[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF67448.1

[Show Plain Result]


## Summary of Sequence Search
    1::566
   24::402     2e-15  26%  465 aa  AEPA_PECCC RecName: Full=Exoenzymes regulatory protein aepA;Flags:
    4::527     3e-11  27%  529 aa  YTCJ_BACSU RecName: Full=Putative amidohydrolase ytcJ;       
   24::87      1e-07  36%  594 aa  ADEC1_LACSS RecName: Full=Adenine deaminase 1;       
   39::89      2e-07  46%  422 aa  HUTI_ALKMQ RecName: Full=Imidazolonepropionase;       
    5::70      5e-07  39%  449 aa  ALLB_DESHY RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      9e-07  38%  453 aa  ALLB_ECOSE RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      9e-07  38%  453 aa  ALLB_ECOLU RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      9e-07  38%  453 aa  ALLB_ECOLI RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      9e-07  38%  453 aa  ALLB_ECOLC RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      9e-07  38%  453 aa  ALLB_ECOHS RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      9e-07  38%  453 aa  ALLB_ECODH RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      9e-07  38%  453 aa  ALLB_ECOBW RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      9e-07  38%  453 aa  ALLB_ECO8A RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      9e-07  38%  453 aa  ALLB_ECO55 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      9e-07  38%  453 aa  ALLB_ECO24 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    5::70      9e-07  38%  449 aa  ALLB_DESHD RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      1e-06  38%  453 aa  ALLB_ECOSM RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
   37::86      2e-06  40%  413 aa  HUTI_FUSNN RecName: Full=Imidazolonepropionase;       
   19::77      2e-06  47%  565 aa  ADEC_RHISN RecName: Full=Adenine deaminase;       
   21::83      2e-06  38%  584 aa  ADEC_METBU RecName: Full=Adenine deaminase;       
   19::77      2e-06  47%  565 aa  ADEC1_RHIME RecName: Full=Adenine deaminase 1;       
   19::77      2e-06  42%  565 aa  ADEC1_RHIEC RecName: Full=Adenine deaminase 1;       
    9::85      3e-06  49%  405 aa  HUTI_KLEP7 RecName: Full=Imidazolonepropionase;       
    4::68      3e-06  37%  453 aa  ALLB_SALTY RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      3e-06  37%  453 aa  ALLB_SALTI RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      3e-06  37%  453 aa  ALLB_SALPK RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      3e-06  37%  453 aa  ALLB_SALPB RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      3e-06  37%  453 aa  ALLB_SALPA RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      3e-06  37%  453 aa  ALLB_SALNS RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      3e-06  37%  453 aa  ALLB_SALHS RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      3e-06  37%  453 aa  ALLB_SALEP RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      3e-06  37%  453 aa  ALLB_SALDC RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      3e-06  37%  453 aa  ALLB_SALA4 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    6::80      3e-06  41%  404 aa  HUTI_BRASB RecName: Full=Imidazolonepropionase;       
   39::89      3e-06  42%  422 aa  HUTI_ALKOO RecName: Full=Imidazolonepropionase;       
   24::85      3e-06  35%  594 aa  ADEC1_DESPS RecName: Full=Adenine deaminase 1;       
    3::75      5e-06  38%  400 aa  HUTI_PARDP RecName: Full=Imidazolonepropionase;       
    2::72      6e-06  41%  406 aa  HUTI_VIBVY RecName: Full=Imidazolonepropionase;       
    2::72      6e-06  41%  406 aa  HUTI_VIBVU RecName: Full=Imidazolonepropionase;       
    2::85      8e-06  37%  416 aa  HUTI_VIBHB RecName: Full=Imidazolonepropionase;       
   30::88      8e-06  41%  575 aa  ADEC1_AGRT5 RecName: Full=Adenine deaminase 1;       
    4::68      1e-05  37%  453 aa  ALLB_ECOUT RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      1e-05  37%  453 aa  ALLB_ECOL6 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      1e-05  37%  453 aa  ALLB_ECOL5 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      1e-05  37%  453 aa  ALLB_ECOK1 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      1e-05  37%  453 aa  ALLB_ECO81 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      1e-05  37%  453 aa  ALLB_ECO45 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::68      1e-05  37%  453 aa  ALLB_ECO27 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
   21::161     1e-05  27%  579 aa  ADEC_LISW6 RecName: Full=Adenine deaminase;         Short=Adenase; 
   17::75      1e-05  37%  577 aa  ADEC_KOSOT RecName: Full=Adenine deaminase;       
   16::74      1e-05  41%  563 aa  ADEC_OCHA4 RecName: Full=Adenine deaminase;       
   37::86      2e-05  42%  415 aa  HUTI_RUBXD RecName: Full=Imidazolonepropionase;       
    4::68      2e-05  35%  453 aa  ALLB_SALCH RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::78      2e-05  36%  454 aa  ALLB_BACLD RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
   16::84      2e-05  35%  592 aa  ADEC_SILPO RecName: Full=Adenine deaminase;         Short=Adenase; 
   17::74      2e-05  33%  569 aa  ADEC_DESAA RecName: Full=Adenine deaminase;       
   10::70      2e-05  42%  484 aa  NDAD_ALCXX RecName: Full=D-aminoacylase;       
   37::89      2e-05  45%  425 aa  HUTI_SYMTH RecName: Full=Imidazolonepropionase;       
    9::85      2e-05  49%  405 aa  HUTI_KLEP3 RecName: Full=Imidazolonepropionase;       
   19::77      2e-05  42%  565 aa  ADEC_RHOS5 RecName: Full=Adenine deaminase;       
    2::68      3e-05  34%  422 aa  PYRC_STRP8 RecName: Full=Dihydroorotase;         Short=DHOase;     
    2::68      3e-05  34%  422 aa  PYRC_STRP6 RecName: Full=Dihydroorotase;         Short=DHOase;     
    2::68      3e-05  34%  422 aa  PYRC_STRP3 RecName: Full=Dihydroorotase;         Short=DHOase;     
    2::68      3e-05  34%  422 aa  PYRC_STRP1 RecName: Full=Dihydroorotase;         Short=DHOase;     
    6::73      3e-05  38%  442 aa  MTAD_DESVV RecName:
    1::77      3e-05  36%  397 aa  HUTI_ROSDO RecName: Full=Imidazolonepropionase;       
   39::88      3e-05  47%  427 aa  HUTI_CHLAD RecName: Full=Imidazolonepropionase;       
   19::77      3e-05  32%  571 aa  ADEC_DEHE1 RecName: Full=Adenine deaminase;       
  287::410     4e-05  36%  436 aa  MTAD_SYMTH RecName:
    3::64      4e-05  40%  458 aa  HYDL_ARTAU RecName: Full=L-hydantoinase;       
   17::76      4e-05  33%  574 aa  ADEC_THEAB RecName: Full=Adenine deaminase;       
   19::76      4e-05  38%  577 aa  ADEC_GEOKA RecName: Full=Adenine deaminase;       
   34::92      4e-05  41%  581 aa  ADEC_BRUSU RecName: Full=Adenine deaminase;       
   34::92      4e-05  41%  581 aa  ADEC_BRUME RecName: Full=Adenine deaminase;       
   34::92      4e-05  41%  581 aa  ADEC_BRUAB RecName: Full=Adenine deaminase;       
   34::92      4e-05  41%  581 aa  ADEC_BRUA2 RecName: Full=Adenine deaminase;       
   23::96      4e-05  32%  595 aa  ADEC3_RHIME RecName: Full=Adenine deaminase 3;       
    2::70      5e-05  33%  421 aa  PYRC_CLOD6 RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::108     5e-05  25%  430 aa  PYRC_CARHZ RecName: Full=Dihydroorotase;         Short=DHOase;     
    7::74      5e-05  38%  438 aa  MTAD_SYNFM RecName:
    9::81      5e-05  43%  431 aa  MTAD_NATPD RecName:
    6::73      5e-05  38%  442 aa  MTAD_DESVH RecName:
   12::60      5e-05  47%  454 aa  ALLB_ENTFA RecName: Full=Allantoinase;       
    2::67      7e-05  42%  457 aa  HYDA_RHIRD RecName: Full=D-hydantoinase;         EC=3.5.2.-;
   20::77      7e-05  34%  577 aa  ADEC_BACA2 RecName: Full=Adenine deaminase;       
   22::80      7e-05  41%  576 aa  ADEC1_BACSK RecName: Full=Adenine deaminase 1;       
    4::66      9e-05  43%  425 aa  PYRC_LACGA RecName: Full=Dihydroorotase;         Short=DHOase;     
   24::73      9e-05  44%  401 aa  HUTI_PSEU2 RecName: Full=Imidazolonepropionase;       
   14::90      9e-05  31%  415 aa  HUTI_PSEHT RecName: Full=Imidazolonepropionase;       
   24::73      9e-05  44%  401 aa  HUTI_PSE14 RecName: Full=Imidazolonepropionase;       
   17::90      9e-05  33%  417 aa  HUTI_MESSB RecName: Full=Imidazolonepropionase;       
   27::95      9e-05  31%  601 aa  ADEC_SILST RecName: Full=Adenine deaminase;         Short=Adenase; 
   22::86      9e-05  33%  609 aa  ADEC_CENSY RecName: Full=Adenine deaminase;       
  101::424     1e-04  33%  430 aa  PYRC_LACPL RecName: Full=Dihydroorotase;         Short=DHOase;     
    4::77      1e-04  32%  400 aa  HUTI_METNO RecName: Full=Imidazolonepropionase;       
   36::421     1e-04  36%  427 aa  HUTI_HERA2 RecName: Full=Imidazolonepropionase;       
    6::75      1e-04  41%  403 aa  HUTI_HAHCH RecName: Full=Imidazolonepropionase;       
   17::74      1e-04  36%  570 aa  ADEC_PETMO RecName: Full=Adenine deaminase;       
   21::161     1e-04  28%  579 aa  ADEC_LISIN RecName: Full=Adenine deaminase;         Short=Adenase; 
   18::75      1e-04  41%  565 aa  ADEC_CLOD6 RecName: Full=Adenine deaminase;       
