName:
    1::124     3e-05  29%  293 aa  YNEJ_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    4::85      3e-05  30%  279 aa  HDFR_SHISS RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_SHIFL RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_SHIF8 RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_SHIDS RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_SHIBS RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  29%  278 aa  HDFR_SALTY RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  29%  278 aa  HDFR_SALTI RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  29%  278 aa  HDFR_SALSV RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  29%  278 aa  HDFR_SALPK RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  29%  278 aa  HDFR_SALPC RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  29%  278 aa  HDFR_SALPB RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  29%  278 aa  HDFR_SALPA RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  29%  278 aa  HDFR_SALNS RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  29%  278 aa  HDFR_SALHS RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  29%  278 aa  HDFR_SALDC RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  29%  278 aa  HDFR_SALA4 RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ESCF3 RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECOUT RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECOSM RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECOSE RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECOLU RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECOLI RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECOLC RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECOL6 RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECOL5 RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECOHS RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECODH RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECOBW RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECO8A RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECO81 RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECO7I RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECO5E RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECO57 RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECO55 RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECO45 RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECO27 RecName: Full=HTH-type transcriptional regulator
    4::85      3e-05  30%  279 aa  HDFR_ECO24 RecName: Full=HTH-type transcriptional regulator
    2::127     6e-05  22%  300 aa  NOCR_AGRT5 RecName: Full=Regulatory protein nocR;
    4::85      6e-05  30%  279 aa  HDFR_SHIB3 RecName: Full=HTH-type transcriptional regulator
   25::71      8e-05  47%  294 aa  TCBR_PSESQ RecName: Full=HTH-type transcriptional regulator
    2::127     8e-05  22%  300 aa  NOCR_AGRT7 RecName: Full=Regulatory protein nocR;
   11::73      1e-04  35%  196 aa  PTXE_PSEST RecName: Full=Putative HTH-type transcriptional
   27::86      1e-04  28%  303 aa  YJIE_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   39::120     2e-04  27%  317 aa  METR_SHIFL RecName: Full=HTH-type transcriptional regulator metR;
   39::120     2e-04  27%  317 aa  METR_ECOLI RecName: Full=HTH-type transcriptional regulator metR;
   39::120     2e-04  27%  317 aa  METR_ECO57 RecName: Full=HTH-type transcriptional regulator metR;
    6::93      2e-04  30%  290 aa  LYSG_CORGL RecName: Full=Lysine export transcriptional regulatory
   15::263     3e-04  25%  298 aa  ICIA_VIBVY RecName: Full=Chromosome initiation inhibitor;AltName:
    1::81      4e-04  21%  298 aa  YGFI_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    2::130     4e-04  23%  286 aa  Y2383_VIBCH RecName: Full=Uncharacterized HTH-type transcriptional
   17::120     4e-04  27%  312 aa  METR_BUCAP RecName: Full=HTH-type transcriptional regulator metR;
   15::263     4e-04  25%  298 aa  ICIA_VIBVU RecName: Full=Chromosome initiation inhibitor;AltName:
   14::263     4e-04  27%  298 aa  ICIA_VIBCM RecName: Full=Chromosome initiation inhibitor;AltName:
   14::263     4e-04  27%  298 aa  ICIA_VIBCH RecName: Full=Chromosome initiation inhibitor;AltName:
   13::259     4e-04  32%  297 aa  ICIA_PSEPF RecName: Full=Chromosome initiation inhibitor;AltName:
   25::71      5e-04  45%  295 aa  TFDS_RALEJ RecName: Full=HTH-type transcriptional regulator tfdS;
   25::71      5e-04  45%  295 aa  TFDR_RALEJ RecName: Full=HTH-type transcriptional regulator tdfR;
    1::124     5e-04  23%  298 aa  OCCR_RHIRD RecName: Full=Octopine catabolism/uptake operon
    1::124     5e-04  23%  298 aa  OCCR_AGRT4 RecName: Full=Octopine catabolism/uptake operon
   14::263     5e-04  27%  298 aa  ICIA_VIBC3 RecName: Full=Chromosome initiation inhibitor;AltName:
    6::128     7e-04  28%  294 aa  LRRA_SYNE7 RecName: Full=Probable HTH-type transcriptional
   13::235     9e-04  27%  299 aa  ICIA_PSEF5 RecName: Full=Chromosome initiation inhibitor;AltName:
    1::302

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQLNMLEAMNIYVNVVEQGSFIRAAEVLELHRPAVTRAVQNLEHDLGVKLLHRTTRQVSMTDEGEEFYQR
YHJC_ECOLI      --MDKIHAMQLFIKVAELESFSRAADFFALPKGSVSRQIQALEHQLGTQLLQRTTRRVKLTPEGMTYYQR
YAFC_ECOLI      ------EELAIFVSVVESGSFSRAAEQLGQANSAVSRAVKKLEMKLGVSLLNRTTRQLSLTEEGERYFRR
Y1364_HAEIN     --MDKLNAISIFCKVIETQSFTLAAKQQNISVAMASKLVSQLEEHLKTRLLQRTTRKIMPTEAGMMYYQR
AAER_ECOLI      --MERLKRMSVFAKVVEFGSFTAAARQLQMSVSSISQTVSKLEDELQVKLLNRSTRSIGLTEAGRIYYQG
AAER_ECOL6      --MERLKRMSVFAKVVEFGSFTAAARQLQMSVSSISQTVSKLEDELQVKLLNRSTRSIGLTEAGRIYYQG
AAER_ECO57      --MERLKRMSVFAKVVEFGSFTAAARQLQMSVSSISQTVSKLEDELQVKLLNRSTRSIGLTEAGRIYYQG
TTDR_ECO57      --------LQVLVEIVHSGSFSAAAATLGQTPAFVTKRIQILENTLATTLLNRSARGVALTESGQRCYEH
TTDR_ECOUT      --------LQVLVEIVHSGSFSAAAATLGQTPAFVTKRIQILENTLATTLLNRSARGVALTESGQRCYEH
TTDR_ECOLI      --------LQVLVEIVHSGSFSAAAATLGQTPAFVTKRIQILENTLATTLLNRSARGVALTESGQRCYEH
TTDR_ECOL6      --------LQVLVEIVHSGSFSAAAATLGQTPAFVTKRIQILENTLATTLLNRSARGVALTESGQRCYEH
TTDR_ECOL5      --------LQVLVEIVHSGSFSAAAATLGQTPAFVTKRIQILENTLATTLLNRSARGVALTESGQRCYEH
YCAN_ECOLI      MRMNMSDFATFFA-VARNQSFRAAGDELGLSSSAISHSIKTLEQRLKIRLFNRTTRSVSLTEAGSNLYER
YEAT_ECOLI      --LPLLNDLRVFMLVARRAGFAAVAEELGVSPAFVSKRIALLEQTLNVVLLHRTTRRVTITEEGERIYQR
LTRA_KLEPN      MNLNLLPDLALFVQIVDQGSFSAVARQNGITPSAVSRSVSRLEREMGCXXXXXXXXXXXXSDAGETIYQH
PTXR_PSEAE      -----------FVAVAEHNSFTAAAEALGLSKSLLSEQLRRLEADLGIQXXXXXXXXXXXXDRGELLFGV
YCJZ_ECOLI      -----------FVVVAEERSFTRAAARLSMAQSALSQIVXXXXXXXXXXXXXXXXXSVVPTEAGEHLLSV
DSDC_ECOLI      -----LSKMHTFEVAARHQSFALAAEELSLSPSAVSHRINQLEEELGIQLFVRSHRKVELTHEGKRVYWA
GCVA_ECOLI      -RLPPLNALRVFDAAARHLSFTRAAEELFVTQAAVSHQIKSLEDFLGLKLFRRRNRSLLLTEEGQSYFLD
GCVA_ECOL6      -RLPPLNALRVFDAAARHLSFTRAAEELFVTQAAVSHQIKSLEDFLGLKLFRRRNRSLLLTEEGQSYFLD
GCVA_ECO57      -RLPPLNALRVFDAAARHLSFTRAAEELFVTQAAVSHQIKSLEDFLGLKLFRRRNRSLLLTEEGQSYFLD
OPRR_PSEAE      -----------FVAVAREGTFTRAAAQLGVTQSALSQSISGLEAXXXXXXXXXXXXSVSPTAAGERLLNA
CYNR_ECOLI      --------INYFLAVAEHGSFTRAASALHVSQPALSQQIRQLEESLGVPLFDRSGRTIRLTDAGEVWRQY
YOFA_BACSU      --------LKIFQAVAREGSITKAAQMLNYVQSNVTARVHNLEEDLNIRLFHRTNRGMKLTAAGENLLQY
GCVA_HAEIN      -RLPPLNSLKSFESAARYLSFTKAADELCVTQAAVSHQIKLLEXFLGIDLFKRKNRSLELTELGKAYFVD
AMPR_YEREN      -----LNSLRAFEAAARQLSFTKAAIELNVTHAAISQQVKALEQRLNCRLFIRISRGLVLTTEGENLLPI
YFIE_ECOLI      --------------VVEEGSFLRASQKLCCTQSTVTFHIQQLEQEFSVQLFEKIGRRMCLTREGKKLLPH
CYNR_ECO57      --------INYFLAVAEHGSFTRAASALHVSQPALSQQIRQLEESLGVPLFDRSGRTIHLTDAGEVWRQY
GLTC_BACSU      -----LRQLRYFMEVAEREHVSEAADHLHVAQSAISRQIANLEEELNVTLFEREGRNIKLTPIGKEFLIH
AMPR_PSEAE      -----LNALRAFEASARHLSFTRAAIELCVTQAAVSHQVKSLEERLGVALFKRLPRGLMLTHEGESLLP-
AMPR_CITFR      -----LNSLRAFEAAARHLSFTRAAIELNVTHSAISQHVKSLEQQLNCQLFVRGSRGLMLTTEGESLLPV
SINR_SALTY      ----------IFIKVAEVGNLSRAARELDISISAVSKSLSRLENSIEVTLLRRDSHHLELTGAGQTAYAS
AMPR_RHOCA      -----LNALRVFEVAMRQGSFTKAAIELRVTQAAVSHQVARLEDLLGTALFLRTSQGLIPTDEGRLLFP-
BENM_ACIAD      -----LRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQY
YWBI_BACSU      --------LTYFLEVARLKSFTKASQSLYVSQPTISKMIKNLEEELGIELFYRNGRQVELTDAGHSMYVQ
YFER_SHIFL      -----LKQLKVFVTVAQEKSFSRAGERIGLSQSAVSHSVKELENHTGVRLLDRTTREVVLTDAGQQXXXX
YFER_ECOLI      -----LKQLKVFVTVAQEKSFSRAGERIGLSQSAVSHSVKELENHTGVRLLDRTTREVVLTDAGQQXXXX
HVRB_RHOCA      -----LTALRAFAATASEGGFSAAARKLNVTHAAIAQQVRALEADLDVPLVWRDGKHLHLTPEGERFAKA
YCGK_BACSU      -----IKVMEYAAEIARRQSFTKAAEHLHIAQPSLSQQIKKLEAELGLTLFHRSHGSVTLTPHGRRFIEK
AMPR_ENTCL      -----LNSLRAFEAAARHLSFTHAAIELNVTHSAISQHVKTLEQHLNCQLFVRVSRGLMLTTEGENLLPV
YBHD_ECOLI      -----LSSMKAFVILAESSSFNNAAKLLNITQPALTRRIKKMEEDLHVQLFERTTRKVTLTKAGKRLLPE
GLTR_BACSU      -----IQLLQVFLTTAREGSISKAALTLNYAQSNVTNKIQQLENDLQTKLFYRHSRGITLTPPGQILVSY
TTUA4_AGRVI     -----LEQLKCFVAAAEELHFGRAAQKMGILPASLGRHLRLLEESLGTRLMSRTTRSVALTEDGVALLEE
CMPR_SYNY3      -----LHQFEVFAAIARTGSFTKAAEELFLTQPTVSQQMKQLTKAIGVPLYEQIGRKIYLTEAGQAVLDA
ABGR_ECOLI      -----IHQIRAFVEVARQGSIRGASRMLNMSQPALSKSIQELEEGLAAQLFFRRSKGVTLTDAGESFYQH
Y4MQ_RHISN      LQTTSLSAMRIFEXXXXXXXXXXXXEELNLSPSAVSHAIMRLERDLGVALFERTTRSVSLTVAGQTLLNH
TTUA3_AGRVI     MELNQLRC---FVSVADELHFGRAAQKLGLMPASLSRHIRMLEESLGTRLMARTTRSVALTDDGLFLLEG
CYSL_BACSU      ------DVLKTFIAVVEEKNFTKAAEKLMISQPSVSLHIKNLEKEFQTALLNRSPKHFTTTPTGDILYQR
MAUR_PARDE      ------------------GSFNRAAKMLNVEETTIARRLARLEGSLGCVLFQAVDGQRRPTEQCRALLQP
NAC_KLEAE       -----LRRLKYFVKIVDIGSLTQAAEVLHIAQPALSQQVATLEGEMDQQLLIRTKRGVTPTEAGKILYTH
YYBE_BACSU      ------EQLEYFQTLARMQHVTKAAKSLSITQPALSRSIARLENHLGVPLFDRQGRSISLNQYGHIFLRR
YIBL_AZOVI      -----LASLNAFIAVAETGSFSEAGERLHLTQPAVSKRIAALEQQLQVRLFDRLGREVRLTEAGRALLPR
PERR_ECOLI      ----------------------------------ISHAIRKLENLLDVRLFQRSTREITLTKEGEILLEH
OXYR_STRVD      -----LAQLRAFAAVAEHLHFRDAAAAIGMSQPALSGAVSALEESLGVTLLERTTRKVLLSPAGERLAAR
SDSB_PSES9      --MNDLRQLRHFVALAEHGHFARAAEAVNLSQPALSRSIQALENGLGCRLLDRGPRQVSLTAHGRLVLEH
CATM_ACIAD      -----LRHLRYFVTVVEEQSISKAAEKLCIAQPPLSRQIQKLEEELGIQLFERGFRPAKVTEAGMFFYQH
YOFA_BACA2      --------LKIFQAVARKGSISKAAESLHYVQSNVTNRIQQLERQLQTQLFYRTNRGMTLTPAGENLLKD
NAC_ECOLI       --------LKYFVKIVDIGSLTQAAEVLHIAQPALSQQVATLEGELNQQLLIRTKRGVTPTDAGKILYTH
ILVY_SALTY      -----LRDLKTFLHLAESRHFGRSARAMHVSPSTLSRQIQRLEEDLGQPLFVRDNRTVTLTEAGEELRVF
ILVY_SALTI      -----LRDLKTFLHLAESRHFGRSARAMHVSPSTLSRQIQRLEEDLGQPLFVRDNRTVTLTEAGEELRVF
ILVY_ECOLI      -----LRDLKTFLHLAESRHFGRSARAMHVSPSTLSRQIQRLEEDLGQPLFVRDNRTVTLTEAGEELRVF
RBCR_CYAPA      -----LEQLRILKAIATEGSFKKAAESLYMTQPAISLQIQTLEKKLNIALFDRSGRRALMTEAGHLLYGD
SMER_SERMA      --LRAFEASARYLNFTKAG--------LELHQAAVSQHVRTLEAILGVNLFKRLPRGLQLTEEG------
RBCR_PHATR      -----LQQLRILKAVATEKNFTKAAELLYLSQPSLSKQIKTLEKNLDILLVNRENNKISLTENGKIFLQR
RBCR_CYAME      -----LDQLRIFQAIVVEGSFQKAAQSLYISQPAVSLQIQNLEQQLNAPLFDRSHRKAKLTEAGQVFFKY
CZCR_BACCR      -----LRDLQIFKSVADQGSVSSAAKELNYVQSNVTARIKQLENELKTPLFYRHKRGMTLTAEGRKMLVY
YVBU_BACSU      --------LKVFVKIAETGSFTKAGQALNMTQPAVSHAISAIEAELDVKLIIRDRRNLMLTDTGKQILVH
YTLI_BACSU      -----LRSIKTFHTIVKFGSFYKAAEILNYSQPTISMRMKQLEQDLGVLLFER-GKSLQLTKAGKLFYER
YEIE_ECOLI      -----LRQLEVFAEVLKSGSTTXXXXXXXXXXXXXXXXXTDLEGQLGVQLFDRVGKRLVVNEHGRLLYPR
YEIE_ECOL6      -----LRQLEVFAEVLKSGSTTXXXXXXXXXXXXXXXXXTDLEGQLGVQLFDRVGKRLVVNEHGRLLYPR
YEIE_ECO57      -----LRQLEVFAEVLKSGSTTXXXXXXXXXXXXXXXXXTDLEGQLGVQLFDRVGKRLVVNEHGRLLYPR
RBCR_THAPS      -----LQQLRIFKAIASEKSFTQAAEILFVSQPSLSKQIKTLENRLGILLLNRTGNKILLTEAGVVFLQR
RBCR_GRATL      -----LDQLRILKAIVKEGSFKRAADSLYVSQPAISLQIQNLEKQLNIPLFERSNKKATLTEAGNRYGGR
CZCR_BACHK      -----LRDLQIFQSVADQGSVSSAAKELNYVQSNVTTRIKQLENELKTPLFYRHKRGMTLTAEGRKMLVY
CZCR_BACCZ      -----LRDLQIFQSVADQGSVSSAAKELNYVQSNVTARIKQLENELKTPLFYRHKRGMTLTAEGRKMLVY
CZCR_BACC1      -----LRDLQIFQSVADQGSVSSAAKELNYVQSNVTARIKQLENELKTPLFYRHKRGMTLTAEGRKMLVY