   38::87      1e-04  42%  426 aa  HUTI_BACHD RecName: Full=Imidazolonepropionase;       
   22::162     1e-04  29%  580 aa  ADEC_LISMO RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::69      2e-04  28%  423 aa  PYRC_LACLA RecName: Full=Dihydroorotase;         Short=DHOase;     
    4::61      2e-04  40%  428 aa  PYRC_BACSU RecName: Full=Dihydroorotase;         Short=DHOase;   
   25::77      2e-04  30%  413 aa  HUTI_TREDE RecName: Full=Imidazolonepropionase;       
   21::161     2e-04  29%  579 aa  ADEC_LISMF RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::75      2e-04  39%  570 aa  ADEC_CLOAB RecName: Full=Adenine deaminase;       
    4::67      2e-04  41%  573 aa  ADEC2_BACSK RecName: Full=Adenine deaminase 2;       
  349::395     2e-04  40%  421 aa  HUTI_STRPD RecName: Full=Imidazolonepropionase;       
   19::77      2e-04  39%  565 aa  ADEC_RHOSK RecName: Full=Adenine deaminase;       
   19::77      2e-04  39%  565 aa  ADEC_RHOS4 RecName: Full=Adenine deaminase;       
   19::77      2e-04  36%  565 aa  ADEC_RHOS1 RecName: Full=Adenine deaminase;       
   20::77      2e-04  34%  577 aa  ADEC_BACSU RecName: Full=Adenine deaminase;       
    2::68      3e-04  27%  422 aa  PYRC_STRT2 RecName: Full=Dihydroorotase;         Short=DHOase;     
    2::68      3e-04  27%  422 aa  PYRC_STRT1 RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::66      3e-04  34%  432 aa  MTAD_METAC RecName:
  215::373     3e-04  33%  407 aa  HUTI_BURCJ RecName: Full=Imidazolonepropionase;       
    6::80      3e-04  37%  404 aa  HUTI_BRASO RecName: Full=Imidazolonepropionase;       
   28::94      3e-04  32%  605 aa  ADEC_STAMF RecName: Full=Adenine deaminase;       
   26::88      3e-04  30%  596 aa  ADEC_MOOTA RecName: Full=Adenine deaminase;       
   23::81      3e-04  37%  569 aa  ADEC1_RHIL3 RecName: Full=Adenine deaminase 1;       
    2::68      4e-04  28%  422 aa  PYRC_STRR6 RecName: Full=Dihydroorotase;         Short=DHOase;     
    2::68      4e-04  28%  422 aa  PYRC_STRPN RecName: Full=Dihydroorotase;         Short=DHOase;     
   10::66      4e-04  42%  425 aa  PYRC_LACJO RecName: Full=Dihydroorotase;         Short=DHOase;     
   23::66      4e-04  48%  425 aa  PYRC_LACH4 RecName: Full=Dihydroorotase;         Short=DHOase;     
   23::66      4e-04  48%  425 aa  PYRC_LACDB RecName: Full=Dihydroorotase;         Short=DHOase;     
   23::66      4e-04  48%  425 aa  PYRC_LACDA RecName: Full=Dihydroorotase;         Short=DHOase;     
    6::66      4e-04  36%  488 aa  NDED_ALCXX RecName: Full=N-acyl-D-glutamate deacylase;       
  349::395     4e-04  38%  421 aa  HUTI_STRPZ RecName: Full=Imidazolonepropionase;       
  349::395     4e-04  38%  421 aa  HUTI_STRPM RecName: Full=Imidazolonepropionase;       
  349::395     4e-04  38%  421 aa  HUTI_STRPG RecName: Full=Imidazolonepropionase;       
   39::88      4e-04  38%  421 aa  HUTI_STRPF RecName: Full=Imidazolonepropionase;       
  349::395     4e-04  38%  421 aa  HUTI_STRPC RecName: Full=Imidazolonepropionase;       
  349::395     4e-04  38%  421 aa  HUTI_STRPB RecName: Full=Imidazolonepropionase;       
  349::395     4e-04  38%  421 aa  HUTI_STRP8 RecName: Full=Imidazolonepropionase;       
  349::395     4e-04  38%  421 aa  HUTI_STRP1 RecName: Full=Imidazolonepropionase;       
   38::83      4e-04  48%  412 aa  HUTI_STAAW RecName: Full=Imidazolonepropionase;       
   38::83      4e-04  48%  412 aa  HUTI_STAAT RecName: Full=Imidazolonepropionase;       
   38::83      4e-04  48%  412 aa  HUTI_STAAS RecName: Full=Imidazolonepropionase;       
   38::83      4e-04  48%  412 aa  HUTI_STAAR RecName: Full=Imidazolonepropionase;       
   38::83      4e-04  48%  412 aa  HUTI_STAAE RecName: Full=Imidazolonepropionase;       
   38::83      4e-04  48%  412 aa  HUTI_STAAC RecName: Full=Imidazolonepropionase;       
   38::83      4e-04  48%  412 aa  HUTI_STAA8 RecName: Full=Imidazolonepropionase;       
   38::83      4e-04  48%  412 aa  HUTI_STAA3 RecName: Full=Imidazolonepropionase;       
   13::86      4e-04  35%  418 aa  HUTI_COLP3 RecName: Full=Imidazolonepropionase;       
  215::373     4e-04  33%  407 aa  HUTI_BURCM RecName: Full=Imidazolonepropionase;       
    8::87      4e-04  34%  421 aa  HUTI_BACSU RecName: Full=Imidazolonepropionase;       
   30::84      4e-04  47%  409 aa  HUTI_ARTAT RecName: Full=Imidazolonepropionase;       
   31::105     4e-04  34%  588 aa  ADEC_SHIFL RecName: Full=Adenine deaminase;         Short=Adenase; 
   31::105     4e-04  34%  588 aa  ADEC_SHIF8 RecName: Full=Adenine deaminase;         Short=Adenase; 
   28::91      4e-04  33%  599 aa  ADEC_CLOB1 RecName: Full=Adenine deaminase;       
   20::78      4e-04  37%  580 aa  ADEC2_LACSS RecName: Full=Adenine deaminase 2;       
    7::69      6e-04  28%  435 aa  MTAD_BACC3 RecName:
    7::69      6e-04  28%  435 aa  MTAD_BACC0 RecName:
    7::69      6e-04  28%  435 aa  MTAD_BACAN RecName:
    7::69      6e-04  28%  435 aa  MTAD_BACAH RecName:
    7::69      6e-04  28%  435 aa  MTAD_BACAC RecName:
    7::69      6e-04  28%  435 aa  MTAD_BACAA RecName:
    2::67      6e-04  41%  457 aa  HYDA_BURPI RecName: Full=D-hydantoinase;         EC=3.5.2.-;
   24::73      6e-04  42%  401 aa  HUTI_PSESM RecName: Full=Imidazolonepropionase;       
  318::398     6e-04  35%  433 aa  HUTI_DANRE RecName: Full=Probable imidazolonepropionase;       
   28::91      6e-04  32%  599 aa  ADEC_CLOBL RecName: Full=Adenine deaminase;       
   39::88      7e-04  32%  421 aa  HUTI_STRSV RecName: Full=Imidazolonepropionase;       
   39::88      7e-04  32%  421 aa  HUTI_STRGC RecName: Full=Imidazolonepropionase;       
   41::102     7e-04  39%  424 aa  HUTI_GEOKA RecName: Full=Imidazolonepropionase;       
    8::79      7e-04  36%  405 aa  HUTI_ERWT9 RecName: Full=Imidazolonepropionase;       
    6::87      7e-04  38%  421 aa  HUTI_BACA2 RecName: Full=Imidazolonepropionase;       
    7::69      7e-04  32%  519 aa  DPYS_MOUSE RecName: Full=Dihydropyrimidinase;       
    5::69      7e-04  32%  448 aa  ALLB_DEIRA RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
   19::77      7e-04  32%  571 aa  ADEC_DEHSC RecName: Full=Adenine deaminase;       
   19::77      7e-04  32%  571 aa  ADEC_DEHSB RecName: Full=Adenine deaminase;       
   28::91      7e-04  33%  599 aa  ADEC_CLOBM RecName: Full=Adenine deaminase;       
   28::91      7e-04  33%  599 aa  ADEC_CLOB6 RecName: Full=Adenine deaminase;       
   33::94      7e-04  29%  597 aa  ADEC2_AGRT5 RecName: Full=Adenine deaminase 2;       
   22::173     0.001  26%  443 aa  PYRC_WOLTR RecName: Full=Dihydroorotase;         Short=DHOase;     
    2::69      0.001  38%  431 aa  MTAD_CLOTH RecName:
    7::69      0.001  28%  435 aa  MTAD_BACCR RecName:
    7::69      0.001  28%  435 aa  MTAD_BACC7 RecName:
    7::69      0.001  28%  435 aa  MTAD_BACC4 RecName:
    7::69      0.001  28%  435 aa  MTAD_BACC2 RecName:
    7::69      0.001  28%  435 aa  MTAD_BACC1 RecName:
  340::407     0.001  32%  408 aa  HUTI_VIBFM RecName: Full=Imidazolonepropionase;       
  340::407     0.001  32%  408 aa  HUTI_VIBF1 RecName: Full=Imidazolonepropionase;       
  349::390     0.001  40%  421 aa  HUTI_STRP6 RecName: Full=Imidazolonepropionase;       
  349::390     0.001  40%  421 aa  HUTI_STRP3 RecName: Full=Imidazolonepropionase;       
   46::73      0.001  54%  401 aa  HUTI_PSEPU RecName: Full=Imidazolonepropionase;       
   13::73      0.001  41%  402 aa  HUTI_PSEA7 RecName: Full=Imidazolonepropionase;       
    3::85      0.001  39%  423 aa  HUTI_BACCN RecName: Full=Imidazolonepropionase;       
   21::176     0.001  27%  439 aa  GUAD_ECOLI RecName: Full=Guanine deaminase;         Short=Guanase; 
    5::78      0.001  31%  445 aa  ALLB_STRCO RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
   31::105     0.001  32%  588 aa  ADEC_SHISS RecName: Full=Adenine deaminase;         Short=Adenase; 
   31::105     0.001  32%  588 aa  ADEC_SHIBS RecName: Full=Adenine deaminase;         Short=Adenase; 
   31::105     0.001  32%  588 aa  ADEC_ECOUT RecName: Full=Adenine deaminase;         Short=Adenase; 
   31::105     0.001  32%  588 aa  ADEC_ECOSE RecName: Full=Adenine deaminase;         Short=Adenase; 
   31::105     0.001  32%  588 aa  ADEC_ECOLC RecName: Full=Adenine deaminase;         Short=Adenase; 
   31::105     0.001  32%  588 aa  ADEC_ECOL6 RecName: Full=Adenine deaminase;         Short=Adenase; 
   31::105     0.001  32%  588 aa  ADEC_ECOL5 RecName: Full=Adenine deaminase;         Short=Adenase; 
   31::105     0.001  32%  588 aa  ADEC_ECOK1 RecName: Full=Adenine deaminase;         Short=Adenase; 
   31::105     0.001  32%  588 aa  ADEC_ECO8A RecName: Full=Adenine deaminase;         Short=Adenase; 
   31::105     0.001  32%  588 aa  ADEC_ECO81 RecName: Full=Adenine deaminase;         Short=Adenase; 
   31::105     0.001  32%  588 aa  ADEC_ECO7I RecName: Full=Adenine deaminase;         Short=Adenase; 
   31::105     0.001  32%  588 aa  ADEC_ECO55 RecName: Full=Adenine deaminase;         Short=Adenase; 
   31::105     0.001  32%  588 aa  ADEC_ECO45 RecName: Full=Adenine deaminase;         Short=Adenase; 