CZCR_BACAN      -----LRDLQIFQSVADQGSVSSAAKELNYVQSNVTARIKQLENELKTPLFYRHKRGMTLTAEGRKMLVY
CZCR_BACAH      -----LRDLQIFQSVADQGSVSSAAKELNYVQSNVTARIKQLENELKTPLFYRHKRGMTLTAEGRKMLVY
CMPR_SYNP6      -----LHQLKVFEAAARHSSFTRAAEELYLTQPTVSIQVKQLTKAVGLPLFEQIGKRLYLTEAGRQLYKT
CMPR_SYNE7      -----LHQLKVFEAAARHSSFTRAAEELYLTQPTVSIQVKQLTKAVGLPLFEQIGKRLYLTEAGRQLYKT
OXYR_MYCLE      -----IAGLRAFVAVVEKGHFSAAASFLGVRQSTLSQALAALESGLGVQLIERSTRRVFVTTQGRHLLPR
YIAU_ECOLI      LQLKYRELKIISV-IAASENISHAATVLGIAQANVSKYLADFESKVGLKVFDRTTRQLMLTPFGTALLPY
SOXR_ARTST      -----IKDLQIFQKVVEYGSVSKAAKSLNYVQSYVTVRIQKLEEELQTELFHRSSRGMVLNSEGKTLLFY
RBCR_GUITH      -----LDQLRILKAIASEGSFKKAAESLYISQPAVSLQIQNLEKQLNIPIFDRANRKAVFTEEGDTLLRY
RBCR_EMIHU      -----LDQLKIIKTIHREGSFKTAAKKLYISQPAVSRQVQNLERQLNTPIFYRDKRKARLTETGHKYAEQ
ARAB_STRAT      -----LALLRTFVTVHRAGSFTRAAALLGLSQPAVTSQIRTLERQLGRPLFLRQARGVTPTTIGDELAHR
CFXR_RALEH      -----LRQLQIFVTVARHASFVRAAEELHLTQPAVSMQVKQLESVVGMALFERVKGQLTLTEPGDRLLHH
BUDR_KLETE      -----LRYLRYFVAVAEARNFTRAAHDLGISQPPLSQQIQRLEREIGTPLLRRLTRGVELTEAGESFYVD
RBCR_CHLAT      -----LDQLLILKAIAAQGSFKKAADSLYISQPAVSMQVQNIEKQLNVQLLDRGGRRANLTDAGHRYGDR
IRGB_VIBC3      -----LSAVKAFHALCQHKSLTAAAKALEQPKSTLSRRLAQLEEDLGQSLLMRQGNRLTLTKAGEVFAEQ
AMPR_PROST      -----LNALRAFEASARHLSFTRAGLELNVTQAAVSQQVRLLEEQLGLELFIRLPRGLALTDEG----LA
RBCR_CHRVI      -----LRQLRVFEAVARHNSYTRAAEELHLSQPAVSMQVRQLEDEIGLSLFERLGKQVVLTEAGREVFHY
RBCR_ANAVT      -----LDQLRILKAIAVEGSFKRAADSLYVSQPAVSLQVQNLERQLDVPLFDRGGRRAQLTEAGHNYGEK
RBCR_ANASP      -----LDQLRILKAIAVEGSFKRAADSLYVSQPAVSLQVQNLERQLDVPLFDRGGRRAQLTEAGHSYGEK
RBCR_SYNY3      -----LDQLRILKAIASEGSFKRAADTLYVSQPAVSLQVQNLEKQLSVPLFDRGGRKAQLTEAGEKIITL
ILVY_HAEIN      --------LQIFIHLSDTKNFTKTATQNHMSPSTLSRQIQRLEDELGKTLFIRDNRQVKLTEYGEKFLQF
NMCR_ENTCL      --LRAFEASARYLNFTKAG--------LELHQAAVSQQVRTLEQMLGVALFTRVPRGLQLTDEG------
RBCR_PORYE      -----LDQLRILKAIAKEGSFKKAANSLYVSQPAISLQIQNLERQLNVSLFERGNKKATLTEAGSRYGGR
RBCR_PORPU      -----LDQLRILKAIAKEGSFKKAANSLYVSQPAISLQIQNLERQLNVALFERGNKKATLTEAGSRYGGR
IRGB_VIBCH      -----LSAVKAFHALCQHKSLTAAAKALEQPKSTLSRRLAQLEEDLGQSLLMRQGNRLTLTKAGEVFAEQ
HCAR_ECOLI      -----LRHLRYFVAVAQALNFTRAAEKLHTSQPSLSSQIRDLENCVGVPLLVRDKRKVALTAAGECFLQD
CATR_ACILW      -----LRQFRYFVAVARERNFTRAARQLNIAQPPLSRQIQLLEEEVGVPLLIRNSRPVQLTDAGRLFFEQ
TRPI_PSEAE      --LPSLNALRAFEAAARLHSISLAAEELHVTHGAVSRQVRLLEDDLGVALFGKDGRGVKLTDSGVRLRDA
PCAQ_RHIRD      --------LQTFVEVARQKSVIRAAEILHVSQPAVTKTIRELEDVLGVSLLEREGRGIRISRYGEVFLRH
PCAQ_AGRT5      --------LQTFVEVARQKSVIRAAEILHVSQPAVTKTIRELEDVLGVSLLEREGRGIRISRYGEVFLRH
CLCR_PSEPU      --------LRYFIAVAEEGNIGAAARRLHISQPPITRQIQALEQDLGVVLFERTHRGVELTAAGTTF---
BLAA_PROVU      -----LNALRAFEASARHLNFTKAALELYVTQGAVSQQVRMLEERLGVILFKRLPRGLEMTDDAQILFS-
RBCR_ODOSI      -----LQQLRILKAIATEKSFTRAAEVLFVSQPSLSKQIKTLESRLNISLLNRENNIVSLTQAGKEYSER
RBCR_CYACA      -----LDQLRILRAILIQGSFKKAATSLYISQPAVSSHVHNIEKQLNIQLFDRSHRNAQLTEAGQKYGGR
Y300_METJA      ---------------------------LGITQGTVSNHISALEKYFDAQLFLRTPEGVDLTPEGKIFYER
RBCR_THIFE      -----LHQLKIFAAVARHMSFARAAEELHLTPPALSIQVRQLAEAVGQPLFDQIGKKIYLTAAGEALTSA
CZCR_BACSU      -----LRDLQIFKCVAHHKSITGAAKELNYVQSNVTARIKQLENELKTPLFNRHKKGVSLSPEGRKMIEY
AMPR_CITDI      -----LNALRAFEASARHLSFTRAALELCVTQAAVSQQVRILEDRLNRVLFKRLPRGLEMTDEAQALFAV
YRAN_BACSU      ----------------EEQSVTKTAERLFTSQPSITYRLKKIEEIFGIELFTKRHKGITFTAEGEHLVAY
TFDT_RALEJ      -----IRQLKYFVAVAEAGGFGTAAQRMHISQPPLTRQIQALERDIGAKLFERTARGVELTAAGKVF---
YDCI_ECOLI      -----LRHLHTFVAVAQQGTLGRAAETLNLSQPALSKTLNELEQLTGARLFERGRQGAQLTLPGEQFLTH
YUST_BACSU      --------LRVFQMVAREGTITKAALQLGYVQSNVTARIQQLEAELGTTLFLRHNRGMTLSASGKLLLDY
CITR_BACSU      --------LHTFVTAAKYENFRKTAETLFLSQPTVTVHIKQLEKEISCKLFERKGRQIQLTDEGRAYLPY
CYSB_HAEIN      ----IVEIVNQNLNVTE------AANALYTSQPGISKQVRLLEDELGLEIFERHGKHISITPAGKKIISI
YAHB_ECOLI      ------ENLLAFTTAARFGSFSKAAEELGLTTSAISYTIKRMETGLDVVLFTRSTRSIELTESGRYFFRK
YOAU_BACSU      MVMNM-NHLHIFVKVGEKLNITEAAKELFISQPAVSKAIKNLESSLQLKLLIRDKHHLMLTDIGKEILRQ
YAGP_ECOLI      ----------------------------------------------------------------------
OXYR_ECOLI      ------------VALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGVMLLERTSRKVLFTQAGMLLVDQ
OXYR_ECOL6      ------------VALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGVMLLERTSRKVLFTQAGMLLVDQ
OXYR_ECO57      ------------VALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGVMLLERTSRKVLFTQAGMLLVDQ
CYSB_ECOLI      -----LQQLRYIVEVVNHNLNVSSAEGLYTSQPGISKQVRMLEDELGIQIFSRSGKHLTVTPAGQEIIRI
CYSB_ECOL6      -----LQQLRYIVEVVNHNLNVSSAEGLYTSQPGISKQVRMLEDELGIQIFSRSGKHLTVTPAGQEIIRI
CYSB_ECO57      -----LQQLRYIVEVVNHNLNVSSAEGLYTSQPGISKQVRMLEDELGIQIFSRSGKHLTVTPAGQEIIRI
NTCB_SYNE7      -----LEQLQAALRVAETGSFQEAAQKVGCNQSTISRQVKGLEDELGIALFRRQGR-MKLTAAGERLLPR
CYSB_SALTY      -----LQQLRYIVEVVNHNLNVSSAEGLYTSQPGISKQVRMLEDELGIQIFARSGKHLTVTPAGQEIIRI
OXYR_PECCC      ------------VALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGVMLLERTSRKVLFTQAGLLLVEQ
OXYR_MYCXE      -----LAGLRAFAAVAEKQHFGSAASALGVNQSTLSQALAGLESGLGVRLIERSTRRVFLTPEGRQLLPH
OXYR_ERWCH      ------------VALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGVMLLERTSRKVLFTQAGLLLVEQ
METR_SALTY      ------------------GSLAAAAAVLHQTQSALSHQFSDLEQRLGFRLFVRKSQPLRFTPQGEVLLQL
METR_SALTI      ------------------GSLAAAAAVLHQTQSALSHQFSDLEQRLGFRLFVRKSQPLRFTPQGEVLLQL
CYSB_KLEPN      -----LQQLRYIVEVVNHNLNVSSAEGLYTSQPGISKQVRMLEDELGIQIFARSGKHLTVTPAGQEIIRI
ALLS_SALTY      ------ETLRTFISVAETGSFSKAAERLCKTTATISYRIKLLEENTGVGLFFRTTRSVSLTAAGSHLLSQ
ALLS_SALPA      ------ETLRTFISVAETGSFSKAAERLCKTTATISYRIKLLEENTGVGLFFRTTRSVSLTAAGSHLLSQ
ALLS_SALCH      ------ETLRTFISVAETGSFSKAAERLCKTTATISYRIKLLEENTGVGLFFRTTRSVSLTAAGSHLLSQ
ALLS_ECOLI      ------ETLRTFIAVAETGSFSKAAERLCKTTATISYRIKLLEENTGVALFFRTTRSVTLTAAGEHLLSQ
ALLS_ECO57      ------ETLRTFIAVAETGSFSKAAERLCKTTATISYRIKLLEENTGVALFFRTTRSVTLTAAGEHLLSQ
OXYR_HAEIN      ------------VALSEYKHFRRAADSCNVSQPTLSGQIRKLEDELGIILLERTSRKVLFTQSGMLLVDQ
ALLS_SALTI      ------ETLRTFISVAETGSFSKAAERLCKTTATTSYRIKLLEENTGVGLFFRTTRSVSLTAAGSHLLSQ
YLAC_STAXY      --------------VVKAQSFTKAAENLYTSQPSISRDIKRLENDYDVKVFEFKHSKMTLTSDGEKLYQY
GBPR_AZOBR      -----LRHLQLFVALDEHRNLHRAAASLTMSQPAASKLLGDLEESLGVTLFERHGRGVEPNWYGGLMIRH
ALLS_KLEPN      ------ETLRTFVSVAETGSFSRAAEKLYKTTATISYRIKLLEDNTGVALFSRTTRSVLLTPAGMHLLAQ
ALLS_ECOL6      ------ETLRTFIAVAETGSFSKAAERLCKTTATISYRIKLLEENTGVALFFRTTRSVTLTAAGEHLLCQ
ALLS_ECOL5      ------ETLRTFIAVAETGSFSKAAERLCKTTATISYRIKLLEENTGVALFFRTTRSVTLTAAGEHLLCQ
YKUM_BACSU      -----LQELHMLVVLAEELNMRKAAERLFVSQPALSQRLQTIEKAWGTKIFLRSQKGLTVTPAGEKIIQF
NTCB_SYNY3      -----LEQLQAFLKVAELGSFQQAALQSEVTQSTISRQIQGLESALKCQLFHRGA-QAKLTVAGELFLRR
CBBR_SINMW      -QLRTVEA------VCRLGKINLAAEALGLTGPALTLQIQHLERDTGVALFDRTRGGMVPTAYGLAFLEA
ALLS_ECOUT      ------ETLRTFIAVAETGSFSKAAERLCKTTATISYRIKLLEENTGVALFFRTTRSVTLTAAGEHLLCQ
ALLS_ECOK1      ------ETLRTFIAVAETGSFSKAAERLCKTTATISYRIKLLEENTGVALFFRTTRSVTLTAAGEHLLCQ
TRPI_PSESY      -----LNALRAFEATARLNSVSQAAEQLHVTHGAVSRQLKVLEEHLGISLFVKDGRGLKLTDAGARLRDA
Y2303_MYCBO     -----LTCFEIFLAIAEAGSLGGAARELGLTQQAVSRRLASMEAQIGVRLAIRTTRGSQLTPAGAEWAAR
Y2282_MYCTU     -----LTCFEIFLAIAEAGSLGGAARELGLTQQAVSRRLASMEAQIGVRLAIRTTRGSQLTPAGAEWAAR
BBUR_BORBR      ------DLLNVFCWVAKTQSFSRAAAELGTSQPVITRKIGRLEECLGVALFVRSNRGCVLTAAGTVLIGK
CBBR_RHIME      -QLRTVEA------VCRLGKINLAAEALGLTGPALTLQIQHLERDAGIALFDRTRGGMVPTAYGLAFLEA
OXYR_MYCMR      -----LAGLRAFVAVAEKQHFGSAANALGVSQSTLSQALAALEAGLNLHLVERSTRRVFLTTEGRSLLPH
YHAJ_ECOLI      -----LEALRVMDAIDRRGSFAAAADELGRVPSALSYTMQKLEEELDVVLFDRSGHRTKFTNVGRMLLER
YHAJ_ECO57      -----LEALRVMDAIDRRGSFAAAADELGRVPSALSYTMQKLEEELDVVLFDRSGHRTKFTNVGRMLLER
CYSB_THIRO      MDVRQLRSLVTLVEV--RFSVSRAAECLHLVQSAVTQHLKQLEAELGTRLFVRGKRLVGLTEVGEQVLRH
TDCA_SHIFL      ----------VFQEVIRSGSIGSAAKELGLTQPAVSKIINDIEDYFGVELVVRKNTGVTLTPAGQLLLSR
TDCA_ECOLI      ----------VFQEVIRSGSIGSAAKELGLTQPAVSKIINDIEDYFGVELVVRKNTGVTLTPAGQLLLSR
TDCA_ECO57      ----------VFQEVIRSGSIGSAAKELGLTQPAVSKIINDIEDYFGVELVVRKNTGVTLTPAGQLLLSR
CBL_ECOLI       ------------------------ANMLFTSQSGVSRHIRELEDELGIEIVRRGKRLLGMTEPGKALLVI
ICIA_VIBPA      --------------VVYQGSFERAAEHLFVSQSAISQRIKQLEKFLAQPVLIR-EQPPKPTPIGKKLYRR
YNEJ_ECOLI      MDLTQLEMFNA---VAEAGSITQAAAKVHRVPSNXXXXXXXXXXXXGVDLFIRENQRLRLSPAGHNFLRY
HDFR_SHISS      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_SHIFL      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_SHIF8      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_SHIDS      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_SHIBS      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_SALTY      ------ELLKTFLEVSRTRHFGRAAEALYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTTAGEKLLPY
HDFR_SALTI      ------ELLKTFLEVSRTRHFGRAAEALYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTTAGEKLLPY
HDFR_SALSV      ------ELLKTFLEVSRTRHFGRAAEALYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTTAGEKLLPY
HDFR_SALPK      ------ELLKTFLEVSRTRHFGRAAEALYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTTAGEKLLPY
HDFR_SALPC      ------ELLKTFLEVSRTRHFGRAAEALYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTTAGEKLLPY
HDFR_SALPB      ------ELLKTFLEVSRTRHFGRAAEALYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTTAGEKLLPY
HDFR_SALPA      ------ELLKTFLEVSRTRHFGRAAEALYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTTAGEKLLPY
HDFR_SALNS      ------ELLKTFLEVSRTRHFGRAAEALYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTTAGEKLLPY
HDFR_SALHS      ------ELLKTFLEVSRTRHFGRAAEALYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTTAGEKLLPY
HDFR_SALDC      ------ELLKTFLEVSRTRHFGRAAEALYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTTAGEKLLPY
HDFR_SALA4      ------ELLKTFLEVSRTRHFGRAAEALYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTTAGEKLLPY
HDFR_ESCF3      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECOUT      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECOSM      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECOSE      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECOLU      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECOLI      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECOLC      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECOL6      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECOL5      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECOHS      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECODH      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECOBW      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECO8A      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECO81      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECO7I      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECO5E      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECO57      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECO55      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECO45      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECO27      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
HDFR_ECO24      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
NOCR_AGRT5      IQSRQLEAFRA---VMLTGGMTSAANLVRITQPAISRLIRDLEEEIGISLFERTGNRLRPTREAGILFKE
HDFR_SHIB3      ------ELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTAAGEKLLPY
TCBR_PSESQ      ---------------------------LHVSQPPITRQMQALEADLGVVLLERSHRGIELTAAGHAF---
NOCR_AGRT7      IQSRQLEAFR---PVMLTGGMTSAANLVRITQPAISRLIRDLEEEIGISLFERTGNRLRPTREAGILFKE
PTXE_PSEST      ------------VAIVQTGSFQSAARALGLAQPTVSQHLQKLEEQVGVTLVQRSRSGCQPTTRALAFMPH
YJIE_ECOLI      -------------------NFSQAAVSRNVSQPAFSRRIRALEQAIGVELFNRQVTPLQLSEQGKIFHSQ
METR_SHIFL      ----------------------------------------DLEQRLGFRLFVRKSQPLRFTPQGEILLQL
METR_ECOLI      ----------------------------------------DLEQRLGFRLFVRKSQPLRFTPQGEILLQL
METR_ECO57      ----------------------------------------DLEQRLGFRLFVRKSQPLRFTPQGEILLQL
LYSG_CORGL      --------LDTLLSIIDEGSFEGASLALSISPSAVSQRVKALEHHVGRVLVSR-TQPAKATEAGEVLVQA
ICIA_VIBVY      --------------VVAQGGFERAAEELYISQSAVSQRIKQLERFLAQSVLIR-EQPPKPTPVGKKLYRR
YGFI_ECOLI      MDIFISKKMRNFILLAQTNNIARAAEKIHMTASPFGKSIAALEEQIGYTLFTRKDNNISLNKAGQELYQK
Y2383_VIBCH     ----LLEGIETLLVLSKEKTMSRTGSQLYISQSAVSKRIANLEKKLGKKLIVPAGRHIKLTADAEQLIAS
METR_BUCAP      ------------------GSLSAAAIQLHQTQSAISHQFNELEKKLGFKLFIRKSNPIKFTAQGEILLQL
ICIA_VIBVU      --------------VVAQGGFERAAEELYISQSAVSQRIKQLERFLAQPVLIR-EQPPKPTPVGKKLYRR
ICIA_VIBCM      -------------SVVSKGSFERAAEQLFISQSAVSQRIKQLEKYLAQPVLIRPPRPTLVGKKLLGLYRR
ICIA_VIBCH      -------------SVVSKGSFERAAEQLFISQSAVSQRIKQLEKYLAQPVLIRPPRPTLVGKKLLGLYRR
ICIA_PSEPF      --------------VVEQAGFERAAQVLGLSQSAISQRIKLLEARVGQPVLVRGT-PPSPTEIGRR----
TFDS_RALEJ      ---------------------------LHISQPPVTRQIHALEQHLGVLLFERSARGVQLTPAGAAF---
TFDR_RALEJ      ---------------------------LHISQPPVTRQIHALEQHLGVLLFERSARGVQLTPAGAAF---
OCCR_RHIRD      MNLRQVEAFRA---VMLTGQMTAAAELMLVTQPAISRLIKDFEQATKLQLFERRGNHIIPTQEAKTLWKE
OCCR_AGRT4      MNLRQVEAFRA---VMLTGQMTAAAELMLVTQPAISRLIKDFEQATKLQLFERRGNHIIPTQEAKTLWKE
ICIA_VIBC3      -------------SVVSKGSFERAAEQLFISQSAVSQRIKQLEKYLAQPVLIRPPRPTLVGKKLLGLYRR
LRRA_SYNE7      --------LQILAAVVETGNFXXXXXXXXXXXXXXXRAIAALEDELGVVLLSRGRFGARPTRVGERVLQL
ICIA_PSEF5      --------------VIEQAGFERAAQVLGLSQSAISQRIKLLEARVGQPVLVRVTPPAP-----TEIGRR


                         .         .         *         .         .         .         .:140
query           CLSLLSELDDVRRLFSSTQPPKGRLRLDVPITLARAVIIPALGDFQNRYPDIEIVLGTSDRKIDLIAERV
YHJC_ECOLI      AKDVLSNLSELDGLFQQDATSSGKLRIDIPPGIAKSLLLPRLSEFLYLHPGIELELSSHDRPVDILHDGF
YAFC_ECOLI      VQSILQEMAAAEEIMETRNTPRGLLRIDAATPVVLHFLMPLIKPFRERYPEVTLSLVSSETIINLIERKV
Y1364_HAEIN     CQGILLDLDEITQLTSSLQ---GNLLISVPRDFGLLFIAPNLPTFMAKHPHLHIEVEFNDKKIDLLSEGY
AAER_ECOLI      CRRMLHEVQDVHQLYAFNNTPIGTLRIGCSSTMAQNVLAGLTAKMLKEYPGLSVNLVTGIPAPDLIADGL
AAER_ECOL6      CRRMLHEVQDVHQLYAFNNTPIGTLRIGCSSTMAQNVLAGLTAKMLKEYPGLSVNLVTGIPAPDLIADGL
AAER_ECO57      CRRMLHEVQDVHQLYAFNNTPIGTLRIGCSSTMAQNVLAGLTAKMLKEYPGLSVNLVTGIPAPDLIADGL
TTDR_ECO57      ALEILTQVDDVTQIKTR---PEGMIRIGCSFGFGRSHIAPAITELMRNYPELQVYFELFDRQIDLVQDNI
TTDR_ECOUT      ALEILTQVDDVTQIKTR---PEGMIRIGCSFGFGRSHIAPAITELMRNYPELQVHFELFDRQIDLVQDNI
TTDR_ECOLI      ALEILTQVDDVTQIKTR---PEGMIRIGCSFGFGRSHIAPAITELMRNYPELQVHFELFDRQIDLVQDNI
TTDR_ECOL6      ALEILTQVDDVTQIKTR---PEGMIRIGCSFGFGRSHIAPAITELMRNYPELQVHFELFDRQIDLVQDNI
TTDR_ECOL5      ALEILTQVDDVTQIKTR---PEGMIRIGCSFGFGRSHIAPAITELMRNYPELQVHFELFDRQIDLVQDNI
YCAN_ECOLI      LRPMLDEMNDFR------LTPTGTLKINAARVAARIFLMSLLVGFTREYPDIKVELTTDDSLVDIVQQGF
YEAT_ECOLI      ILQMMDELSDVR------QVPQGMLRIISSFGFGRQVVXXXXXXXXXXYPQLELRFDVEDRLVDLVNEGV
LTRA_KLEPN      AQQMLEAARQAMDSAGSRQTAQGKLTLSVPKAVGRFVIHPLMMAFFHRYPQVDVCLRLEDRPLDFIDDGI
PTXR_PSEAE      AQRMLGELDDVRDLQGE---PSGRLRITAPQDFVKWHISSVSAAFIRQFPKVQVEMLADDQFSDLVGQRI
YCJZ_ECOLI      LGPMLHDIDSAMASLSDLQNPSGTIRITTVEHAAKTILLPAMRTFLKSHPEIDIQLTIDYGLTDVVSERF
DSDC_ECOLI      LKSSLDTLNQ-EILDIKNQELSGTLTLYSRPSIAQCWLVPALGDFTRRYPSISLTVLTGNDNVNLQRAGI
GCVA_ECOLI      IKEIFSQLTEATRKLQA-RSAKGALTVSLLPSFAIHWLVPRLSSFNSAYPGIDVRIQAVDRQEDKLADDV
GCVA_ECOL6      IKEIFSQLTEATRKLQA-RSAKGALTVSLLPSFAIHWLVPRLSSFNSAYPGIDVRIQAVDRQEDKLADDV
GCVA_ECO57      IKEIFSQLTEATRKLQA-RSAKGALTVSLLPSFAIHWLVPRLSSFNSAYPGIDVRIQAVDRQEDKLADDV
OPRR_PSEAE      IGNRFDEIEELDELSALRDKPSGTVRITCGDHIQXXXXXXXXXXXXXEYPDIKVEFDINYGFRDIVADRF
CYNR_ECOLI      ASRALQELGAGKRIHDVADLTRGSLRIAVTPTFTSYFIGPLMADFYARYPSITLQLEMSQEKIELCRDEL
YOFA_BACSU      ADQVLSLLDQAEKSTRMSRQPKGPLRIGSLETMAVTHLPEHAASFLRRFPEVDLSVNTAD----------
GCVA_HAEIN      INKILRRLNEARLLTLKTDP---HLNISVPQTFGIQWLVPHLSEFNQLYPQIEVRLTGVDQDEGLLNKEI
AMPR_YEREN      LNDSFDRIADTLDRFS-TGIIREKVRVGVVGTFATGYLLSRLRDFQQHSPHVDILLSTHNNRVDVVAEGL
YFIE_ECOLI      IYELTRVMDTLREAAKKESDPDGELRVVSGETLLSYRMPQVLQRFRQRAPKVRLSLQSLNCYVALLNDEA
CYNR_ECO57      ASRALQELGAGKRIHDVADLTRGSLRIAVTPTFTSYFIGPLMADFYARYPGITLQL--------------
GLTC_BACSU      VKTAMKAIDYAKQIDEYLDPHRGTVKIGFPTSLASQLLPTVISAFKEEYPHVEFLLRQGSYKIEAVRNRD
AMPR_PSEAE      --VLCDSFDRIAGLLERFEGGHYRDVLTVGATFTVGWLLPRLEDFQARHPFIDLRLSTHNNRVDIAAEGL
AMPR_CITFR      LNDSFDRMAGMLDRFATKQTQE-KLKIGVVGTFAIGCLFPLLSDFKRSYPHIDLHISTHNNRVDPAAEGL
SINR_SALTY      MKRITSSLDELR---NPDKIIRGSIKFSAPAIVCEFLANKWIWEFTASYPDTKIYLDSRERS-DFFSKSL
AMPR_RHOCA      --VLEHGFDAMSRVLDRLGGRRDVLKVGVNTTFAMCWLMPRLEAFRQAHPQIDLRISTNNNRVEILREGL
BENM_ACIAD      AIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELGTKAQTEALKEGRI
YWBI_BACSU      AQNLTSELNDIMEV------KKGHVRIGLPPMIGSGFFPRVLGDFRENYPNVTFQL--------------
YFER_SHIFL      XXXXXSTLRDTGRM---GQQLSGKVRVAASQTISAHLIPQCIAESHRRYPDIQFVL--------------
YFER_ECOLI      XXXXXSTLRDTGRM---GQQLSGKVRVAASQTISAHLIPQCIAESHRRYPDIQFVL--------------
HVRB_RHOCA      LADGFSMIQSAADMLRADTSEKA-LTVTVPPVFASEWLMPRLARFWKKHPDIPLSLLPDARLVDLKEIGA
YCGK_BACSU      AEDIIRSRDDLREMQERSQGIGHKLSIGIPAVTGRYLFPPLLKQFLARYPHVEVQLVEKD----------
AMPR_ENTCL      LNDSFDRIAGMLDRFANHRAQE-KLKIGVVGTFATGVLFSQLEDFRRGYPHIDLQLSTHNNRVDPAAEGL
YBHD_ECOLI      ARELIKKFDELFNIRDMNAYHRGMVTLACIPTAVFYFLPLAIGKFNELYPNIKVRIGTNNCMESVLCNES
GLTR_BACSU      SEKILHTIEEARAAMGESSAPSGPLRIGSMETTAAVWLPQLLAHYNNLYPDLNLVTGPTEQQIQAVLHEL
TTUA4_AGRVI     VRPLLHRLQTLAEEFRSRKTQQATLRIGAIDSAAAGLIPPLLHDFRERFPGIQLVEDKSIRLIKLIAGRL
CMPR_SYNY3      SKNITSCLDQLQEVIADLQGKKGNLRL-ATITTGKYFVPRLLGEFRQQYPGISISLQIGNRQLERLANNL
ABGR_ECOLI      ASLILEELEDIRQRQGQL---AGQINIGMGASISRSLMPAVISRFHQQHPQVKVRI-MEGQLVSMINE--
Y4MQ_RHISN      ASNAFEEL---RRGVEQISSNKAQLRLHCAPSFAAQVLSPRLPQFLKENPGIEVRVAASTNYARFVDGLF
TTUA3_AGRVI     AREILERTEVLQNRFQTSRQERVEILRIGAIDSAAAGLLPTLHDFRQQCPEISTQL-SEDKTIRLIPKLL
CYSL_BACSU      AKQMVFLYEQAKEIYAHHHYVKGELKIAASFTIGEYILPPLLAQLQKLYPELDVMIGNTEE----VSERV
MAUR_PARDE      LVLMEQAAEAITLQLERQERPLRNFRLTTIDAIAQHYLAPTLADLLIAEPELSLQLETSDDNVDMARWHA
NAC_KLEAE       ARTILRQCEQAQLAVNNVQTLRGQVSIGLPGTAASAITMPLLQTVRNELPEVMVYLQES-----------
YYBE_BACSU      VQAMMKEYTEGKEIQALLKPDQGVVSLGFLHTLGTTLVPDLIGSFQQEYPNISFQL--------------
YIBL_AZOVI      AYRILSVLEDTRRALNNLNDVSGRLTL-------------------------------------------
PERR_ECOLI      IQRGFNELQQGLALVTADE--SRPLRLHTAPSFAHQWLLPRLGKFIRENPSIDLRLSASTEYARFEQDDF
OXYR_STRVD      AKSVLAEVGALVEEADALQAPTGVLRLGVIPTVAPYVLPTVLRLVHDRYPRLDL----------------
SDSB_PSES9      XXSAVSQLDNL---------GSGELRLGAGPYPGARLVPRALGRFAGAHPGVRVQL--------------
CATM_ACIAD      AVQILTHTAQASSMAKRIATVSQTLRIGYVSSLLYGLLPEIIYLFRQQNPEIHIELGTKDQINALKQGKI
YOFA_BACA2      ADRILQLLHEAQKTAQEAGDPNGPLRIGSLETAAAVHLPQFFTEYCSRYPKVQLSLSTGD----------
NAC_ECOLI       ARAILRQCEQAQAVHNVGQALSGQVSIGAPGTAASSITMPLLQAVRAEFPEIVIYL--------------
ILVY_SALTY      AQQTLLQYQQLRHTLDQQGPSSGELHIFCSVTAAYSHLPPILDRFRAEHPSVEIKLTTGD----------
ILVY_SALTI      AQQTLLQYQQLRHTLDQQGPSSGELHIFCSVTAAYSHLPPILDRFRAEHPSVEIKLTTGD----------
ILVY_ECOLI      AQQTLLQYQQLRHTIDQQGPSSGELHIFCSVTAAYSHLPPILDRFRAEHPSVEIKLTTGD----------
RBCR_CYAPA      CILALCELEDLRNL------QGGTLVIGASQTTGTYLMPRLIGLFRQRYPQVTVKLHVSTRRINIANGQV
SMER_SERMA      -LHLLPMINEAFSIMGSALEREGKIREVITVTFAVGWLLPRLSGFTKSYPWIDIRVITHNNVINLAAEGI
RBCR_PHATR      ILALCEE--SCRALIDLKNGERGSLTVGASQTIGTYLMPRVLALFAQNYPQIDLKVQVNSTRINILNREI
RBCR_CYAME      ASRILALCEETRALEDLHHLQAGSLIIGASQTIGTYLMPGLIGLFRQKYPHICVQL--------------
CZCR_BACCR      VSKILQDVDELKQVFLDSETPSGILKIGTVETVSTLPTI--LSSYYKSYPNVDLSL--------------
YVBU_BACSU      IREVLKGIEKVEQVAAAEKGLEGTIHIGTFSTASAYFMPKLISEFKQKYPKLELVL--------------
YTLI_BACSU      TGDLLMQYEALKHNLSDLKEEEGIINIGVSEPTASLIFPEILKDFLMDYPKITVNIKVDD----------
YEIE_ECOLI      ALALLEQAVEIEQLF---REDNGAIRIYASSTIGNYILPAVIARYRHDYPQIELSVGNSQDVMQAVLDRV
YEIE_ECOL6      ALALLEQAVEIEQLF---REDNGAIRIYASSTIGNYILPAVIARYRHDYPQIELSVGNSQDVMQAVLDRV
YEIE_ECO57      ALALLEQAVEIEQLF---REDNGAIRIYASSTIGNYILPAVIARYRHDYPQIELSVGNSQDVMQAVLDRV
RBCR_THAPS      ILALCEE--SCRALNDLKDGERGNLKVGASQTIGAYLMPRVLTLFAQSYPQINLHIDIDSTRI--IAKKV
RBCR_GRATL      ILALCEELEDVQNL------QGGNLVIGASQTTGTYLMPRLIGLFRQRYPQVNVQL--------------
CZCR_BACHK      VNKILQDVDELKQVFLDSETPSGILKIGTVETVSTLPTI--LSSYYKSYPNVDLSL--------------
CZCR_BACCZ      VNKILQDVDELKQVFLDSETPSGILKIGTVETVSTLPTI--LSSYYKSYPNVDLSL--------------
CZCR_BACC1      VNKILQDVDELKQVFLDSETPSGILKIGTVETVSTLPTI--LSSYYKSYPNVDLSL--------------
CZCR_BACAN      VNKILQDVDELKQVFLDSETPSGILKIGTVETVSTLPTI--LSSYYKSYPNVDLSL--------------
CZCR_BACAH      VHKILQDVDELKQVFLDSETPSGILKIGTVETVSTLPTI--LSSYYKSYPNVDLSL--------------
CMPR_SYNP6      TRQVFEQLEQLDMTIADLQGMKGQLRLAV-ITTAKYFIPRLIGPFCQRYPGINVSLKVTNHEINRINDNL
CMPR_SYNE7      TRQVFEQLEQLDMTIADLQGMKGQLRLAV-ITTAKYFIPRLIGPFCQRYPGINVSLKVTNHEINRINDNL
OXYR_MYCLE      AQAAIEAMDATAAAAGESDPLRGGMRLGLIPTVAPYVLPTMLTGLTHRLPTLTL------RVVEDQTEHL
YIAU_ECOLI      INDMLDRNEQLNNFIADYKHEKGRVTIYAPITYLSKHVIDKIKDI----GDITLSLKTCNLERNAFYEGV
SOXR_ARTST      SQNIISMVDEMIKVVQDCDNPAGSLEIGTVETVNKLPSI--LSAYHKKYPDLSLITGTEDLVDDVLNYKL
RBCR_GUITH      GNRVLSLCDETCRAIEDLKTLQGTLIIGASQTTGTYLMPRLIGLFRHKYPQIAVQL--------------
RBCR_EMIHU      ILSLCEELDELKSINS------GTLVIGASQTTGTYLMPRLIGIFRHKYPQISIEL--------------
ARAB_STRAT      AAPHLDALVEIAESGLDDDSSSRTLYLAGPPEFTTERVLPAXXXXXXXXXXXRVSFGTAEETLELSCGRH
CFXR_RALEH      ASRILGEVKDAEELQAVKDVEQGSITIGL-ISTSKYFAPKLLAGFTALHPDLRIAEGNRETLLRLLQDNI
BUDR_KLETE      ACQILALSDALEKTKGIARGMNGSLVPGITSSAAHSQIFSLLYQFQQRYPAVAL----------------
RBCR_CHLAT      ILALCDELEDLRNL------QTGTLIIGASQTTGTYLMPQLISLFRKKYPQIMVQL--------------
IRGB_VIBC3      LLELANKSQEA--LQELNNQVTGELTLVVHPNLIRGWLSQVLDEFMQQHSTLKIRLLSQFQHSDEVFEP-
AMPR_PROST      LLPVLSSFDQIESLLQQFEDGHYHEVLSVSVTFAVGWLLPRLPAFAALYPYIDLRIMTHNNVVNLAAEGV
RBCR_CHRVI      SRAIGQSLREMEEVLESLKVSRGSLRIAVASTV--NYFAPRLAIFQQRHSGIGLRLDVTNRE--------
RBCR_ANAVT      ILSLCQEIEDLQNL------QGGTLIVGASQTTGTYLLPKMIGMFRQKYPDVAVQL--------------
RBCR_ANASP      ILSLCQEIEDLQNL------QGGTLIVGASQTTGTYLLPKMIGMFRQKYPDVAVQL--------------
RBCR_SYNY3      CQETCRAIEDLQNL------QGGTLIVGASQTTGTYLLPRMIGMFRQQYPDVTVQL--------------
ILVY_HAEIN      AKTEWQNWQQFKQLKDESDELCGEIKLFCSVTASYSHLPHVLKEFRQRYPKVEIQLTTGDPALALQAQQV
NMCR_ENTCL      -MHLLPSITEALQMMSSAMDKKEVLTIAVVGTFAIGWLLPRITAFLNENPWIDIRILTHNNVVNLAAEGI
RBCR_PORYE      ILALCEELDDLQNL------QGGTLIIGASQTTGTYLMPRLIGLFRQRYPQVAVQLQVHSTRLSVANGQV
RBCR_PORPU      ILALCEELDDLQNL------QGGTLIIGASQTTGTYLMPRLIGLFRQRYPQVAVQLQVHSTRLSVANGQV
IRGB_VIBCH      LLELANKSQEA--LQELNNQVTGELTLVVHPNLIRGWLSQVLDEFMQQHSTLKIRLLSQFQHSDEVFEP-
HCAR_ECOLI      ALAILEQAENAKLRARKIVQEDRQLTIGFVPSAEVNLLPKVLPMFRLRQPDTLIEL------VSLITTQQ
CATR_ACILW      AIQVLGRVEQMQ----------------------------------------------------------
TRPI_PSEAE      CGDAFERLRGVCAEL-RRQTAEAPFVLGVPGSLLARWFIPRLDQLNRALPDLRLQLSTSEGEFDPRRPGL
PCAQ_RHIRD      ATALRQAVDSVSQEAARAGPP-------------------------------------------------
PCAQ_AGRT5      ATALRQAVDSVSQEAARAGPP-------------------------------------------------
CLCR_PSEPU      -------LEDARRLLHVTEISRVRSR--------------------------------------------
BLAA_PROVU      --VLTTAFSDIERVFK--QFERGEYRDVVSITFAVGWLLPRLAEFRQLYPRIEXXXXXXXXXXXXATEGL
RBCR_ODOSI      ILALCEE--SCRVLNDLKTGDRGNLIVGASQTIGTYLMPRVLALFAQNHPQINIVHVDSTRKI-------
RBCR_CYACA      ILALCEELEDLQNL------QCGNLIIGASQTTGTYLMPKLIGLFRQKYPQISVQL--------------
Y300_METJA      AEKILDLLNEAKLLMRAIENPEGIIRIYASTTPGEHILPSIIKEYKSSYKDFEITITDSERCFKALDEGL
RBCR_THIFE      CHDILDRLEYFTQEIAALQGEKGSLKV-ATLSTTKYFIPRMLGGFCTEHPGVATVLFIGNREVERLARNQ
CZCR_BACSU      VNKILKDVEELEQVFLDTEIPSGILKIG---TVETVRILPTIASYYKKYPNVDLSL--------------
AMPR_CITDI      LTDAFGQIDTIFRQFEGGE-YREVLTVAAVGTFAVGWLLPRIEQFRQAHPFVELRLRTXXXXXXLAAEGL
YRAN_BACSU      ARRMLQELQDTKDHISNSKEVQGHLRLGVSSNFAQYKLPKLLREFSTMYPNVQYSVQT------------
TFDT_RALEJ      ----------------------------------------------------------------------
YDCI_ECOLI      AVRVLDAINTARSLHRKEGLNNDVVRVGALPTAALGILPSVIGQFHQQQKETTLQVATMSNPMILAGLKT
YUST_BACSU      ANKIIGLLDEASKALSSSAEPSGPLMIGCTQTTAAVRLPKLLASYYEEHPNVQLSLTT------------