   31::105     0.001  32%  588 aa  ADEC_ECO24 RecName: Full=Adenine deaminase;         Short=Adenase; 
   21::78      0.001  29%  575 aa  ADEC_DESVH RecName: Full=Adenine deaminase;       
   25::81      0.001  32%  600 aa  ADEC4_RHIME RecName: Full=Adenine deaminase 4;       
    5::67      0.001  37%  567 aa  ADEC2_OENOB RecName: Full=Adenine deaminase 2;       
    1::566

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDIILHNGNIITLNDAQPQASALAISGSRIVAIGDDTATD
AEPA_PECCC      ---------------------------------VYENARIYTVNDRQPTASVLVVDQGKIVYVGGNDGAK
YTCJ_BACSU      ---------------------------------IWHGGFIYTMLEEGDRTEAVYVEDGVIKGTGSERLKE
ADEC1_LACSS     -------------------------------DLIIKNGQLVNVMTAEIYPAEVAIYQGKIVAVDPDVSA-
HUTI_ALKMQ      ----------------------------------------------------IAIKGDKIVAVGSGLMEE
ALLB_DESHY      -------------------------------DLILRNGNVVCPDGVRK--ADIAVSDGKIVLIAEEIP--
ALLB_ECOSE      -------------------------------DLIIKNGTVILENEAR--VVDIAVKGGKIAAIGQDL---
ALLB_ECOLU      -------------------------------DLIIKNGTVILENEAR--VVDIAVKGGKIAAIGQDL---
ALLB_ECOLI      -------------------------------DLIIKNGTVILENEAR--VVDIAVKGGKIAAIGQDL---
ALLB_ECOLC      -------------------------------DLIIKNGTVILENEAR--VVDIAVKGGKIAAIGQDL---
ALLB_ECOHS      -------------------------------DLIIKNGTVILENEAR--VVDIAVKGGKIAAIGQDL---
ALLB_ECODH      -------------------------------DLIIKNGTVILENEAR--VVDIAVKGGKIAAIGQDL---
ALLB_ECOBW      -------------------------------DLIIKNGTVILENEAR--VVDIAVKGGKIAAIGQDL---
ALLB_ECO8A      -------------------------------DLIIKNGTVILENEAR--VVDIAVKGGKIAAIGQDL---
ALLB_ECO55      -------------------------------DLIIKNGTVILENEAR--VVDIAVKGGKIAAIGQDL---
ALLB_ECO24      -------------------------------DLIIKNGTVILENEAR--VVDIAVKGGKIAAIGQDL---
ALLB_DESHD      -------------------------------DLILRNGNVVCPDGVRK--ADIAVSDGKIVLIAEEIP--
ALLB_ECOSM      -------------------------------DLIIKNGTVILENEAR--VVDVAVKGGKIAAIGQDL---
HUTI_FUSNN      ----------------------------------------------------IVIEKDKIVAVGSGEVLK
ADEC_RHISN      -------------------------------DIVLKGGRFFDLVTGELVASDIAISGDRIVGTGDYEGRE
ADEC_METBU      -------------------------------DTIFFGGLLINVNTKEMLYRDIAVKEGYIVGIGDVSSL-
ADEC1_RHIME     -------------------------------DIVLKGGRFFDLVTGELVASDIAISGERIVGTGDYEGRE
ADEC1_RHIEC     -------------------------------DIVLKGGSFFDLVTGEIVRSDIAIGADRIVGTSGD----
HUTI_KLEP7      --------------------------------VIWRNGRLATLNPAQPERHALLVRDGRIAAI---VAED
ALLB_SALTY      -------------------------------DLIIKNGTVILENEAR--VIDIAVQGGKIAAIGENL---
ALLB_SALTI      -------------------------------DLIIKNGTVILENEAR--VIDIAVQGGKIAAIGENL---
ALLB_SALPK      -------------------------------DLIIKNGTVILENEAR--VIDIAVQGGKIAAIGENL---
ALLB_SALPB      -------------------------------DLIIKNGTVILENEAR--VIDIAVQGGKIAAIGENL---
ALLB_SALPA      -------------------------------DLIIKNGTVILENEAR--VIDIAVQGGKIAAIGENL---
ALLB_SALNS      -------------------------------DLIIKNGTVILENEAR--VIDIAVQGGKIAAIGENL---
ALLB_SALHS      -------------------------------DLIIKNGTVILENEAR--VIDIAVQGGKIAAIGENL---
ALLB_SALEP      -------------------------------DLIIKNGTVILENEAR--VIDIAVQGGKIAAIGENL---
ALLB_SALDC      -------------------------------DLIIKNGTVILENEAR--VIDIAVQGGKIAAIGENL---
ALLB_SALA4      -------------------------------DLIIKNGTVILENEAR--VIDIAVQGGKIAAIGENL---
HUTI_BRASB      -------------------------------DRIWHNARLATLREGQPEQGVVAARDGRIAFAGSDFAAD
HUTI_ALKOO      ----------------------------------------------------IAVAGDRIVGIGSGEISA
ADEC1_DESPS     ---------------------------------VLEGGYLVNVMSNEVYLADVAIYEERIVAIGK---VE
HUTI_PARDP      ---------------------------------LLHHAQLVTMDEESGEQGALVIEAGRISWIGPETDLP
HUTI_VIBVY      -------------------------------DLLLTNARLVTLQSGQPSTPSIGIKAGKIHYLGIDTALA
HUTI_VIBVU      -------------------------------DLLLTNARLVTLQSGQPSTPSIGIKAGKIHYLGIDTALA
HUTI_VIBHB      -------------------------------DLLIENARLVTMQEGEQPLARVGIRSGKIVALGEDSAET
ADEC1_AGRT5     -------------------------------DMVLKGGRFFDLVTGELVASDIAICGDTVVGTCGD----
ALLB_ECOUT      -------------------------------DLIIKNGTVILENEAR--VVDIAVKDGKIAAIGQDL---
ALLB_ECOL6      -------------------------------DLIIKNGTVILENEAR--VVDIAVKDGKIAAIGQDL---
ALLB_ECOL5      -------------------------------DLIIKNGTVILENEAR--VVDIAVKDGKIAAIGQDL---
ALLB_ECOK1      -------------------------------DLIIKNGTVILENEAR--VVDIAVKDGKIAAIGQDL---
ALLB_ECO81      -------------------------------DLIIKNGTVILENEAR--VVDIAVKDGKIAAIGQDL---
ALLB_ECO45      -------------------------------DLIIKNGTVILENEAR--VVDIAVKDGKIAAIGQDL---
ALLB_ECO27      -------------------------------DLIIKNGTVILENEAR--VVDIAVKDGKIAAIGQDL---
ADEC_LISW6      -------------------------------DLVIKNGRIVNVFSGEIMEGDIAIKNGYIAGIGDFSEAE
ADEC_KOSOT      -------------------------------DLLLKNARIVNVFSGEIERANIAIFRKRIAGIGDYS---
ADEC_OCHA4      -------------------------------DIVLKGGRFFDLVTGELVESDIAICGDRIVG-----TFG
HUTI_RUBXD      --------------------------------------------------ASIAVSGDRIAAVGPEVLRD
ALLB_SALCH      -------------------------------DLIIKNGTVILENEAR--VIDIAVQGGKIAAIGENLE--
ALLB_BACLD      -------------------------------DSIIKNGLVILENGEQEVE--VGIKDGKIAAIGQDLGTS
ADEC_SILPO      -------------------------------DMIIRNGTWINVHTREAPGHSIAIAEGRIAFVGPDAS--
ADEC_DESAA      -------------------------------DLVLKNAQIVNVFSGEIQKGDVAVQGGKVAALDSR----
NDAD_ALCXX      -------------------------------DLLLAGGTLIDGSNTPGRRADLGVRGDRIAAIGDDAAA-
HUTI_SYMTH      ---------------------------------------------------ALAARDGRIVAVGDEVLRT
HUTI_KLEP3      --------------------------------VIWRNARLATLNPSQPERHALLVRNGRIEAIVADA--D
ADEC_RHOS5      -------------------------------DLVLKNGRIFDLVTGELVQTDVAICGDRIVGT---FGTY
PYRC_STRP8      --------------------------------ILIKNGRVMDPKSQRDQVADVLIDGKQIVKIASAIECQ
PYRC_STRP6      --------------------------------ILIKNGRVMDPKSQRDQVADVLIDGKQIVKIASAIECQ
PYRC_STRP3      --------------------------------ILIKNGRVMDPKSQRDQVADVLIDGKQIVKIASAIECQ
PYRC_STRP1      --------------------------------ILIKNGRVMDPKSQRDQVADVLIDGKQIVKIASAIECQ
MTAD_DESVV      -------------------------------DTILQAALIVTQDDARTEDGAIAIHEGRIAAVGQDAIVG
HUTI_ROSDO      --------------------------------MLFTNARIVTLRDDQDEEGAIATDGDQIAWVGPSAVPD
HUTI_CHLAD      ---------------------------------------------------AVAIRGSTIVAVGPGTVRR
ADEC_DEHE1      -------------------------------DLVLLNARVVNVFNAEIEPANVAVFGGQIAGVGDYTLGN
MTAD_SYMTH      ----------------------------------------------------------------------
HYDL_ARTAU      -------------------------------DVIVKNCRLVS-SDGITEADILVKDG-KVAAISADTSDV
ADEC_THEAB      -------------------------------DVLIKNVNLVNVFTGKIEKTNIALYKKRIAGIGDDYKVG
ADEC_GEOKA      -------------------------------DLVIQNGKIVNVFTREIIEGDLAIVEGMIVGIG------
ADEC_BRUSU      -------------------------------DIVLKGGRFLDLITGELVESDIAICEDRIVG-----TFG
ADEC_BRUME      -------------------------------DIVLKGGRFLDLITGELVESDIAICEDRIVG-----TFG
ADEC_BRUAB      -------------------------------DIVLKGGRFLDLITGELVESDIAICEDRIVG-----TFG
ADEC_BRUA2      -------------------------------DIVLKGGRFLDLITGELVESDIAICEDRIVG-----TFG
ADEC3_RHIME     -------------------------------DLVVRNGRWVNVYSGEIVPGAIAIVGGRFAYVGPDAG--
PYRC_CLOD6      --------------------------------ILIKNGRVIDPKSQRDENIDLIIKENKIYKIGKFDESD
PYRC_CARHZ      --------------------------------MLIKNGNVVMVEDGKIRKMDVLIDKGIIVEISPEINRS
MTAD_SYNFM      -------------------------------DLLLVNGMVLTLDPRRFDPGAVAILNGEIAAVGPERLAA
MTAD_NATPD      -------------------------------------GQVLTPELTVRTADVLADSETEILAVGDTAAGD
MTAD_DESVH      -------------------------------DTILQAALIVTQDDARTEDGAIAIHEGRIAAVGQDAIVG
ALLB_ENTFA      --------------------------------VILETGEVIT---------DVAVQGGKIVAIGQDLSGE
HYDA_RHIRD      -------------------------------DIIIKNGTIVTADGISP--ADLGIKDGKIAQIGGTF---
ADEC_BACA2      -------------------------------DTVIKNGKIMDVFNQEWISADIAITGGVIVGLG------
ADEC1_BACSK     -------------------------------DILVINGKLIDVYTLTIYEASIAITDGYIVGIGDYT---
PYRC_LACGA      ---------------------------------VIKNGTVYQ-NGRLIKADVL-IEGKKIKAIGTDL---
HUTI_PSEU2      --------------------------------------------------AAIVTSGALIEWIGPQAALA
HUTI_PSEHT      -------------------------------DLLLTDANIATMDSAVEENAALAIKNGKIMWLGEQKNLP
HUTI_PSE14      --------------------------------------------------AAIVTSGALIEWIGPETELA
HUTI_MESSB      ---------------------------------IWRNGRLATLREDLQENGAVVCEGGRILFAGPEGELP
ADEC_SILST      -------------------------------DTVIRNGKWVNVHTREVEGHDIAIKAGRIAYVGPDASY-
ADEC_CENSY      -------------------------------DLIIQNCSLVSVYTGEVEGTEIAVSGDRIAYVGPDAS--
PYRC_LACPL      ----------------------------------------------------------------------
HUTI_METNO      -------------------------------DRLWHNARLATLAESRPEDGVIAARDGRILHAGPTAEAP
HUTI_HERA2      --------------------------------------------------AVVAVQAGNIVALGSQAELS
HUTI_HAHCH      ------------------------------------NARIATLDDAQHESHALGVAHGKVEAI---VPMS
ADEC_PETMO      -------------------------------DLVFKNGKIIDVFNEKVIEEDLAISNGVIIGFGKYEGKE
ADEC_LISIN      -------------------------------DLVIKNGRIVNVFSGEIMEGDIAIKNGYIAGIGHFPDAD
ADEC_CLOD6      -------------------------------DIVLKNGTIINVFTEELITGDVAIVGDTIVGIGDYKGNV
HUTI_BACHD      --------------------------------------------------AALGIRDGKVAFIGTMVEAD
ADEC_LISMO      -------------------------------DLVIKNGRIINVFSGEIMDGDIAIKNGYIAGIGSFP---
PYRC_LACLA      --------------------------------LLIKNGRLVDPKSNRDEVLDILIENDKIVKIGLNLSVE
PYRC_BACSU      ---------------------------------LIKNGWILNENGEKTQAD-IRVTGETITAIGKLDATD
HUTI_TREDE      -------------------------------------------------AGYIVVENGLIQKVGKGDAPE
ADEC_LISMF      -------------------------------DLVIKNGRIINVFSGEIMDGDIAIKNGYIAGIGNFP---
ADEC_CLOAB      --------------------------------LVLKNCNIVNVFSSEIIRGDLAIDGDTIIGIGKYKGKT
ADEC2_BACSK     -------------------------------DTLVKNVRVYNAYTQQFIASDVAIDEGRFVAIGH---SD
HUTI_STRPD      ----------------------------------------------------------------------
ADEC_RHOSK      -------------------------------DLVLKHGRVFDLVTGELVQTDVAICGDRIVGTF------
ADEC_RHOS4      -------------------------------DLVLKHGRVFDLVTGELVQTDVAICGDRIVGTF------
ADEC_RHOS1      -------------------------------DLVLKHGRVFDLVTGELVQTDVAICGDRIVGTFGTYAG-
ADEC_BACSU      -------------------------------DIVIKNGKIMDVYNQEWIYEDIAITDGVIVGLG------
PYRC_STRT2      --------------------------------LLIKNGRVVDPKSGLDTQADVLVDGKKVVKIAENIDAG
PYRC_STRT1      --------------------------------LLIKNGRVVDPKSGLDTQADVLVDGKKVVKIAENIDAG
MTAD_METAC      -------------------------------DIIIKNAYVLTMDPGDLKNGTVVIEDGKITEIGENT---
HUTI_BURCJ      ----------------------------------------------------------------------
HUTI_BRASO      -------------------------------DRIWQNARLATLGEGRPEHGVVASRAGRIAFAGSDFAAD
ADEC_STAMF      -------------------------------DIVISNVNLVLTPTGEILDNAIIISGKRIAGAGKYSELH
ADEC_MOOTA      -------------------------------DTVIKGGKVVNVFTGEILPWDIAIKNGRIASVGDVSAAV
ADEC1_RHIL3     -------------------------------DIVLKGGCFFDLVTGELVQSDIAIGADRIVG-----TSG
PYRC_STRR6      --------------------------------LLIKNGRVMDPKSGLDQVCDVLVQDGKIIKIAPEITEE
PYRC_STRPN      --------------------------------LLIKNGRVMDPKSGLDQVCDVLVQDGKIIKIASEITEE
PYRC_LACJO      ---------------------------------VYQNGHLIKAD--------VLIDGQKIKAIGTDLEGE
PYRC_LACH4      ------------------------------------------------------IEDQKIKAIGTDLTGD
PYRC_LACDB      ------------------------------------------------------IEDQKIKAIGTDLTGD
PYRC_LACDA      ------------------------------------------------------IEDQKIKAIGTDLTGD
NDED_ALCXX      -------------------------------DLVIEGGWVIDGLGGPRRRADVGIRGERIAAIGDLSAAP
HUTI_STRPZ      ----------------------------------------------------------------------
HUTI_STRPM      ----------------------------------------------------------------------
HUTI_STRPG      ----------------------------------------------------------------------
HUTI_STRPF      ----------------------------------------------------IAIKDSLIVALGSGEPDA
HUTI_STRPC      ----------------------------------------------------------------------
HUTI_STRPB      ----------------------------------------------------------------------
HUTI_STRP8      ----------------------------------------------------------------------
HUTI_STRP1      ----------------------------------------------------------------------
HUTI_STAAW      ----------------------------------------------------VVIKDGKIVYAG--THTD
HUTI_STAAT      ----------------------------------------------------VVIKDGKIVYAG--THTD
HUTI_STAAS      ----------------------------------------------------VVIKDGKIVYAG--THTD
HUTI_STAAR      ----------------------------------------------------VVIKDGKIVYAG--THTD
HUTI_STAAE      ----------------------------------------------------VVIKDGKIVYAG--THTD
HUTI_STAAC      ----------------------------------------------------VVIKDGKIVYAG--THTD
HUTI_STAA8      ----------------------------------------------------VVIKDGKIVYAG--THTD
HUTI_STAA3      ----------------------------------------------------VVIKDGKIVYAG--THTD
HUTI_COLP3      ------------------------------------NVNLATMTDGSESQGALAISAGKIAWLGKESDLP
HUTI_BURCM      ----------------------------------------------------------------------
HUTI_BACSU      --------------------------------ILINIGQLLTMESSGPRAAVVGIHEQKIVFAGQKGAEA
HUTI_ARTAT      --------------------------------------------------AAIVIEGERIAWLGDAPAAD
ADEC_SHIFL      -------------------------------DYIIDNVSILDLINAGEISGPIVIKGRYIAGVGAEYADT
ADEC_SHIF8      -------------------------------DYIIDNVSILDLINAGEISGPIVIKGRYIAGVGAEYADT
ADEC_CLOB1      -------------------------------DMVIINSRLINVCTREVENTDVAISCGRIALVGD---AK
ADEC2_LACSS     -------------------------------DTIIKNAKIVDVYNARIIEGTLAIADSRFLGIDAAYTAD
MTAD_BACC3      ------------------------------------NATIVTMNEQNEENGYIIVENDKIIDVNSGEFAS
MTAD_BACC0      ------------------------------------NATIVTMNEQNEENGYIIVENDKIIDVNSGEFAS
MTAD_BACAN      ------------------------------------NATIVTMNEQNEENGYIIVENDKIIDVNSGEFAS
MTAD_BACAH      ------------------------------------NATIVTMNEQNEENGYIIVENDKIIDVNSGEFAS
MTAD_BACAC      ------------------------------------NATIVTMNEQNEENGYIIVENDKIIDVNSGEFAS
MTAD_BACAA      ------------------------------------NATIVTMNEQNEENGYIIVENDKIIDVNSGEFAS
HYDA_BURPI      -------------------------------DIIIKNGTIVTADGIS--RADLGIKDGKITQIGGALGPA
HUTI_PSESM      --------------------------------------------------AAIVTSGALIEWIGPQAELA
HUTI_DANRE      ----------------------------------------------------------------------
ADEC_CLOBL      -------------------------------DMVIINSRLINVCTREVENTDVAVSCGRIALVGD---AK
HUTI_STRSV      ----------------------------------------------------IAVKDGKILAVGSGEPDA
HUTI_STRGC      ----------------------------------------------------IAVKDGKILAVGSGEPDA
HUTI_GEOKA      ------------------------------------------------------IENGTIVAVGPDDELV
HUTI_ERWT9      -------------------------------DHLWFGADIVTMQNGRYEQGAIAVSGQQIIWVGPDSAHI
HUTI_BACA2      -------------------------------DTILTNGQLLTMESGGPRSAVIGISDGRIVFAGHQGAEE
DPYS_MOUSE      --------------------------------LLIRGGRIV--NDDFSQVADVLVEDGVVRALGRDLLPP
ALLB_DEIRA      ---------------------------------LLLRGAVLVTPEGERRAD-LGIVGGQIAELTDEIATP
ADEC_DEHSC      -------------------------------DLVLLNARVINVFNAEIEQANVAVFDGKIAGVGDYRHGK
ADEC_DEHSB      -------------------------------DLVLLNARVINVFNAEIEQTNVAVFDGKIAGVGDYRHGK
ADEC_CLOBM      -------------------------------DMVIINSRLINVCTREVENTDVAISCGRIALVGD---AK
ADEC_CLOB6      -------------------------------DMVIINSRLINVCTREVENTDVAISCGRIALVGD---AK
ADEC2_AGRT5     -------------------------------DVLITGGTLVDVVTGELRPADIGIVGALIASVHEPAS--
PYRC_WOLTR      ------------------------------------NARIIDPETKLDIEGSLLTEGSKIIDFGESLFSN
MTAD_CLOTH      -------------------------------NILIKNADIITCNDDVLQGAFLGIKDGYIDFIDTEDALK
MTAD_BACCR      ------------------------------------NATIVTMNEQNEENGYIIVENDQIIDVKSGEFAN
MTAD_BACC7      ------------------------------------NATIVTMNEQNEENGYIIVENDQIIDVKSGEFAN
MTAD_BACC4      ------------------------------------NATIVTMNEQNEENGYIIVENDQIIDVKSGKFAN
MTAD_BACC2      ------------------------------------NATIVTMNEQNEENGYIIVENDQIIDVKSGEFAN
MTAD_BACC1      ------------------------------------NATIVTMNEQNEENGYIIVENDQIIDVKSGEFAN
HUTI_VIBFM      ----------------------------------------------------------------------
HUTI_VIBF1      ----------------------------------------------------------------------
HUTI_STRP6      ----------------------------------------------------------------------
HUTI_STRP3      ----------------------------------------------------------------------
HUTI_PSEPU      ----------------------------------------------------------------------
HUTI_PSEA7      ----------------------------------LRNGKYSIVEDA-----VLVTDGPLIHWIGPRAELP
HUTI_BACCN      -------------------------------DILLTNGQLLTMDQEQEAMKTLPVIESGAVGIKDGVTAE
GUAD_ECOLI      -----------------------------------------TIDNPEEIASALRFDGLLLIKQGKVEWFG
ALLB_STRCO      -------------------------------ELVLRSTRVITPEGTR--AASVAVTGEKITAV---LPYD
ADEC_SHISS      -------------------------------DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAD-
ADEC_SHIBS      -------------------------------DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAD-
ADEC_ECOUT      -------------------------------DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAD-
ADEC_ECOSE      -------------------------------DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAD-
ADEC_ECOLC      -------------------------------DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAD-
ADEC_ECOL6      -------------------------------DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAD-
ADEC_ECOL5      -------------------------------DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAD-
ADEC_ECOK1      -------------------------------DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAD-
ADEC_ECO8A      -------------------------------DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAD-
ADEC_ECO81      -------------------------------DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAD-
ADEC_ECO7I      -------------------------------DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAD-
ADEC_ECO55      -------------------------------DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAD-