CITR_BACSU      ALRLLAELHRVRQGYSQT----------------------------------------------------
CYSB_HAEIN      ARELLVKAQGIRAVADETRPNHGVLRIATTNTQARYMLPSVIERFSKKYPDVSL----------------
YAHB_ECOLI      ATDLLNDFYAIRRIDTISQGIEARVRI-------------------------------------------
YOAU_BACSU      MKGIESKIYQVAN--RENKLLNGKVKIGSFPAVSTNIMPQAIAAFRSNYPRIELIEGTSDQ---------
YAGP_ECOLI      ----------------------------------------------------------------------
OXYR_ECOLI      ARTVLREVKVLKEMASQQETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLQTHQLLAQLDSGKL
OXYR_ECOL6      ARTVLREVKVLKEMASQQETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLQTHQLLAQLDSGKL
OXYR_ECO57      ARTVLREVKVLKEMASQQETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLQTHQLLAQLDSGKL
CYSB_ECOLI      AREVLSKVDAIKSVAGETWPDKGSLYIATTHTQARYALPNVIKGFIERYPRVSL----------------
CYSB_ECOL6      AREVLSKVDAIKSVAGETWPDKGSLYIATTHTQARYALPNVIKGFIERYPRVSL----------------
CYSB_ECO57      AREVLSKVDAIKSVAGETWPDKGSLYIATTHTQARYALPNVIKGFIERYPRVSL----------------
NTCB_SYNE7      CQEWQTACTEIEELLTGRQT---ELCMAIADSIGGCYLPAVLNRFQQQWPSIHLRVSTSDRALKVLR---
CYSB_SALTY      AREVLSKVDAIKSVAGETWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSL----------------
OXYR_PECCC      ARTVLREVKVLKEMASQQETMSGPLHIGLIPTVGPYLLPQIIPMLHRTFPKLEMYLQTHQLLAQLDSGKL
OXYR_MYCXE      AXXXXXXXXXXXXXXXXSDPLQGSLRLGLIPTMAPYVLPTVLAGLAERLPALTL----------------
OXYR_ERWCH      ARTVLREVKVLKEMASQQEAMSGPLHIGLIPTVGPYLLPQIIPMLHRAFPKLEMYLQTHQLLAQLDSGKL
METR_SALTY      ANQVLPQIS--RALQACNEPQQTRLRIAIECHSCIQWLTPALENFRASWPQVEM----------------
METR_SALTI      ANQVLPQIS--RALQACNEPQQTRLRIAIECHSCIQWLTPALENFRASWPQVEM----------------
CYSB_KLEPN      AREVLSKVDAIKSVAGETWPDKGSLYVATTHTQARYALPGVIKGFIERYPRVSL----------------
ALLS_SALTY      AKDWLAWLDSM-----------------------------------------------------------
ALLS_SALPA      AKDWLAWLDSM-----------------------------------------------------------
ALLS_SALCH      AKDWLAWLDSM-----------------------------------------------------------
ALLS_ECOLI      ARDWLSWLESM-----------------------------------------------------------
ALLS_ECO57      ARDWLSWLESM-----------------------------------------------------------
OXYR_HAEIN      ARTVLREVKLLKEMASNQKEMTGPLHIGLIPTVGPYLLPYIVPMLKAAFPDLEVFLQTHQLLEQLETGRL
ALLS_SALTI      AKDWLAWLDSM-----------------------------------------------------------
YLAC_STAXY      VLQ-RNYLEQALRLKMQNNAVAGDLKLGSSFTFGEYRLSRQLTKLAQMYPELHI----------------
GBPR_AZOBR      ARTILSGLQEAEELNDLLAGHSGSVSIGTVMAPAVELVVPVITTLTRDHPDLKIAVAVETS--DVLAERV
ALLS_KLEPN      AREWLGWIDSM-----------------------------------------------------------
ALLS_ECOL6      ARDWLSWLESM-----------------------------------------------------------
ALLS_ECOL5      ARDWLSWLESM-----------------------------------------------------------
YKUM_BACSU      ANDVTLEQERIRENIDELEGEHGTLKLAVASIIGQHWLPKVLKTYVEKYPNAKISLIT------------
NTCB_SYNY3      ARKICQEWDEISSLFQGKQ---------------------------------------------------
CBBR_SINMW      ARAVLAALEDSIGAISGLR--TGRLRLGV-VSTGKYFAPQLIAAFRDQVPAVEINLFIGNR-AEIIAKLR
ALLS_ECOUT      ARDWLGWLESM-----------------------------------------------------------
ALLS_ECOK1      ARDWLGWLESM-----------------------------------------------------------
TRPI_PSESY      SAEAFERLRDVELTQSSADAP---FVLGCSGSLLARWLIPRLGRLNADLPDLRLHLSAGDGDLDPRRPGL
Y2303_MYCBO     LLEVADEID-------------------------------------------------------------
Y2282_MYCTU     LLEVADEID-------------------------------------------------------------
BBUR_BORBR      APSILLQLAEIK----------------------------------------------------------
CBBR_RHIME      AIALEDSIDAIKGLRT------GRLRLGV-VSTGKYFAPQLIAAFRDQVPAVEINLFIGNR-AEIIAKLR
OXYR_MYCMR      XXXXXXXXXXXXXXXXXXXDPNGSIRFGIIPTVAPYVLPTVLAGLTRRLPTLTV------RVIEDQTERL
YHAJ_ECOLI      GRVLLEAADKL-----TTDAEALARGWETHLTIVTEALVPTPAFF----PLIDKLAAKANTQLAIITERA
YHAJ_ECO57      GRVLLEAADKL-----TTDAEALARGWETHLTIVTEALVPTPAFF----PLIDKLAAKANTQLAIITERA
CYSB_THIRO      ACEALRQTGNIVAVXXXXXXXXXXXXXGATHTQARYVLPPVIRRFAAAYPAVELQIGTPGQLVD------
TDCA_SHIFL      SESITREMKNM-----------------------------------------------------------
TDCA_ECOLI      SESITREMKNM-----------------------------------------------------------
TDCA_ECO57      SESITREMKNM-----------------------------------------------------------
CBL_ECOLI       AERILNEASNVRRLADFTNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVELIQGT------------
ICIA_VIBPA      VRLLEHEILPEIKNDTTTRPV--QLSLATNADSLATWLLPALQDMKTRQVELKLTIYGESRSIELKSGEV
YNEJ_ECOLI      SQQILALVDEARSVVAGDEP-QGLFSLG-SLESTAAVRIPALAEFNRRYPKIQFSLST------------
HDFR_SHISS      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_SHIFL      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_SHIF8      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_SHIDS      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_SHIBS      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_SALTY      AETLMNTWQAARKEVAHT----------------------------------------------------
HDFR_SALTI      AETLMNTWQAARKEVAHT----------------------------------------------------
HDFR_SALSV      AETLMNTWQAARKEVAHT----------------------------------------------------
HDFR_SALPK      AETLMNTWQAARKEVAHT----------------------------------------------------
HDFR_SALPC      AETLMNTWQAARKEVAHT----------------------------------------------------
HDFR_SALPB      AETLMNTWQAARKEVAHT----------------------------------------------------
HDFR_SALPA      AETLMNTWQAARKEVAHT----------------------------------------------------
HDFR_SALNS      AETLMNTWQAARKEVAHT----------------------------------------------------
HDFR_SALHS      AETLMNTWQAARKEVAHT----------------------------------------------------
HDFR_SALDC      AETLMNTWQAARKEVAHT----------------------------------------------------
HDFR_SALA4      AETLMNTWQAARKEVAHT----------------------------------------------------
HDFR_ESCF3      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECOUT      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECOSM      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECOSE      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECOLU      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECOLI      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECOLC      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECOL6      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECOL5      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECOHS      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECODH      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECOBW      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECO8A      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECO81      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECO7I      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECO5E      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECO57      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECO55      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECO45      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECO27      AETLMSTWQAARKEVAHT----------------------------------------------------
HDFR_ECO24      AETLMSTWQAARKEVAHT----------------------------------------------------
NOCR_AGRT5      VSRHFNGIQHIDKVAAELKKSMGSLRVACYTAPALSFMSGVIQTFIADRPDVSVYLDT------------
HDFR_SHIB3      AEMLMSTWQAARKEVAHT----------------------------------------------------
TCBR_PSESQ      -------LEDARRI--------------------------------------------------------
NOCR_AGRT7      VSRHFNGIQHIDKVAAELKKSMGSLRVACYTAPALSFMSGVIQTFIADRPDVSVYLDT------------
PTXE_PSEST      ATALL-----------------------------------------------------------------
YJIE_ECOLI      IRHLLQQLE-------------------------------------------------------------
METR_SHIFL      ANQVLPQISQA--LQACNEPQQTRLRIAIECHSCIQWLTPALENFHKNWPQVEM----------------
METR_ECOLI      ANQVLPQISQA--LQACNEPQQTRLRIAIECHSCIQWLTPALENFHKNWPQVEM----------------
METR_ECO57      ANQVLPQISQA--LQACNEPQQTRLRIAIECHSCIQWLTPALENFHKNWPQVEM----------------
LYSG_CORGL      ARKMVLLQAETKAQLS------GRL-AEIPLTIA------------------------------------
ICIA_VIBVY      VRILEHEL--IPELMNDDTAKPIQLALATNADSLATWLLPALKEMTQRQVELNLAIYGESRSIELKSGEV
YGFI_ECOLI      LFPVYQRLSAI-----------------------------------------------------------
Y2383_VIBCH     IGPTFNELHGL--IFQQTLEDNTLLRMDCSETLVAGYLGQTMGQHRKQDPHWVITTNHTPRIVE------
METR_BUCAP      SKEILPKIHKAIQNCKKTHQMIIKLAIECHSCIQW--LTPALKIFQKKWPRVEI----------------
ICIA_VIBVU      VRILEHEL--IPELMNDDTAKPIQLALATNADSLATWLLPALKEVMTRQVELNLAIYGESRSIELKSGEV
ICIA_VIBCM      VCLIEQEL--VPELTNQEHVRPVSMSIATNADSLATWLLPALDKMKSRQVELNLVIYGESRTLDKLKNEV
ICIA_VIBCH      VCLIEQEL--VPELTNQEHVRPVSMSIATNADSLATWLLPALDKMKSRQVELNLVIYGESRTLDKLKNEV
ICIA_PSEPF      ---LLNHVQQVRLLERDLQTPE-RLRIALNADSLATWWAEAVGDFQHLLLDLIVEDQTVGLKRMRAGEVA
TFDS_RALEJ      -------LEDARRM--------------------------------------------------------
TFDR_RALEJ      -------LEDARRM--------------------------------------------------------
OCCR_RHIRD      VDRAFVGLNHIGNLAADIRQAAGTLRIAAMPALANGLLPRFLAQFIRDRPNLQVSL--------------
OCCR_AGRT4      VDRAFVGLNHIGNLAADIRQAAGTLRIAAMPALANGLLPRFLAQFIRDRPNLQVSL--------------
ICIA_VIBC3      VCLIEQEL--VPELTNQEHVRPVSMSIATNADSLATWLLPALDKMKSRQVELNLVIYGESRTLDKLKNEV
LRRA_SYNE7      AQRMLQLHDSVHEVNLEKGLQGGHLRIASFRSAATHVLPPRLALFRQRCPGVSVSIIETD----------
ICIA_PSEF5      LLNHVQQVRLLERDLQSLVPAPERLRIALNADSLATWWAGAVGDFCAEH-HLLLDLVVEDQTVGLKRMRA


                         +         .         .         .         .         *         .:210
query           DCVIRLGELNDSSFVARRLGTAAMVTCAAPSYLAKHGTPHSIDELMKSHRAVNFFSNHSLQIMEWKFTVD
YHJC_ECOLI      DCVIRTGALPEDGVIARPLGKLTMVNCASPHYLTRFGYPQSPDDL-TSHAIVRYTPHLGVHPLGFEVASV
YAFC_ECOLI      DVAIRAGTLTDSSLRARPLFNSYRKIIASPDYISRYGKPETIDDL-KQHICLGFTEPASLN--TWPIASD
Y1364_HAEIN     DLALRIGYMEDSSLVSRKIGTTTVHFAASPNYLETNGIPQTPDDL-EHHNGLLY--KNAMNQVNWVGSRI
AAER_ECOLI      DVVIRVGALQDSSLFSRRLGAMPMVVCAAKSYLTQYGIPEKPADL-SSHSWLEYSVRPD---NEFELIAP
AAER_ECOL6      DVVIRVGALQDSSLFSRRLGAMPMVVCAAKSYLTQYGIPEKPADL-SSHSWLEYSVRPD---NEFELIAP
AAER_ECO57      DVVIRVGALQDSSLFSRRLGAMPMVVCAAKSYLTQYGIPEKPADL-SSHSWLEYSVRPD---NEFELIAP
TTDR_ECO57      DLDIRINDEIPDYYIAHLLTKNKRILCAAPEYLQKYPQPQSLQELSRHDCLVT--KERDMTHGIWELGNG
TTDR_ECOUT      DLDIRINDAIPDYYIAHLLTKNKRILCAAPEYLQKYPQPQSLQELSRHDCLVT--KERDMTHGIWELGNG
TTDR_ECOLI      DLDIRINDEIPDYYIAHLLTKNKRILCAAPEYLQKYPQPQSLQELSRHDCLVT--KERDMTHGIWELGNG
TTDR_ECOL6      DLDIRINDAIPDYYIAHLLTKNKRILCAAPEYLQKYPQPQSLQELSRHDCLVT--KERDMTHGIWELGNG
TTDR_ECOL5      DLDIRINDEIPDYYIAHLLTKNKRILCAAPEYLQKYPQPQSLQELSRHDCLVT--KERDMTHGIWELGNG
YCAN_ECOLI      DAGVRLSCIVEKDMISVAIGPPVKLCVAAPEYFARYGKPRHPHDLL-NHQCV-VFRYPSGKPFHWQFAKE
YEAT_ECOLI      DLDIRIGDDIAPNLIARKLATNYRILCASPEFIAQHGAPKHLTDLSALPCLVIKERDHPFGV--WQLRNK
LTRA_KLEPN      DLALRITDTPSPGLHGKPLMPIRHVICATEAYLQQHGTPYTPQDL-RAHSCISL--GETPADARWKFRRE
PTXR_PSEAE      DLAVRIGWPRDSGLHASKLCDFQQVAVATPGYLA------GLPPVLQPHDLARCWIGHTRLSTPWTWTFE
YCJZ_ECOLI      DAGVRLGGEMDKDMIAIRIGDIPMAIVGSPDYFSRRSVPTSVSQLI-DHQAINLYLPTSGTANRWRLIXX
DSDC_ECOLI      DLAIYFDDAPSAQLTHHFLMDEEILPVCSPEYAQRHALTNTVINLLHDRQA---WSNDS-GTDEWHSWAQ
GCVA_ECOLI      DVAIFYGRGNWPGLRVEKLYAEYLLPVCSPLLLTGE-KPLKTPEDLAKHTLL-----HDASRRDWQYTRQ
GCVA_ECOL6      DVAIFYGRGNWPGLRVEKLYAEYLLPVCSPLLLTGE-KPLKTPEDLAKHTLL-----HDASRRDWQYTRQ
GCVA_ECO57      DVAIFYGRGNWPGLRVEKLYAEYLLPVCSPLLLTGE-KPLKTPEDLAKHTLL-----HDASRRDWQYTRQ
OPRR_PSEAE      DAGVRLGDTIDKDMIAVPIGXXXXXXXXXXXXXXXHPKPRSPRDLV-DHNCINMRMQSGGGLYAWDFQRK
CYNR_ECOLI      DVGIAFAPVHSPELEAIPLLTESLALVVAQHHLAVH----------------------------------
YOFA_BACSU      ----------------------------------------------------------------------
GCVA_HAEIN      DLAIYYGLGNWQNLQVDRLCEENLLILASPELLAEN--PIIQPEDLKKHTLIHIHTCDNWQAMANHLQLD
AMPR_YEREN      DYAIRYGNGALAWHESHFMYAPPLAQLCAPSISKRFTPPTDLQRLLGSYRAMNWSA--------WFAAAG