ADEC_ECO45      -------------------------------DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAD-
ADEC_ECO24      -------------------------------DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAD-
ADEC_DESVH      -------------------------------DLVVRNARIVDVFSQRIVEAPLAIGGGRFLGF-------
ADEC4_RHIME     -------------------------------------GRLVNVVSEEIYQADVAIYRDRIIAVGD---IS
ADEC2_OENOB     -------------------------------DLKIINGQIYNTFTRQFTAKEVAIVDGKFFQIADKLSDD


                         .         .         *         .         .         .         .:140
query           EWRGDHTRTIDLQGKTVIPGLTDTHIHAIRGGQTWTFETYWYDSPSLKDALDKLRADANRRPHDQWVAVV
AEPA_PECCC      PFKATATELVDLEGKTVLPGFIESHAHPATVAVMEAGDFVYVDARTLSQILSQLKAYLVAHPKANYLLAQ
YTCJ_BACSU      KYGSPETEEISLNGAVMFPGFVDSHLHLIGHGE----KQLQLDLSALKDSILQAAKERERQPKNDWLIGE
ADEC1_LACSS     -YQGTETRVIDAKQQYIVPGLIDGHIH-------------------------------------------
HUTI_ALKMQ      NLKGKNTMVIDGKGKTVTPGLVDPHTHLVHGG--------------------------------------
ALLB_DESHY      ---GDAKEVIDAAGKHVFPGITDGHVHFNDPGRT------------------------------------
ALLB_ECOSE      ---GDAKEVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_ECOLU      ---GDAKEVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_ECOLI      ---GDAKEVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_ECOLC      ---GDAKEVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_ECOHS      ---GDAKEVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_ECODH      ---GDAKEVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_ECOBW      ---GDAKEVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_ECO8A      ---GDAKEVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_ECO55      ---GDAKEVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_ECO24      ---GDAKEVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_DESHD      ---GDAKEIIDAAGKHIFPGITDGHVHFNDPGRT------------------------------------
ALLB_ECOSM      ---GDAKEVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
HUTI_FUSNN      EYLTPATEMVDLSGKLVTPGLIDSHTHLVHGG--------------------------------------
ADEC_RHISN      E--------IDVSGRIVVPGFIDTHLH-------------------------------------------
ADEC_METBU      --KGDETEMIDVTGKHLCPGLMDGHVH-------------------------------------------
ADEC1_RHIME     E--------IDVTGRIVVPGFIDTHLH-------------------------------------------
ADEC1_RHIEC     -YRGE--TEIDISGRTVVPGFIDTHLH-------------------------------------------
HUTI_KLEP7      DVPSG--RSIDLEGRLVTPGLIDCHTHLVFGGQEW-----------------------------------
ALLB_SALTY      ---GEAKNVLDATGLIVSPGMVDAHTHISEPGRT------------------------------------
ALLB_SALTI      ---GEAKNVLDATGLIVSPGMVDAHTHISEPGRT------------------------------------
ALLB_SALPK      ---GEAKNVLDATGLIVSPGMVDAHTHISEPGRT------------------------------------
ALLB_SALPB      ---GEAKNVLDATGLIVSPGMVDAHTHISEPGRT------------------------------------
ALLB_SALPA      ---GEAKNVLDATGLIVSPGMVDAHTHISEPGRT------------------------------------
ALLB_SALNS      ---GEAKNVLDATGLIVSPGMVDAHTHISEPGRT------------------------------------
ALLB_SALHS      ---GEAKNVLDATGLIVSPGMVDAHTHISEPGRT------------------------------------
ALLB_SALEP      ---GEAKNVLDATGLIVSPGMVDAHTHISEPGRT------------------------------------
ALLB_SALDC      ---GEAKNVLDATGLIVSPGMVDAHTHISEPGRT------------------------------------
ALLB_SALA4      ---GEAKNVLDATGLIVSPGMVDAHTHISEPGRT------------------------------------
HUTI_BRASB      ---GDAPERIDCAGRWITPGLVDCHTHLVYGG--------------------------------------
HUTI_ALKOO      DFQGENTVIISGEGKTVTPGLIDPHTHLVHAG--------------------------------------
ADEC1_DESPS     EYKGPETEVIDVTGLYLLPGLIDGHLHS------------------------------------------
HUTI_PARDP      AQYADATRR-DLGGRLVTPGLIDCHTHIVFGG--------------------------------------
HUTI_VIBVY      A-----TKQIDLKGKLVTPGLIDCHTHLVYAG--------------------------------------
HUTI_VIBVU      A-----TKQIDLKGKLVTPGLIDCHTHLVYAG--------------------------------------
HUTI_VIBHB      ELNPDHEQTIDLQSKLLLPGLIDCHTHLVYAG--------------------------------------
ADEC1_AGRT5     -YKGRHE--IDISGKIVVPGFIDTHLH-------------------------------------------
ALLB_ECOUT      ---GDAKDVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_ECOL6      ---GDAKDVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_ECOL5      ---GDAKDVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_ECOK1      ---GDAKDVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_ECO81      ---GDAKDVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_ECO45      ---GDAKDVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ALLB_ECO27      ---GDAKDVMDASGLVVSPGMVDAHTHISEPGRS------------------------------------
ADEC_LISW6      Q-------IMDAAGEFIVPGFIDAHVHVPNGVTTIVTDPHEIANVAGEKGIEFMLEDAKGAPLDMFVMLP
ADEC_KOSOT      ----EGKQVIDLHGAYVVPGLIDAHLH-------------------------------------------
ADEC_OCHA4      NYQGKHE--IDISGRIVVPGFIDTHLH-------------------------------------------
HUTI_RUBXD      HPPGPGCETVDGRGKAALPGLVDCHTHA------------------------------------------
ALLB_SALCH      ----EAKNVLDATGLIVSPGMVDAHTHISEPGRT------------------------------------
ALLB_BACLD      ------AKIIDAKGSIVSPGMIDAHVHITEPGGGYRDEWEGYDT--------------------------
ADEC_SILPO      HCSGPDTRIIEANGRYMIPGLCDGHMHIESG---------------------------------------
ADEC_DESAA      ----DAKITVDLEGRFLTPGLIDAHVH-------------------------------------------
NDAD_ALCXX      -----HTR-VDVSGLVVAPGFIDSHTH-------------------------------------------
HUTI_SYMTH      VETGPDTRVIDARGRAVIPGFVDPHTHLCFAG--------------------------------------
HUTI_KLEP3      APGG---RSIDLEGRLVTPGLIDCHTHLIFGGQEW-----------------------------------
ADEC_RHOS5      EGR----REIDCRGRILVPGFIDTHLH-------------------------------------------
PYRC_STRP8      E-----AQVIDASGLIVAPGLVDIHVHFREPGQT------------------------------------
PYRC_STRP6      E-----AQVIDASGLIVAPGLVDIHVHFREPGQT------------------------------------
PYRC_STRP3      E-----AQVIDASGLIVAPGLVDIHVHFREPGQT------------------------------------
PYRC_STRP1      E-----AQVIDASGLIVAPGLVDIHVHFREPGQT------------------------------------
MTAD_DESVV      NWHG--ATVIDMGASLIMPGLVNAHTHA------------------------------------------
HUTI_ROSDO      AYRSETTH--DLGGRLVTPALIDCHTHVVFGGNRAT----------------------------------
HUTI_CHLAD      RFRASHE--IDARGRAVCPGLVDCHTHIVYAG--------------------------------------
ADEC_DEHE1      -------RVLDLKGAYLLPGLINGHTH-------------------------------------------
MTAD_SYMTH      ----------------------------------------------------------------------
HYDL_ARTAU      E----ASRTIDAGGKFVMPGVVDEHVHII-----------------------------------------
ADEC_THEAB      K------EVIDAKGLFAIPGLIDAHVH-------------------------------------------
ADEC_GEOKA      --RYEGEKTIDAEGRYICPGLIDGHVH-------------------------------------------
ADEC_BRUSU      TYRGKHE--IDVSGRIVVPGFIDTHLH-------------------------------------------
ADEC_BRUME      TYRGKHE--IDVSGRIVVPGFIDTHLH-------------------------------------------
ADEC_BRUAB      TYRGKHE--IDVSGRIVVPGFIDTHLH-------------------------------------------
ADEC_BRUA2      TYRGKHE--IDVSGRIVVPGFIDTHLH-------------------------------------------
ADEC3_RHIME     HTIGEGTKIVDAAGRYLVPGLCDGHMHVESGLVTVT----------------------------------
PYRC_CLOD6      EYE----KIIDASGNVVAPGLVDVHVHFRDPGFTY-----------------------------------
PYRC_CARHZ      D-----VEVIDIEGKFLIPGLIDMHVHFRDPGYTHKEDIHSGSNAALAGGFTGVLMMPNTDPPPDNATVI
MTAD_SYNFM      DFRA--TRTLDVGGCVVLPGLINAHTHA------------------------------------------
MTAD_NATPD      -------RTLDAEGCLVVPGLVNTHCHA---------------------AMTLLRGYADDKPLDRWL---
MTAD_DESVH      NWHG--VTVIDMGESLIMPGLVNAHTHA------------------------------------------
ALLB_ENTFA      -------RVIDATGLVVSPGMVDAHVH-------------------------------------------
HYDA_RHIRD      ---GPAGRTIDASGRYVFPGGIDVHTHV----ETVSFNT-------------------------------
ADEC_BACA2      EYEGEEV--IDAEGQMIVPGFIDGHVH-------------------------------------------
ADEC1_BACSK     ----EGKTVIDAQGKYVCPPLIDGHVH-------------------------------------------
PYRC_LACGA      ----DAEKIIDAQGMLVSPGLVDVHVHYRDPGQTY-----------------------------------
HUTI_PSEU2      E--PEHDNCIDLDGAWVTPGLIDCHTHTVFGG--------------------------------------
HUTI_PSEHT      SFDVFATPTLSIKGQWLTPGLIDCHTHLVFAG--------------------------------------
HUTI_PSE14      E--PEHDNCIDLGGAWVTPGLIDCHTHTVFGG--------------------------------------
HUTI_MESSB      AELIENTEITDLEGRWVTPGLVDCHTHIVYGG--------------------------------------
ADEC_SILST      -CTGPETEVIDAEGRYMMPGLCDGHMHIESG---------------------------------------
ADEC_CENSY      HARGAGTVIHNAQGRYAAPGFADPHIH-------------------------------------------
PYRC_LACPL      ----------------------------------------------------------------------
HUTI_METNO      SFAA--RETIDCEGRWITPGLIDCHTHLVFGG--------------------------------------
HUTI_HERA2      AWTAD--QTIDAGGYLAIPGFVDPHTHACYAG--------------------------------------
HUTI_HAHCH      EWDGDASDNIDANGRLITPGLVDCHTHLVYGG--------------------------------------
ADEC_PETMO      E--------VDLEGKFISPGFIDAHLH-------------------------------------------
ADEC_LISIN      Q-------IIDAAGEFISPGFIDAHVHVPNGVTTIITDPHEIANVAGEKGIEFMLEDAKGAPLDMFVMLP
ADEC_CLOD6      E--------IDCSNKYISPGFIDAHMH-------------------------------------------
HUTI_BACHD      TFTAN--QMIDCQGKLVTPGLVDPHTHLIFGG--------------------------------------
ADEC_LISMO      ----DAEKIIDAAGAFIAPGFIDAHVHVPNGVTTIVTDPHEIANVAGEKGIEFMLEDAKGAPLDMFVMLP
PYRC_LACLA      -----NAEIVDARGLVVAPGLIDVHVHFREPGQT------------------------------------
PYRC_BACSU      -----NETVIDAKGLLVSPGFVDLHVH-------------------------------------------
HUTI_TREDE      SLKSQAEKIIDARGKTITAGLVDAHTHLVHGG--------------------------------------
ADEC_LISMF      ----DAEKIIDAAGAFIAPGFIDAHVHVPNGVTTIVTDPHEIANVAGEKGIEFMLEDAKGVPIDMFVMLP
ADEC_CLOAB      E--------IDLSNKYVAPGFIDSHVH-------------------------------------------
ADEC2_BACSK     ELESIQANTIDGQGQQMIPGLIDIHLH-------------------------------------------
HUTI_STRPD      ----------------------------------------------------------------------
ADEC_RHOSK      ---GTYTREIDCRGRILVPGFIDTHLH-------------------------------------------
ADEC_RHOS4      ---GTYTREIDCRGRILVPGFIDTHLH-------------------------------------------
ADEC_RHOS1      ------RREIDCRGRILVPGFIDTHLH-------------------------------------------
ADEC_BACSU      EYEGENI--IDAEGQMIVPGFIDGHVH-------------------------------------------
PYRC_STRT2      D-----AQVIDATGLVVAPGLVDIHVHFREPGQT------------------------------------
PYRC_STRT1      D-----AQVIDATGLVVAPGLVDIHVHFREPGQT------------------------------------
MTAD_METAC      --KENADTVIDAKGSVVMPGLANTHTHA------------------------------------------
HUTI_BURCJ      ----------------------------------------------------------------------
HUTI_BRASO      ---ADAPERIDCEGRWITPGLIDCHTHLVYGG--------------------------------------
ADEC_STAMF      RFIGKNTLVIDGENNYAMPGFIDPHIH-------------------------------------------
ADEC_MOOTA      ---GPETEVIDASGYYLCPGFMDGHVH-------------------------------------------
ADEC1_RHIL3     NYEGE--TEIDISGRIVVPGFIDTHLH-------------------------------------------
PYRC_STRR6      G-----AETIDATGHVVAPGLVDIHVHFREPGQT------------------------------------
PYRC_STRPN      G-----AETIDATGLVVAPGLVDIHVHFREPGQT------------------------------------
PYRC_LACJO      E-------IIDASGMIVSPGLVDVHVHYRDPGQTY-----------------------------------
PYRC_LACH4      -------KVIDATGKLVSPGLVDVHVHYRDPGQTY-----------------------------------
PYRC_LACDB      -------KVIDATGKLVSPGLVDVHVHYRDPGQTY-----------------------------------
PYRC_LACDA      -------KVIDATGKLVSPGLVDVHVHYRDPGQTY-----------------------------------
NDED_ALCXX      A-----DRRLDAGGRIVAPGFIDTHGH-------------------------------------------
HUTI_STRPZ      ----------------------------------------------------------------------
HUTI_STRPM      ----------------------------------------------------------------------
HUTI_STRPG      ----------------------------------------------------------------------
HUTI_STRPF      ELVGPQTIMRSYKGKIATPGIIDCHTHLVYGG--------------------------------------
HUTI_STRPC      ----------------------------------------------------------------------
HUTI_STRPB      ----------------------------------------------------------------------
HUTI_STRP8      ----------------------------------------------------------------------
HUTI_STRP1      ----------------------------------------------------------------------
HUTI_STAAW      DY--DATETIDASGKVVSPALVDAHTHLTFGG--------------------------------------
HUTI_STAAT      DY--DATETIDASGKVVSPALVDAHTHLTFGG--------------------------------------
HUTI_STAAS      DY--DATETIDASGKVVSPALVDAHTHLTFGG--------------------------------------
HUTI_STAAR      DY--DATETIDASGKVVSPALVDAHTHLTFGG--------------------------------------
HUTI_STAAE      DY--DATETIDASGKVVSPALVDAHTHLTFGG--------------------------------------
HUTI_STAAC      DY--DATETIDASGKVVSPALVDAHTHLTFGG--------------------------------------
HUTI_STAA8      DY--DATETIDASGKVVSPALVDAHTHLTFGG--------------------------------------
HUTI_STAA3      DY--DATETIDASGKVVSPALVDAHTHLTFGG--------------------------------------
HUTI_COLP3      EHTDEDIEVIDCKGQWLTPGLIDCHTHLVYGG--------------------------------------
HUTI_BURCM      ----------------------------------------------------------------------
HUTI_BACSU      GYEADEI--IDCSGRLVTPGLVDPHTHLVFGG--------------------------------------
HUTI_ARTAT      E-------NIDAQGRAVLPGWVDSHSHLVAGDRTAEFE--------------------------------
ADEC_SHIFL      P----ALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_SHIF8      P----ALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_CLOB1      HCIGENTEVIDAKGQYIAPGFLDGHIH-------------------------------------------
ADEC2_LACSS     N-------VINAHGQYVVPGLIDPHIH-------------------------------------------
MTAD_BACC3      DFEVDEV--IDMKGKWVLPGLVNTHTHVV-----------------------------------------
MTAD_BACC0      DFEVDEV--IDMKGKWVLPGLVNTHTHVV-----------------------------------------
MTAD_BACAN      DFEVDEV--IDMKGKWVLPGLVNTHTHVV-----------------------------------------
MTAD_BACAH      DFEVDEV--IDMKGKWVLPGLVNTHTHVV-----------------------------------------
MTAD_BACAC      DFEVDEV--IDMKGKWVLPGLVNTHTHVV-----------------------------------------
MTAD_BACAA      DFEVDEV--IDMKGKWVLPGLVNTHTHVV-----------------------------------------
HYDA_BURPI      E------RTIDAAGRYVFPGGIDVHTHV----ETVSFNT-------------------------------
HUTI_PSESM      E--PEHDNCIDLGGAWVTPGLIDCHTHTVFGG--------------------------------------
HUTI_DANRE      ----------------------------------------------------------------------
ADEC_CLOBL      HCIGENTEVIDAKGQYIAPGFLDGHIH-------------------------------------------
HUTI_STRSV      SLVGPDTKIQSYEGKIATPGLIDCHTHLVYGG--------------------------------------
HUTI_STRGC      SLIGPDTKIQSYEGKIATPGLIDCHTHLVYGG--------------------------------------
HUTI_GEOKA      RRFADRAEVIDAKGKTVTPGLIDPHTHLVYAGHEWTMRLH------------------------------
HUTI_ERWT9      QAR----QRTDLGGGIVTPGLVDCHTHLVFGG--------------------------------------
HUTI_BACA2      GYEARDI--IDCGGRLVTPGLVDPHTHLVFGG--------------------------------------
DPYS_MOUSE      EDASRGLRILDAAGKLVLPGGIDTHTH-------------------------------------------
ALLB_DEIRA      A-----AQTLDVSGLHVFPGVLDDHVHLNEPGRT------------------------------------
ADEC_DEHSC      E-------VIDLKGAYLLPGLINGHTH-------------------------------------------
ADEC_DEHSB      E-------VIDLKGAYLLPGLINGHTH-------------------------------------------
ADEC_CLOBM      HCIGESTEVIDAKGQYIAPGFLDGHIH-------------------------------------------
ADEC_CLOB6      HCIGESTEVIDAKGQYIAPGFLDGHIH-------------------------------------------
ADEC2_AGRT5     --RRDAAQVIDAGGAYVSPGLIDTHMH-------------------------------------------
PYRC_WOLTR      GVPSGVDETINCEGLVLMPGLVDIHVHFREPGQEHKETIYTGSKSAAAGGVTTVVCQPNTTP------AI
MTAD_CLOTH      DFKAD--RIIDAKGKLVMPGLVNAHTHS------------------------------------------
MTAD_BACCR      DFEVDEV--IDMKGKWVLPGLVNTHTHVV-----------------------------------------
MTAD_BACC7      DFEVDEV--IDMKGKWVLPGLVNTHTHVV-----------------------------------------
MTAD_BACC4      DFEVDEV--IDMKGKWVLPGLVNTHTHVV-----------------------------------------
MTAD_BACC2      DFEVDEV--IDMKGKWVLPGLVNTHTHVV-----------------------------------------
MTAD_BACC1      DFEVDEV--IDMKGKWVLPGLVNTHTHVV-----------------------------------------
HUTI_VIBFM      ----------------------------------------------------------------------
HUTI_VIBF1      ----------------------------------------------------------------------
HUTI_STRP6      ----------------------------------------------------------------------
HUTI_STRP3      ----------------------------------------------------------------------
HUTI_PSEPU      ----DADRTVDLGGAWITPGLIDCHTHAVFGG--------------------------------------
HUTI_PSEA7      P--GDYAERIDLGGAWLTPGLIDCHTHAVFGG--------------------------------------
HUTI_BACCN      EAKGLQAREIDCEGKVVSPGLVDPHTHLVFGG--------------------------------------
GUAD_ECOLI      EWENDTIRVRDYRGKLIVPGFVDTHIHYPQSEMVGAY------GEQLLEWLNKHTFPTERRYEDEYAREM
ALLB_STRCO      APVPAGARLEDVGDHVVLPGLVDTHVHVNDPGRT-EWEGFW-----------------------------
ADEC_SHISS      ---APALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_SHIBS      ---APALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_ECOUT      ---APALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_ECOSE      ---APALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_ECOLC      ---APALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_ECOL6      ---APALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_ECOL5      ---APALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_ECOK1      ---APALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_ECO8A      ---APALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_ECO81      ---APALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_ECO7I      ---APALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_ECO55      ---APALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_ECO45      ---APALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_ECO24      ---APALQRIDARGATAVPGFIDAHLHIESSMMTVTFET-------------------------------
ADEC_DESVH      -FEAEAHATLDAEGRYLLPGLIDGHVH-------------------------------------------
ADEC4_RHIME     EYIGPQTEIIDAADRYLTPGMIDGHLH-------------------------------------------
ADEC2_OENOB     FKFED---ILDLKGSYVIPGLIDSHMH-------------------------------------------


                         +         .         .         .         .         *         .:210