YFIE_ECOLI      DVGVFYRVGNDDALNRRELGEQSLVLVASPQIADVDFTEPG------RHNACSFIINEPQCVFRQIFEST
CYNR_ECO57      ----------------------------------------------------------------------
GLTC_BACSU      IDLALLGPVNFSDITGKILFTEKIYALVPLNHLAKQKTVHLID--LRNDQFVLFPEGFVLREMAIDTCKQ
AMPR_PSEAE      DYAIRFGGGAWHGTEALALFEAPLTVLCCPEVAAQLHSPADLHTLLRSYRA-----------DEWPFQAA
AMPR_CITFR      DYTIRYGGGAWHDTDAQYLCSALMSPLCSPTLASQIQTPADILKLLRSYRR-----------DEWALWMQ
SINR_SALTY      ELVFKSGIIESEDLVYRKISPLKLVLCASPKYIRKYGISHPGD--LENHIIVG-LHNHGLSGPLTLFRQD
AMPR_RHOCA      DMAIRFGTGGWTGHDAIPLAEAPMAPLCAPGLASRLLHPSDLGQLLRSYRSA-----------EWPGWFE
BENM_ACIAD      D---------------------------------------------------------------------
YWBI_BACSU      ----------------------------------------------------------------------
YFER_SHIFL      ----------------------------------------------------------------------
YFER_ECOLI      ----------------------------------------------------------------------
HVRB_RHOCA      NIGIRFGVGKWPGVISVFLTAAPQVVVAAPELLGGR-KKLSLREMAMLPWVREGDWPEQMQLLESMGLVP
YCGK_BACSU      ----------------------------------------------------------------------
AMPR_ENTCL      DYTIRYGG-------GAWHGTEAEFLCHAP--LAPLCTPDIAASLHSPADILRFTLLRSYRRDEWTAWMQ
YBHD_ECOLI      DFGINMNNVTNSS---------------------------------------------------------
GLTR_BACSU      NGAFISGPIEHPDLVQEKVLDEEMVLVTS----ASHPVISSIQDVQTQTMLV-FRKGCSYRAKLNHILQE
TTUA4_AGRVI     DIVIRPRDGLNRNLVVRTLTQETPVIALPVTHPLANRERISVDEL-------------------------
CMPR_SYNY3      DDLYFLGK--------------------------------------------------------------
ABGR_ECOLI      ---LRQGELD------------------------------------------------------------
Y4MQ_RHISN      DADIVYGELNREDLIVIPLSEEIVLPLCAPDLAHQIKSPRDLQPLIRS----------DLKRIQWIDWFE
TTUA3_AGRVI     SGGLDLAFIRAPDFVDPKLKTVFLVVAMSENHRLAHNTSVTIHDL-------------------------
CYSL_BACSU      ----------------------------------------------------------------------
MAUR_PARDE      DIAIRLGRPRRGNFTMRRVGNLVLPRGAAPEDLVLAAYPDPLMEVPEMQDFQQYFPGRSANLRVIRVLVD
NAC_KLEAE       ----------------------------------------------------------------------
YYBE_BACSU      -------KQNHSYWLLERLKSGDLDLCLLAS--IKPENPIQWIKLWSEELFVFVPNDHPLASRELRMTVD
YIBL_AZOVI      ----------------------------------------------------------------------
PERR_ECOLI      DLDIVYGEPRPSPYEKIPLAVEELTPLCSPQLAERLKKPEDLYALT--------LIQCDVQLYQWKGWFE
OXYR_STRVD      ----------------------------------------------------------------------
SDSB_PSES9      ----------------------------------------------------------------------
CATM_ACIAD      D--LGFGRLKITDPAIRRI---------------------------------------------------
YOFA_BACA2      ----------------------------------------------------------------------
NAC_ECOLI       ----------------------------------------------------------------------
ILVY_SALTY      ----------------------------------------------------------------------
ILVY_SALTI      ----------------------------------------------------------------------
ILVY_ECOLI      ----------------------------------------------------------------------
RBCR_CYAPA      DLAVIGGE------VPHELQESLTI------------TPYAEDELVKSHPFAKLESIQKEDLYRLKFALD
SMER_SERMA      DAAIRFGHGFWQSTENYKLFSAPHTVLCPPNVAKKLTTPEDMKDLLRTYR--------------------
RBCR_PHATR      DIAVVGGEI-------------------------------------------------------------
RBCR_CYAME      ----------------------------------------------------------------------
CZCR_BACCR      ----------------------------------------------------------------------
YVBU_BACSU      ----------------------------------------------------------------------
YTLI_BACSU      ----------------------------------------------------------------------
YEIE_ECOLI      DIGFIEGPCHSTEIISEPWLEDELVVFAAPTSPLARG-PVTLEQLAAAPWILRERGSGTREIVDYLLLSH
YEIE_ECOL6      DIGFIEGPCHSTEIISEPWLEDELVVFAAPTSPLARG-PVTLEQLAAAPWILRERGSGTREIVDYLLLSH
YEIE_ECO57      DIGFIEGPCHSTEIISEPWLEDELVVFAAPTSPLARG-PVTLEQLAAAPWILRERGSGTREIVDYLLLSH
RBCR_THAPS      ----------------------------------------------------------------------
RBCR_GRATL      ----------------------------------------------------------------------
CZCR_BACHK      ----------------------------------------------------------------------
CZCR_BACCZ      ----------------------------------------------------------------------
CZCR_BACC1      ----------------------------------------------------------------------
CZCR_BACAN      ----------------------------------------------------------------------
CZCR_BACAH      ----------------------------------------------------------------------
CMPR_SYNP6      D---------------------------------------------------------------------
CMPR_SYNE7      D---------------------------------------------------------------------
OXYR_MYCLE      LTALREGAL-DAAMIALPVETAGI----------------------------------------------
YIAU_ECOLI      DVLISYAPPKDESLVASFITQYAVTAYASQRYLEKH--PISRPDELEHHSCILIDSMMIDDANIWRFNVA
SOXR_ARTST      DGAFVTGYYNHPQII-------------------------------------------------------
RBCR_GUITH      ----------------------------------------------------------------------
RBCR_EMIHU      ----------------------------------------------------------------------
ARAB_STRAT      DLAISTTRPRGALLSATPLCDEEHVLVAAPRWAERIGAAPALDDLVEVHESLPFVSRY------WASVFD
CFXR_RALEH      DLALMGRPPRELDAVSEPIAAHPHVLVASPRHPLHDAKGFDLQELRHETFLLREPGSGTRTVAEYMFR-D
BUDR_KLETE      ----------------------------------------------------------------------
RBCR_CHLAT      ----------------------------------------------------------------------
IRGB_VIBC3      DLIIWIEHAAPMGYRKERLGYWRYATYASPKYLAHRDKPTHPRELI-HHPWIDFIACRRAE-LELHHPEF
AMPR_PROST      DFAIRFGE--------------------------------------------------------------
RBCR_CHRVI      ----------------------------------------------------------------------
RBCR_ANAVT      ----------------------------------------------------------------------
RBCR_ANASP      ----------------------------------------------------------------------
RBCR_SYNY3      ----------------------------------------------------------------------
ILVY_HAEIN      DLAL------------------------------------------------------------------
NMCR_ENTCL      DASIRFG---------------------------------------------------------------
RBCR_PORYE      DLAIIGGEV-------------------------------------------------------------
RBCR_PORPU      DLAIIGGEV-------------------------------------------------------------
IRGB_VIBCH      DLIIWIEHAAPMGYRKERLGYWRYAAYASPKYLAHRDKPTHPRELI-HHPWIDFIACRRAE-LELHHPEF
HCAR_ECOLI      EEKIRRGELD------------------------------------------------------------
CATR_ACILW      ----------------------------------------------------------------------
TRPI_PSEAE      DAMLWFAE--------------------------------------------------------------
PCAQ_RHIRD      ----------------------------------------------------------------------
PCAQ_AGRT5      ----------------------------------------------------------------------
CLCR_PSEPU      ----------------------------------------------------------------------
BLAA_PROVU      DFAIRFGE--------------------------------------------------------------
RBCR_ODOSI      ----------------------------------------------------------------------
RBCR_CYACA      ----------------------------------------------------------------------
Y300_METJA      ADIAAVGYLKNKNYEYTIIGKDRLVLIVPPNHLAEKGTA-KLEDILK-----------------------
RBCR_THIFE      DDLYILGQPPEMNVVAEAFADNPLVVVAEPSRL--RDVPFILREPGSGTRAEKFFEQH------------
CZCR_BACSU      ----------------------------------------------------------------------
AMPR_CITDI      DFAIRFG---------------------------------------------------------------
YRAN_BACSU      ----------------------------------------------------------------------
TFDT_RALEJ      ----------------------------------------------------------------------
YDCI_ECOLI      EIDIGIGRMSD-----------------------------------------------------------
YUST_BACSU      ----------------------------------------------------------------------
CITR_BACSU      ----------------------------------------------------------------------
CYSB_HAEIN      ----------------------------------------------------------------------
YAHB_ECOLI      ----------------------------------------------------------------------
YOAU_BACSU      ----------------------------------------------------------------------
YAGP_ECOLI      -----------------------------------------------THKCIGWRQSPEVAPYRWPFEEN
OXYR_ECOLI      DCVI------------------------------------------------------------------
OXYR_ECOL6      DCVI------------------------------------------------------------------
OXYR_ECO57      DCVI------------------------------------------------------------------
CYSB_ECOLI      ----------------------------------------------------------------------
CYSB_ECOL6      ----------------------------------------------------------------------
CYSB_ECO57      ----------------------------------------------------------------------
NTCB_SYNE7      DGLIDLAIVMDSPTLTTSAG--------------------------------------------------
CYSB_SALTY      ----------------------------------------------------------------------
OXYR_PECCC      DCAI------------------------------------------------------------------
OXYR_MYCXE      ----------------------------------------------------------------------
OXYR_ERWCH      DCAI------------------------------------------------------------------
METR_SALTY      ----------------------------------------------------------------------
METR_SALTI      ----------------------------------------------------------------------
CYSB_KLEPN      ----------------------------------------------------------------------
ALLS_SALTY      ----------------------------------------------------------------------
ALLS_SALPA      ----------------------------------------------------------------------
ALLS_SALCH      ----------------------------------------------------------------------
ALLS_ECOLI      ----------------------------------------------------------------------
ALLS_ECO57      ----------------------------------------------------------------------
OXYR_HAEIN      DCAI------------------------------------------------------------------
ALLS_SALTI      ----------------------------------------------------------------------
YLAC_STAXY      ----------------------------------------------------------------------
GBPR_AZOBR      ----------------------------------------------------------------------
ALLS_KLEPN      ----------------------------------------------------------------------
ALLS_ECOL6      ----------------------------------------------------------------------
ALLS_ECOL5      ----------------------------------------------------------------------
YKUM_BACSU      ----------------------------------------------------------------------
NTCB_SYNY3      ----------------------------------------------------------------------
CBBR_SINMW      D---------------------------------------------------------------------
ALLS_ECOUT      ----------------------------------------------------------------------
ALLS_ECOK1      ----------------------------------------------------------------------
TRPI_PSESY      DALLVFAE--------------------------------------------------------------
Y2303_MYCBO     ----------------------------------------------------------------------
Y2282_MYCTU     ----------------------------------------------------------------------
BBUR_BORBR      ----------------------------------------------------------------------
CBBR_RHIME      D---------------------------------------------------------------------
OXYR_MYCMR      LTALREGSL-DTALIA------------------------------------------------------
YHAJ_ECOLI      DIVIAMHFRSSSEINSRKLYTLMNVYVAAPDH-PIHQEPEPLSEVTRKYRGIAVADTARERPV---LTVQ
YHAJ_ECO57      DIVIAMHFRSSSEINSRKLYTLMNVYVAAPDH-PIHQEPEPLSEVTRKYRGIAVADTARERPV---LTVQ
CYSB_THIRO      ----------------------------------------------------------------------
TDCA_SHIFL      ----------------------------------------------------------------------
TDCA_ECOLI      ----------------------------------------------------------------------
TDCA_ECO57      ----------------------------------------------------------------------
CBL_ECOLI       ----------------------------------------------------------------------
ICIA_VIBPA      AGAISLESQAIPNCRADYLGRIDYVCVANPEFYQRYFSEGVNNQTLAKAPAVSYYDDLHKKFLTEHFNVR
YNEJ_ECOLI      ----------------------------------------------------------------------
HDFR_SHISS      ----------------------------------------------------------------------
HDFR_SHIFL      ----------------------------------------------------------------------
HDFR_SHIF8      ----------------------------------------------------------------------
HDFR_SHIDS      ----------------------------------------------------------------------
HDFR_SHIBS      ----------------------------------------------------------------------
HDFR_SALTY      ----------------------------------------------------------------------
HDFR_SALTI      ----------------------------------------------------------------------
HDFR_SALSV      ----------------------------------------------------------------------
HDFR_SALPK      ----------------------------------------------------------------------
HDFR_SALPC      ----------------------------------------------------------------------
HDFR_SALPB      ----------------------------------------------------------------------
HDFR_SALPA      ----------------------------------------------------------------------
HDFR_SALNS      ----------------------------------------------------------------------
HDFR_SALHS      ----------------------------------------------------------------------
HDFR_SALDC      ----------------------------------------------------------------------
HDFR_SALA4      ----------------------------------------------------------------------
HDFR_ESCF3      ----------------------------------------------------------------------
HDFR_ECOUT      ----------------------------------------------------------------------
HDFR_ECOSM      ----------------------------------------------------------------------
HDFR_ECOSE      ----------------------------------------------------------------------
HDFR_ECOLU      ----------------------------------------------------------------------
HDFR_ECOLI      ----------------------------------------------------------------------
HDFR_ECOLC      ----------------------------------------------------------------------
HDFR_ECOL6      ----------------------------------------------------------------------
HDFR_ECOL5      ----------------------------------------------------------------------
HDFR_ECOHS      ----------------------------------------------------------------------
HDFR_ECODH      ----------------------------------------------------------------------
HDFR_ECOBW      ----------------------------------------------------------------------
HDFR_ECO8A      ----------------------------------------------------------------------
HDFR_ECO81      ----------------------------------------------------------------------
HDFR_ECO7I      ----------------------------------------------------------------------
HDFR_ECO5E      ----------------------------------------------------------------------
HDFR_ECO57      ----------------------------------------------------------------------
HDFR_ECO55      ----------------------------------------------------------------------
HDFR_ECO45      ----------------------------------------------------------------------
HDFR_ECO27      ----------------------------------------------------------------------
HDFR_ECO24      ----------------------------------------------------------------------
NOCR_AGRT5      ----------------------------------------------------------------------
HDFR_SHIB3      ----------------------------------------------------------------------
TCBR_PSESQ      ----------------------------------------------------------------------
NOCR_AGRT7      ----------------------------------------------------------------------
PTXE_PSEST      ----------------------------------------------------------------------
YJIE_ECOLI      ----------------------------------------------------------------------
METR_SHIFL      ----------------------------------------------------------------------
METR_ECOLI      ----------------------------------------------------------------------
METR_ECO57      ----------------------------------------------------------------------
LYSG_CORGL      ----------------------------------------------------------------------
ICIA_VIBVY      AGAISLESQPIAGCKADYLGRMDYVCVASPDFYQRYFAAGVNYQTLRKAPAVSYDQYDDLHN---RFLHD
YGFI_ECOLI      ----------------------------------------------------------------------
Y2383_VIBCH     ----------------------------------------------------------------------
METR_BUCAP      ----------------------------------------------------------------------
ICIA_VIBVU      AGAISLESQPIAGCKADYLGRMDYVCVASPDFYQRYFAAGVNYQTLRKAPAVSYDQYDDLHN---RFLHD
ICIA_VIBCM      VGAISLEPQPITGCSAEYLGQMEYLCVASPKYFAKGVTPRS---LIKA-PAVSYDQYDELHN---KFLWD
ICIA_VIBCH      VGAISLEPQPITGCSAEYLGQMEYLCVASPKYFAKGVTPRS---LIKA-PAVSYDQYDELHN---KFLWD
ICIA_PSEPF      GCLC-ASERPVAGARSVLLGAMRYRALASPAFIKRHFPDGVRAEQLPRTPALVFGPDDFLQHRYLSLGVD
TFDS_RALEJ      ----------------------------------------------------------------------
TFDR_RALEJ      ----------------------------------------------------------------------
OCCR_RHIRD      ----------------------------------------------------------------------
OCCR_AGRT4      ----------------------------------------------------------------------
ICIA_VIBC3      VGAISLEPQPITGCSAEYLGQMEYLCVASPKYFAKGVTPRS---LIKA-PAVSYDQYDELHN---KFLWD
LRRA_SYNE7      ----------------------------------------------------------------------
ICIA_PSEF5      GEVAACVCASERPVAGARLGAMRYRAMASPEFIVRHFPQGVRAEQLPRTPALVFGPDDFLQHRYLSLGVD


                         .         .         .         +         .         .         .:280
query           GSIASIKIPSSILVDNSEAFLSCGLAGLGVLHGLRPSLAPFIASGELTEILTDFXXXXXXVSLLYPDRRY
YHJC_ECOLI      NGVQWFKSGGMLTVNSSENYLTAGLAGLGIIQIPRIAVREALRAGRLIEVLPGYRAEPLSLSLVYPQRRE
YAFC_ECOLI      GQLHEVKY--GLSSNSGETLKQLCLSGNGIACLSDYMIDKEIARGELVELMADVLPVEMPFSAVYYSDRA
Y1364_HAEIN     NQTQRFKIQSKVVSNSGFALLNMAKAGLGIANLPKFILGRAFEKGELIEILPEYKQQKLEIHVVYPNRRH
AAER_ECOLI      EGISTRLIPQGRFVTNDPMTLVRWLAGAGIAYVPLMWVINEINRGELEILLPRYQSDPRPVYALYTEKDK
AAER_ECOL6      EGISTRLIPQGRFVTNDPMTLVRWLAGAGIAYVPLMWVINEINRGELEILLPRYQSDPRPVYALYTEKDK
AAER_ECO57      EGISTRLIPQGRFVTNDPMTLVRWLAGAGIAYVPLMWVINEINRGELEILLPRYQSDPRPVYALYTEKDK
TTDR_ECO57      QEKKSVKVSGHLSSNSGEIVLQWALEGKGIMLRSEWDVLPFLESGKLVQVLPEY-AQSANIWAVYREPLY
TTDR_ECOUT      QEKKSVKVSGHLSSNSGEIVLQWALEGKGIMLRSEWDVLPFLESGKLVRVLPEY-AQSANIWAVYREPLY
TTDR_ECOLI      QEKKSVKVSGHLSSNSGEIVLQWALEGKGIMLRSEWDVLPFLESGKLVQVLPEY-AQSANIWAVYREPLY
TTDR_ECOL6      QEKKSVKVSGHLSSNSGEIVLQWALEGKGIMLRSEWDVLPFLESGKLVRVLPEY-AQSANIWAVYREPLY
TTDR_ECOL5      QEKKSVKVSGHLSSNSGEIVLQWALEGKGIMLRSEWDVLPFLESGKLVRVLPEY-AQSANIWAVYREPLY
YCAN_ECOLI      LEIA---VAGNIILDDVDAELEAVLMGAGIGYLLYEQIKEYLDTGRLECVLEDWSTERPGFQIYYPNRQY
YEAT_ECOLI      EGPHAIKVTGPLSSNHGEIVHQWCLDGQGIALRSWWDVSENIASGHLVQVLPEY-YQPANVWAVYVSRLA
LTRA_KLEPN      GKTETVQTYGRYAANHTAVRLDAVRQHLGI--GSLPTAREALANGDIVQVLPEWSSYSGDLWLLWAGDKH
PTXR_PSEAE      RERATVQTRGRLLANNTLAVYRLVLDGAGV--SVLPSVAREIARGRLVRLLPGWRLPQGGIYALYPSARY
YCJZ_ECOLI      XXXXXXXXXXQLLLNTIDLIIDAAIDGHGLAYLPYDQVERAIKEKKLIRVLDKFTPDLPGYHLYYPHRRH
DSDC_ECOLI      HYAVNLPTSSGIGFDRSDLAVIAAMNHIGVAMGRKRLVQKRLASGELVAPFGDMTVKCHQHYYILPGRQW
GCVA_ECOLI      LGLNHINVQQGPIFSHSAMVLQAAIHGQGVALANNVMAQSEIEAGRLVCPFNDVLVSKNAFYLVCHDSQA
GCVA_ECOL6      LGLNHINVQQGPIFSHSAMVLQAAIHGQGVALANNVMAQSEIEAGRLVCPFNDVLVSKNAFYLVCHDSQA
GCVA_ECO57      LGLNHINVQQGPIFSHSAMVLQAAIHGQGVALANNVMAQSEIEAGRLVCPFNDVLVSKNAFYLVCHDSQA
OPRR_PSEAE      DRHVNVRVDGQLIFNTSPNIVDAALAGLGIAWLPEEEFAPHIEEGRLLRVLENWCPLFPGYYLYYPNRRQ
CYNR_ECOLI      ----------------------------------------------------------------------
YOFA_BACSU      ----------------------------------------------------------------------
GCVA_HAEIN      ----DLNIQQGPLFSHTFMALQAAIHGQGIVLANRLLALQEIENGSLQAVL-------------------
AMPR_YEREN      GSVPS---PSQMMFDSSVSMLEAAQAEIGI----------------------------------------
YFIE_ECOLI      LRQRRITVENTIELISIESIKRCVAANIGVSYLPRFAVAKELECGELIELPFGEQSQTITAMCAHHAGKA
CYNR_ECO57      ----------------------------------------------------------------------
GLTC_BACSU      AGFAPLVSTEGEDLDAIKGLVS---AGMGV------TLLPESTFAETTKIPIEFPQVKRTVGIIKPKNRE
AMPR_PSEAE      GLPAHAPLTRSIVFDTSLAMLEAARQGVGV----------------------------------------
AMPR_CITFR      AAGEAPPSPTHMVFDSSVTMLEAAQGGMGVAIAPVRMFTHLLSSERIVQFLTQIDLGSYWITRL--QSRP
SINR_SALTY      ESYTSGAXXXXXXXXXXXXXXXXXXEGKGI-NLMTPAATKYLKNNELEIILPEWRVPDLPIYLVWRHRQY
AMPR_RHOCA      AAGVPCPPVTGPVFDSSVALAELATSGAGVALLPISMFESYIAQGRLAQ---------------------
BENM_ACIAD      ----------------------------------------------------------------------
YWBI_BACSU      ----------------------------------------------------------------------
YFER_SHIFL      ----------------------------------------------------------------------
YFER_ECOLI      ----------------------------------------------------------------------
HVRB_RHOCA      AALKFVDFP------NEELALAAAREGIGLHLETEALIVEDLKLGWLVKI-HELTEESLGYYIVRPPGR-
YCGK_BACSU      ----------------------------------------------------------------------
AMPR_ENTCL      AAGEHPPSPTHMVFDSSVTMLEAAQAGVGIAIAPVDMFTHLLASERIVQFATQIELGSYWLTRL--QSRA
YBHD_ECOLI      ----------------------------------------------------------------------
GLTR_BACSU      EGLLPIKLMEFGIL---EAIIGCVSAGLGI----------------------------------------
TTUA4_AGRVI     ----------------------------------------------------------------------
CMPR_SYNY3      ----------------------------------------------------------------------
ABGR_ECOLI      ----------------------------------------------------------------------
Y4MQ_RHISN      ANDLGPPPSPSMSFDRSFLAVDAAVNGLGIALESDVLARRELESGKLVRPLHRICRDNRYIGLAYPKSGS
TTUA3_AGRVI     ----------------------------------------------------------------------
CYSL_BACSU      ----------------------------------------------------------------------
MAUR_PARDE      SGRAAAVLPDFLSVD-------------------------------------------------------
NAC_KLEAE       ----------------------------------------------------------------------
YYBE_BACSU      ELFEKANIQPNIMFEGEEATTAAGFVAAGLGISILPDLKG-LDQSKITKIRVSWPECQRVIGIAWIKGRF
YIBL_AZOVI      ----------------------------------------------------------------------
PERR_ECOLI      ANKMTPPNNYGLRFDRSFMAIAAAVDGLGVVLESKLLAEREIASGKLVCPLVNSTSEIHYIGLVFPQHQH
OXYR_STRVD      ----------------------------------------------------------------------
SDSB_PSES9      ----------------------------------------------------------------------
CATM_ACIAD      ----------------------------------------------------------------------
YOFA_BACA2      ----------------------------------------------------------------------
NAC_ECOLI       ----------------------------------------------------------------------
ILVY_SALTY      ----------------------------------------------------------------------
ILVY_SALTI      ----------------------------------------------------------------------
ILVY_ECOLI      ----------------------------------------------------------------------
RBCR_CYAPA      AQSAIRKVIDKVLAQNGESIKNAVQSGLGAAFVSVSAIAKELELGILHWCRIENITIKRMLSIITNPNRY
SMER_SERMA      ----------------------------------------------------------------------
RBCR_PHATR      ----------------------------------------------------------------------
RBCR_CYAME      ----------------------------------------------------------------------