query           GSWIPAQFAENRAPTVAELSHALPDHPAYIQYLYDYALVNQRGIDVLGLNDTPPPDLAGIGVERDAKGSA
AEPA_PECCC      GFNVASGLPQGALPTAADLDTVSESVPIVV---YDSGMANSAALNVAHVDNTPDPIPGKHYFERDNKGNP
YTCJ_BACSU      G-WNENQFETPDYLTKHDLDRLFPDRPVLLKRICRHAIVNSAALQAAGISNTPDPD--GGVIVKDANGEP
ADEC1_LACSS     ----------------------------------------------------------------------
HUTI_ALKMQ      ----------------------------------------------------------------------
ALLB_DESHY      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ALLB_DESHD      ----------------------------------------------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
HUTI_FUSNN      ----------------------------------------------------------------------
ADEC_RHISN      ----------------------------------------------------------------------
ADEC_METBU      ----------------------------------------------------------------------
ADEC1_RHIME     ----------------------------------------------------------------------
ADEC1_RHIEC     ----------------------------------------------------------------------
HUTI_KLEP7      ----------------------------------------------------------------------
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
HUTI_BRASB      ----------------------------------------------------------------------
HUTI_ALKOO      ----------------------------------------------------------------------
ADEC1_DESPS     ----------------------------------------------------------------------
HUTI_PARDP      ----------------------------------------------------------------------
HUTI_VIBVY      ----------------------------------------------------------------------
HUTI_VIBVU      ----------------------------------------------------------------------
HUTI_VIBHB      ----------------------------------------------------------------------
ADEC1_AGRT5     ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
ADEC_LISW6      SS-VPATEGEHNGETL----HAKKLHPLY-----------------------------------------
ADEC_KOSOT      ----------------------------------------------------------------------
ADEC_OCHA4      ----------------------------------------------------------------------
HUTI_RUBXD      ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
ALLB_BACLD      ----------------------------------------------------------------------
ADEC_SILPO      ----------------------------------------------------------------------
ADEC_DESAA      ----------------------------------------------------------------------
NDAD_ALCXX      ----------------------------------------------------------------------
HUTI_SYMTH      ----------------------------------------------------------------------
HUTI_KLEP3      ----------------------------------------------------------------------
ADEC_RHOS5      ----------------------------------------------------------------------
PYRC_STRP8      ----------------------------------------------------------------------
PYRC_STRP6      ----------------------------------------------------------------------
PYRC_STRP3      ----------------------------------------------------------------------
PYRC_STRP1      ----------------------------------------------------------------------
MTAD_DESVV      ----------------------------------------------------------------------
HUTI_ROSDO      ----------------------------------------------------------------------
HUTI_CHLAD      ----------------------------------------------------------------------
ADEC_DEHE1      ----------------------------------------------------------------------
MTAD_SYMTH      ----------------------------------------------------------------------
HYDL_ARTAU      ----------------------------------------------------------------------
ADEC_THEAB      ----------------------------------------------------------------------
ADEC_GEOKA      ----------------------------------------------------------------------
ADEC_BRUSU      ----------------------------------------------------------------------
ADEC_BRUME      ----------------------------------------------------------------------
ADEC_BRUAB      ----------------------------------------------------------------------
ADEC_BRUA2      ----------------------------------------------------------------------
ADEC3_RHIME     ----------------------------------------------------------------------
PYRC_CLOD6      ----------------------------------------------------------------------
PYRC_CARHZ      YYW-------------------------------------------------------------------
MTAD_SYNFM      ----------------------------------------------------------------------
MTAD_NATPD      ----------------------------------------------------------------------
MTAD_DESVH      ----------------------------------------------------------------------
ALLB_ENTFA      ----------------------------------------------------------------------
HYDA_RHIRD      ----------------------------------------------------------------------
ADEC_BACA2      ----------------------------------------------------------------------
ADEC1_BACSK     ----------------------------------------------------------------------
PYRC_LACGA      ----------------------------------------------------------------------
HUTI_PSEU2      ----------------------------------------------------------------------
HUTI_PSEHT      ----------------------------------------------------------------------
HUTI_PSE14      ----------------------------------------------------------------------
HUTI_MESSB      ----------------------------------------------------------------------
ADEC_SILST      ----------------------------------------------------------------------
ADEC_CENSY      ----------------------------------------------------------------------
PYRC_LACPL      ----------------------------------------------------------------------
HUTI_METNO      ----------------------------------------------------------------------
HUTI_HERA2      ----------------------------------------------------------------------
HUTI_HAHCH      ----------------------------------------------------------------------
ADEC_PETMO      ----------------------------------------------------------------------
ADEC_LISIN      SS-VPATEGEHNGETL----HAKQLHPLY-----------------------------------------
ADEC_CLOD6      ----------------------------------------------------------------------
HUTI_BACHD      ----------------------------------------------------------------------
ADEC_LISMO      SS-VPATEGEHNGETL----HAEKLHPLY-----------------------------------------
PYRC_LACLA      ----------------------------------------------------------------------
PYRC_BACSU      ----------------------------------------------------------------------
HUTI_TREDE      ----------------------------------------------------------------------
ADEC_LISMF      SS-VPATEGEHNGETL----HAEKLHPLY-----------------------------------------
ADEC_CLOAB      ----------------------------------------------------------------------
ADEC2_BACSK     ----------------------------------------------------------------------
HUTI_STRPD      ----------------------------------------------------------------------
ADEC_RHOSK      ----------------------------------------------------------------------
ADEC_RHOS4      ----------------------------------------------------------------------
ADEC_RHOS1      ----------------------------------------------------------------------
ADEC_BACSU      ----------------------------------------------------------------------
PYRC_STRT2      ----------------------------------------------------------------------
PYRC_STRT1      ----------------------------------------------------------------------
MTAD_METAC      ----------------------------------------------------------------------
HUTI_BURCJ      ----------------------------------------------------------------------
HUTI_BRASO      ----------------------------------------------------------------------
ADEC_STAMF      ----------------------------------------------------------------------
ADEC_MOOTA      ----------------------------------------------------------------------
ADEC1_RHIL3     ----------------------------------------------------------------------
PYRC_STRR6      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_LACJO      ----------------------------------------------------------------------
PYRC_LACH4      ----------------------------------------------------------------------
PYRC_LACDB      ----------------------------------------------------------------------
PYRC_LACDA      ----------------------------------------------------------------------
NDED_ALCXX      ----------------------------------------------------------------------
HUTI_STRPZ      ----------------------------------------------------------------------
HUTI_STRPM      ----------------------------------------------------------------------
HUTI_STRPG      ----------------------------------------------------------------------
HUTI_STRPF      ----------------------------------------------------------------------
HUTI_STRPC      ----------------------------------------------------------------------