CZCR_BACCR      ----------------------------------------------------------------------
YVBU_BACSU      ----------------------------------------------------------------------
YTLI_BACSU      ----------------------------------------------------------------------
YEIE_ECOLI      ----LPKFEMAMELGNSEAIKHAVRHGLGISCLSRRVIEDQLQAGTLSEVAVPLPRLMRTLWRIHHRQKH
YEIE_ECOL6      ----LPKFEMAMELGNSEAIKHAVRHGLGISCLSRRVIEDQLQAGTLSEVAVPLPRLMRTLWRIHHRQKH
YEIE_ECO57      ----LPKFEMAMELGNSEAIKHAVRHGLGISCLSRRVIEDQLQAGTLSEVAVPLPRLMRTLWRIHHRQKH
RBCR_THAPS      ----------------------------------------------------------------------
RBCR_GRATL      ----------------------------------------------------------------------
CZCR_BACHK      ----------------------------------------------------------------------
CZCR_BACCZ      ----------------------------------------------------------------------
CZCR_BACC1      ----------------------------------------------------------------------
CZCR_BACAN      ----------------------------------------------------------------------
CZCR_BACAH      ----------------------------------------------------------------------
CMPR_SYNP6      ----------------------------------------------------------------------
CMPR_SYNE7      ----------------------------------------------------------------------
OXYR_MYCLE      ----------------------------------------------------------------------
YIAU_ECOLI      GSVRDYRVKGNYVCDNTQSALELARNHLGIVFAPDKSVQSDLQDGTLVPCFQQPYEWWLDLVAIFRKREY
SOXR_ARTST      ----------------------------------------------------------------------
RBCR_GUITH      ----------------------------------------------------------------------
RBCR_EMIHU      ----------------------------------------------------------------------
ARAB_STRAT      CAPAA---TGTVIVPDLRAVLSCASAGAGL----------------------------------------
CFXR_RALEH      HLFTPAKV---ITLGSNETIKQAVMAGMGI----------------------------------------
BUDR_KLETE      ----------------------------------------------------------------------
RBCR_CHLAT      ----------------------------------------------------------------------
IRGB_VIBC3      GSYSLPALESRLQSDNMQADAIAKGRGIGLLPTWFANGFETAHPGSLIPCVNGWQSQPTEINCFYPLGRH
AMPR_PROST      ----------------------------------------------------------------------
RBCR_CHRVI      ----------------------------------------------------------------------
RBCR_ANAVT      ----------------------------------------------------------------------
RBCR_ANASP      ----------------------------------------------------------------------
RBCR_SYNY3      ----------------------------------------------------------------------
ILVY_HAEIN      ----------------------------------------------------------------------
NMCR_ENTCL      ----------------------------------------------------------------------
RBCR_PORYE      ----------------------------------------------------------------------
RBCR_PORPU      ----------------------------------------------------------------------
IRGB_VIBCH      GSYSLPALESRLQSDNMQADAIAKGRGIGLLPTWFANGFETAHPGSLIPCVNGWQSQPTEINCFYPLGRH
HCAR_ECOLI      ----------------------------------------------------------------------
CATR_ACILW      ----------------------------------------------------------------------
TRPI_PSEAE      ----------------------------------------------------------------------
PCAQ_RHIRD      ----------------------------------------------------------------------
PCAQ_AGRT5      ----------------------------------------------------------------------
CLCR_PSEPU      ----------------------------------------------------------------------
BLAA_PROVU      ----------------------------------------------------------------------
RBCR_ODOSI      ----------------------------------------------------------------------
RBCR_CYACA      ----------------------------------------------------------------------
Y300_METJA      ----------------------------------------------------------------------
RBCR_THIFE      ----GVILKTRMEFGSNEAVKQSVAGGLGITVLSASTIRAELASGKLAILDVRGFPLERKWYAVYPAGKR
CZCR_BACSU      ----------------------------------------------------------------------
AMPR_CITDI      ----------------------------------------------------------------------
YRAN_BACSU      ----------------------------------------------------------------------
TFDT_RALEJ      ----------------------------------------------------------------------
YDCI_ECOLI      ----------------------------------------------------------------------
YUST_BACSU      ----------------------------------------------------------------------
CITR_BACSU      ----------------------------------------------------------------------
CYSB_HAEIN      ----------------------------------------------------------------------
YAHB_ECOLI      ----------------------------------------------------------------------
YOAU_BACSU      ----------------------------------------------------------------------
YAGP_ECOLI      GRTFDLAIEPQITTNDXXXXXXXXXXXXXITIATQETFRPYIESGKLVSLLDDFLPQFPGFYLYFPQRRN
OXYR_ECOLI      ----------------------------------------------------------------------
OXYR_ECOL6      ----------------------------------------------------------------------
OXYR_ECO57      ----------------------------------------------------------------------
CYSB_ECOLI      ----------------------------------------------------------------------
CYSB_ECOL6      ----------------------------------------------------------------------
CYSB_ECO57      ----------------------------------------------------------------------
NTCB_SYNE7      ----------------------------------------------------------------------
CYSB_SALTY      ----------------------------------------------------------------------
OXYR_PECCC      ----------------------------------------------------------------------
OXYR_MYCXE      ----------------------------------------------------------------------
OXYR_ERWCH      ----------------------------------------------------------------------
METR_SALTY      ----------------------------------------------------------------------
METR_SALTI      ----------------------------------------------------------------------
CYSB_KLEPN      ----------------------------------------------------------------------
ALLS_SALTY      ----------------------------------------------------------------------
ALLS_SALPA      ----------------------------------------------------------------------
ALLS_SALCH      ----------------------------------------------------------------------
ALLS_ECOLI      ----------------------------------------------------------------------
ALLS_ECO57      ----------------------------------------------------------------------
OXYR_HAEIN      ----------------------------------------------------------------------
ALLS_SALTI      ----------------------------------------------------------------------
YLAC_STAXY      ----------------------------------------------------------------------
GBPR_AZOBR      ----------------------------------------------------------------------
ALLS_KLEPN      ----------------------------------------------------------------------
ALLS_ECOL6      ----------------------------------------------------------------------
ALLS_ECOL5      ----------------------------------------------------------------------
YKUM_BACSU      ----------------------------------------------------------------------
NTCB_SYNY3      ----------------------------------------------------------------------
CBBR_SINMW      ----------------------------------------------------------------------
ALLS_ECOUT      ----------------------------------------------------------------------
ALLS_ECOK1      ----------------------------------------------------------------------
TRPI_PSESY      ----------------------------------------------------------------------
Y2303_MYCBO     ----------------------------------------------------------------------
Y2282_MYCTU     ----------------------------------------------------------------------
BBUR_BORBR      ----------------------------------------------------------------------
CBBR_RHIME      ----------------------------------------------------------------------
OXYR_MYCMR      ----------------------------------------------------------------------
YHAJ_ECOLI      LLDKQPRLTVSTIEDKRQAL----LAGLGVATMPYPMVEKDIAEGRL-----------------------
YHAJ_ECO57      LLDKQPRLTVSTIEDKRQAL----LAGLGVATMPYPMVEKDIAEGRL-----------------------
CYSB_THIRO      ----------------------------------------------------------------------
TDCA_SHIFL      ----------------------------------------------------------------------
TDCA_ECOLI      ----------------------------------------------------------------------
TDCA_ECO57      ----------------------------------------------------------------------
CBL_ECOLI       ----------------------------------------------------------------------
ICIA_VIBPA      --------PDSVIISSSEAFLKMALAGVAYCLIPRLQITDELEQGSLIDITPGF----------------
YNEJ_ECOLI      ----------------------------------------------------------------------
HDFR_SHISS      ----------------------------------------------------------------------
HDFR_SHIFL      ----------------------------------------------------------------------
HDFR_SHIF8      ----------------------------------------------------------------------
HDFR_SHIDS      ----------------------------------------------------------------------
HDFR_SHIBS      ----------------------------------------------------------------------
HDFR_SALTY      ----------------------------------------------------------------------
HDFR_SALTI      ----------------------------------------------------------------------
HDFR_SALSV      ----------------------------------------------------------------------
HDFR_SALPK      ----------------------------------------------------------------------
HDFR_SALPC      ----------------------------------------------------------------------
HDFR_SALPB      ----------------------------------------------------------------------
HDFR_SALPA      ----------------------------------------------------------------------
HDFR_SALNS      ----------------------------------------------------------------------
HDFR_SALHS      ----------------------------------------------------------------------
HDFR_SALDC      ----------------------------------------------------------------------
HDFR_SALA4      ----------------------------------------------------------------------
HDFR_ESCF3      ----------------------------------------------------------------------
HDFR_ECOUT      ----------------------------------------------------------------------
HDFR_ECOSM      ----------------------------------------------------------------------
HDFR_ECOSE      ----------------------------------------------------------------------
HDFR_ECOLU      ----------------------------------------------------------------------
HDFR_ECOLI      ----------------------------------------------------------------------
HDFR_ECOLC      ----------------------------------------------------------------------
HDFR_ECOL6      ----------------------------------------------------------------------
HDFR_ECOL5      ----------------------------------------------------------------------
HDFR_ECOHS      ----------------------------------------------------------------------
HDFR_ECODH      ----------------------------------------------------------------------
HDFR_ECOBW      ----------------------------------------------------------------------
HDFR_ECO8A      ----------------------------------------------------------------------
HDFR_ECO81      ----------------------------------------------------------------------
HDFR_ECO7I      ----------------------------------------------------------------------
HDFR_ECO5E      ----------------------------------------------------------------------
HDFR_ECO57      ----------------------------------------------------------------------
HDFR_ECO55      ----------------------------------------------------------------------
HDFR_ECO45      ----------------------------------------------------------------------
HDFR_ECO27      ----------------------------------------------------------------------
HDFR_ECO24      ----------------------------------------------------------------------
NOCR_AGRT5      ----------------------------------------------------------------------
HDFR_SHIB3      ----------------------------------------------------------------------
TCBR_PSESQ      ----------------------------------------------------------------------
NOCR_AGRT7      ----------------------------------------------------------------------
PTXE_PSEST      ----------------------------------------------------------------------
YJIE_ECOLI      ----------------------------------------------------------------------
METR_SHIFL      ----------------------------------------------------------------------
METR_ECOLI      ----------------------------------------------------------------------
METR_ECO57      ----------------------------------------------------------------------
LYSG_CORGL      ----------------------------------------------------------------------
ICIA_VIBVY      HFNISRDSIINHNVGSSEAFVRLAVSGIAYCLIPKLQIEQELASGVLMDITPGF----------------
YGFI_ECOLI      ----------------------------------------------------------------------
Y2383_VIBCH     ----------------------------------------------------------------------
METR_BUCAP      ----------------------------------------------------------------------
ICIA_VIBVU      HFNISRDSIINHNVGSSEAFVRLAVSGIAYCLIPKLQIEQELASGVLMDITPGF----------------
ICIA_VIBCM      YFAVPRDKVINHTVGSSEAFVRLALSGAAYCLIPRLQIISELESGALINMTPDF----------------
ICIA_VIBCH      YFAVPRDKVINHTVGSSEAFVRLALSGAAYCLIPRLQIISELESGALINMTPDF----------------
ICIA_PSEPF      GGFEHHLCPS------SEGFIRLTEAGLG--WGLVPELREQLERGVLRELLPD-----------------
TFDS_RALEJ      ----------------------------------------------------------------------
TFDR_RALEJ      ----------------------------------------------------------------------
OCCR_RHIRD      ----------------------------------------------------------------------
OCCR_AGRT4      ----------------------------------------------------------------------
ICIA_VIBC3      YFAVLRDKVINHTVGSSEAFVRLALSGAAYCLIPRLQIISELESGALINMTPDF----------------
LRRA_SYNE7      ----------------------------------------------------------------------
ICIA_PSEF5      GAFEHHLCPS------SEGFIRLTEAGLG-----------------------------------------


                         .         *         .         .         .         .         +:350
query           LAPKVRVFIDWLCEVFGxxxxx
YHJC_ECOLI      LSRRVNLFMQWLAGV-------
YAFC_ECOLI      VSTRIRAFIDFLSE--------
Y1364_HAEIN     LPIKV-----------------
AAER_ECOLI      LPLKVQVVINSLTDYF------
AAER_ECOL6      LPLKVQVVINSLTDYF------
AAER_ECO57      LPLKVQVVINSLTDYF------
TTDR_ECO57      RSMKLRVCVEFL----------
TTDR_ECOUT      RSMKLRVCVEFL----------
TTDR_ECOLI      RSMKLRVCVEFL----------
TTDR_ECOL6      RSMKLRVCVEFL----------
TTDR_ECOL5      RSMKLRVCVEFL----------
YCAN_ECOLI      MSCGLRAFLDYV----------
YEAT_ECOLI      TSAKVRITVEFLRQYF------
LTRA_KLEPN      MPARMRAMIDYLSE--------
PTXR_PSEAE      MPVRVRAFIESLREHLG-----
YCJZ_ECOLI      AGSAFSLFIDRL----------
DSDC_ECOLI      --PKIEAFIIWLRE--------
GCVA_ECOLI      ELGKIAAFRQWI----------
GCVA_ECOL6      ELGKIAAFRQWI----------
GCVA_ECO57      ELGKIAAFRQWI----------
OPRR_PSEAE      PSPAFSLVVDAL----------
CYNR_ECOLI      ----------------------
YOFA_BACSU      ----------------------
GCVA_HAEIN      ----------------------
AMPR_YEREN      ----------------------
YFIE_ECOLI      VSPAMHTFIQCVEESF------
CYNR_ECO57      ----------------------
GLTC_BACSU      LAPSANDFYEFVIQFF------
AMPR_PSEAE      ----------------------
AMPR_CITFR      ETPAMREFSRWLTGV-------
SINR_SALTY      YSPLFQRFLSFI----------
AMPR_RHOCA      ----------------------
BENM_ACIAD      ----------------------
YWBI_BACSU      ----------------------
YFER_SHIFL      ----------------------
YFER_ECOLI      ----------------------
HVRB_RHOCA      LNPAAKIFIDWL----------
YCGK_BACSU      ----------------------
AMPR_ENTCL      ETPAMREFSRWLVE--------
YBHD_ECOLI      ----------------------
GLTR_BACSU      ----------------------
TTUA4_AGRVI     ----------------------
CMPR_SYNY3      ----------------------
ABGR_ECOLI      ----------------------
Y4MQ_RHISN      QRRLARAFADWL----------
TTUA3_AGRVI     ----------------------
CYSL_BACSU      ----------------------
MAUR_PARDE      ----------------------
NAC_KLEAE       ----------------------
YYBE_BACSU      LSPVAETFKQYVISHF------
YIBL_AZOVI      ----------------------
PERR_ECOLI      MHSALDVFKTWL----------
OXYR_STRVD      ----------------------
SDSB_PSES9      ----------------------
CATM_ACIAD      ----------------------
YOFA_BACA2      ----------------------
NAC_ECOLI       ----------------------
ILVY_SALTY      ----------------------
ILVY_SALTI      ----------------------
ILVY_ECOLI      ----------------------
RBCR_CYAPA      HSQAARIFSEEILTMF------
SMER_SERMA      ----------------------
RBCR_PHATR      ----------------------
RBCR_CYAME      ----------------------
CZCR_BACCR      ----------------------
YVBU_BACSU      ----------------------
YTLI_BACSU      ----------------------
YEIE_ECOLI      LSNALRRFLDY-----------
YEIE_ECOL6      LSNALRRFLDY-----------
YEIE_ECO57      LSNALRRFLDY-----------
RBCR_THAPS      ----------------------
RBCR_GRATL      ----------------------
CZCR_BACHK      ----------------------
CZCR_BACCZ      ----------------------
CZCR_BACC1      ----------------------
CZCR_BACAN      ----------------------
CZCR_BACAH      ----------------------
CMPR_SYNP6      ----------------------
CMPR_SYNE7      ----------------------
OXYR_MYCLE      ----------------------
YIAU_ECOLI      QPWRVQYVLD------------
SOXR_ARTST      ----------------------
RBCR_GUITH      ----------------------
RBCR_EMIHU      ----------------------
ARAB_STRAT      ----------------------
CFXR_RALEH      ----------------------
BUDR_KLETE      ----------------------
RBCR_CHLAT      ----------------------
IRGB_VIBC3      -PLRLRLFIDAL----------
AMPR_PROST      ----------------------
RBCR_CHRVI      ----------------------
RBCR_ANAVT      ----------------------
RBCR_ANASP      ----------------------
RBCR_SYNY3      ----------------------
ILVY_HAEIN      ----------------------
NMCR_ENTCL      ----------------------
RBCR_PORYE      ----------------------
RBCR_PORPU      ----------------------
IRGB_VIBCH      -PLRLRLFIDAL----------
HCAR_ECOLI      ----------------------
CATR_ACILW      ----------------------
TRPI_PSEAE      ----------------------
PCAQ_RHIRD      ----------------------
PCAQ_AGRT5      ----------------------
CLCR_PSEPU      ----------------------
BLAA_PROVU      ----------------------
RBCR_ODOSI      ----------------------
RBCR_CYACA      ----------------------
Y300_METJA      ----------------------
RBCR_THIFE      ISPRTKAFMEYL----------
CZCR_BACSU      ----------------------
AMPR_CITDI      ----------------------
YRAN_BACSU      ----------------------
TFDT_RALEJ      ----------------------
YDCI_ECOLI      ----------------------
YUST_BACSU      ----------------------
CITR_BACSU      ----------------------
CYSB_HAEIN      ----------------------
YAHB_ECOLI      ----------------------
YOAU_BACSU      ----------------------
YAGP_ECOLI      IAPKLRALIDYVKE--------
OXYR_ECOLI      ----------------------
OXYR_ECOL6      ----------------------
OXYR_ECO57      ----------------------
CYSB_ECOLI      ----------------------
CYSB_ECOL6      ----------------------
CYSB_ECO57      ----------------------
NTCB_SYNE7      ----------------------
CYSB_SALTY      ----------------------
OXYR_PECCC      ----------------------
OXYR_MYCXE      ----------------------
OXYR_ERWCH      ----------------------
METR_SALTY      ----------------------
METR_SALTI      ----------------------
CYSB_KLEPN      ----------------------
ALLS_SALTY      ----------------------
ALLS_SALPA      ----------------------
ALLS_SALCH      ----------------------
ALLS_ECOLI      ----------------------
ALLS_ECO57      ----------------------
OXYR_HAEIN      ----------------------
ALLS_SALTI      ----------------------
YLAC_STAXY      ----------------------
GBPR_AZOBR      ----------------------
ALLS_KLEPN      ----------------------
ALLS_ECOL6      ----------------------
ALLS_ECOL5      ----------------------
YKUM_BACSU      ----------------------
NTCB_SYNY3      ----------------------
CBBR_SINMW      ----------------------
ALLS_ECOUT      ----------------------
ALLS_ECOK1      ----------------------
TRPI_PSESY      ----------------------
Y2303_MYCBO     ----------------------
Y2282_MYCTU     ----------------------
BBUR_BORBR      ----------------------
CBBR_RHIME      ----------------------
OXYR_MYCMR      ----------------------
YHAJ_ECOLI      ----------------------
YHAJ_ECO57      ----------------------
CYSB_THIRO      ----------------------
TDCA_SHIFL      ----------------------
TDCA_ECOLI      ----------------------
TDCA_ECO57      ----------------------
CBL_ECOLI       ----------------------
ICIA_VIBPA      ----------------------
YNEJ_ECOLI      ----------------------
HDFR_SHISS      ----------------------
HDFR_SHIFL      ----------------------
HDFR_SHIF8      ----------------------
HDFR_SHIDS      ----------------------
HDFR_SHIBS      ----------------------
HDFR_SALTY      ----------------------
HDFR_SALTI      ----------------------
HDFR_SALSV      ----------------------
HDFR_SALPK      ----------------------
HDFR_SALPC      ----------------------
HDFR_SALPB      ----------------------
HDFR_SALPA      ----------------------
HDFR_SALNS      ----------------------
HDFR_SALHS      ----------------------
HDFR_SALDC      ----------------------
HDFR_SALA4      ----------------------
HDFR_ESCF3      ----------------------
HDFR_ECOUT      ----------------------
HDFR_ECOSM      ----------------------
HDFR_ECOSE      ----------------------
HDFR_ECOLU      ----------------------
HDFR_ECOLI      ----------------------
HDFR_ECOLC      ----------------------
HDFR_ECOL6      ----------------------
HDFR_ECOL5      ----------------------
HDFR_ECOHS      ----------------------
HDFR_ECODH      ----------------------
HDFR_ECOBW      ----------------------
HDFR_ECO8A      ----------------------
HDFR_ECO81      ----------------------
HDFR_ECO7I      ----------------------
HDFR_ECO5E      ----------------------
HDFR_ECO57      ----------------------
HDFR_ECO55      ----------------------
HDFR_ECO45      ----------------------
HDFR_ECO27      ----------------------
HDFR_ECO24      ----------------------
NOCR_AGRT5      ----------------------
HDFR_SHIB3      ----------------------
TCBR_PSESQ      ----------------------
NOCR_AGRT7      ----------------------
PTXE_PSEST      ----------------------
YJIE_ECOLI      ----------------------
METR_SHIFL      ----------------------
METR_ECOLI      ----------------------
METR_ECO57      ----------------------
LYSG_CORGL      ----------------------
ICIA_VIBVY      ----------------------
YGFI_ECOLI      ----------------------
Y2383_VIBCH     ----------------------
METR_BUCAP      ----------------------
ICIA_VIBVU      ----------------------
ICIA_VIBCM      ----------------------
ICIA_VIBCH      ----------------------
ICIA_PSEPF      ----------------------
TFDS_RALEJ      ----------------------
TFDR_RALEJ      ----------------------
OCCR_RHIRD      ----------------------
OCCR_AGRT4      ----------------------
ICIA_VIBC3      ----------------------
LRRA_SYNE7      ----------------------
ICIA_PSEF5      ----------------------