HUTI_STRPB      ----------------------------------------------------------------------
HUTI_STRP8      ----------------------------------------------------------------------
HUTI_STRP1      ----------------------------------------------------------------------
HUTI_STAAW      ----------------------------------------------------------------------
HUTI_STAAT      ----------------------------------------------------------------------
HUTI_STAAS      ----------------------------------------------------------------------
HUTI_STAAR      ----------------------------------------------------------------------
HUTI_STAAE      ----------------------------------------------------------------------
HUTI_STAAC      ----------------------------------------------------------------------
HUTI_STAA8      ----------------------------------------------------------------------
HUTI_STAA3      ----------------------------------------------------------------------
HUTI_COLP3      ----------------------------------------------------------------------
HUTI_BURCM      ----------------------------------------------------------------------
HUTI_BACSU      ----------------------------------------------------------------------
HUTI_ARTAT      ----------------------------------------------------------------------
ADEC_SHIFL      ----------------------------------------------------------------------
ADEC_SHIF8      ----------------------------------------------------------------------
ADEC_CLOB1      ----------------------------------------------------------------------
ADEC2_LACSS     ----------------------------------------------------------------------
MTAD_BACC3      ----------------------------------------------------------------------
MTAD_BACC0      ----------------------------------------------------------------------
MTAD_BACAN      ----------------------------------------------------------------------
MTAD_BACAH      ----------------------------------------------------------------------
MTAD_BACAC      ----------------------------------------------------------------------
MTAD_BACAA      ----------------------------------------------------------------------
HYDA_BURPI      ----------------------------------------------------------------------
HUTI_PSESM      ----------------------------------------------------------------------
HUTI_DANRE      ----------------------------------------------------------------------
ADEC_CLOBL      ----------------------------------------------------------------------
HUTI_STRSV      ----------------------------------------------------------------------
HUTI_STRGC      ----------------------------------------------------------------------
HUTI_GEOKA      ----------------------------------------------------------------------
HUTI_ERWT9      ----------------------------------------------------------------------
HUTI_BACA2      ----------------------------------------------------------------------
DPYS_MOUSE      ----------------------------------------------------------------------
ALLB_DEIRA      ----------------------------------------------------------------------
ADEC_DEHSC      ----------------------------------------------------------------------
ADEC_DEHSB      ----------------------------------------------------------------------
ADEC_CLOBM      ----------------------------------------------------------------------
ADEC_CLOB6      ----------------------------------------------------------------------
ADEC2_AGRT5     ----------------------------------------------------------------------
PYRC_WOLTR      DSVILAKYLKYRA---LETSHVNIEFYAKIEKLTEVALLKEAG--AVGFTDDGIP---------------
MTAD_CLOTH      ----------------------------------------------------------------------
MTAD_BACCR      ----------------------------------------------------------------------
MTAD_BACC7      ----------------------------------------------------------------------
MTAD_BACC4      ----------------------------------------------------------------------
MTAD_BACC2      ----------------------------------------------------------------------
MTAD_BACC1      ----------------------------------------------------------------------
HUTI_VIBFM      ----------------------------------------------------------------------
HUTI_VIBF1      ----------------------------------------------------------------------
HUTI_STRP6      ----------------------------------------------------------------------
HUTI_STRP3      ----------------------------------------------------------------------
HUTI_PSEPU      ----------------------------------------------------------------------
HUTI_PSEA7      ----------------------------------------------------------------------
HUTI_BACCN      ----------------------------------------------------------------------
GUAD_ECOLI      SAFFIKQLLRNGTTTALVFGTV---HPQSVDALFEAASINMRMIAGKVMMDRNAPD--------------
ALLB_STRCO      ----------------------------------------------------------------------
ADEC_SHISS      ----------------------------------------------------------------------
ADEC_SHIBS      ----------------------------------------------------------------------
ADEC_ECOUT      ----------------------------------------------------------------------
ADEC_ECOSE      ----------------------------------------------------------------------
ADEC_ECOLC      ----------------------------------------------------------------------
ADEC_ECOL6      ----------------------------------------------------------------------
ADEC_ECOL5      ----------------------------------------------------------------------
ADEC_ECOK1      ----------------------------------------------------------------------
ADEC_ECO8A      ----------------------------------------------------------------------
ADEC_ECO81      ----------------------------------------------------------------------
ADEC_ECO7I      ----------------------------------------------------------------------
ADEC_ECO55      ----------------------------------------------------------------------
ADEC_ECO45      ----------------------------------------------------------------------
ADEC_ECO24      ----------------------------------------------------------------------
ADEC_DESVH      ----------------------------------------------------------------------
ADEC4_RHIME     ----------------------------------------------------------------------
ADEC2_OENOB     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TGKLFGDIAAFNQLFASISSNADREGGLRQFFADMNARGVTGIIDPSAGPAAAYEPLFAMRNQGDLPLRV
AEPA_PECCC      TG-FMHESAMHNQQFNAVENVAEK---LQPILKTYHSLGFTAITDVGDTFSTTVAAIARLNEQG--KLKV
YTCJ_BACSU      TGLLF-----------------------------------------------------------------
ADEC1_LACSS     ----------------------------------------------------------------------
HUTI_ALKMQ      ----------------------------------------------------------------------
ALLB_DESHY      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ALLB_DESHD      ----------------------------------------------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
HUTI_FUSNN      ----------------------------------------------------------------------
ADEC_RHISN      ----------------------------------------------------------------------
ADEC_METBU      ----------------------------------------------------------------------
ADEC1_RHIME     ----------------------------------------------------------------------
ADEC1_RHIEC     ----------------------------------------------------------------------
HUTI_KLEP7      ----------------------------------------------------------------------
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
HUTI_BRASB      ----------------------------------------------------------------------
HUTI_ALKOO      ----------------------------------------------------------------------
ADEC1_DESPS     ----------------------------------------------------------------------
HUTI_PARDP      ----------------------------------------------------------------------
HUTI_VIBVY      ----------------------------------------------------------------------
HUTI_VIBVU      ----------------------------------------------------------------------
HUTI_VIBHB      ----------------------------------------------------------------------
ADEC1_AGRT5     ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
ADEC_LISW6      ----------------------------------------------------------------------
ADEC_KOSOT      ----------------------------------------------------------------------
ADEC_OCHA4      ----------------------------------------------------------------------
HUTI_RUBXD      ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
ALLB_BACLD      ----------------------------------------------------------------------
ADEC_SILPO      ----------------------------------------------------------------------
ADEC_DESAA      ----------------------------------------------------------------------
NDAD_ALCXX      ----------------------------------------------------------------------
HUTI_SYMTH      ----------------------------------------------------------------------
HUTI_KLEP3      ----------------------------------------------------------------------
ADEC_RHOS5      ----------------------------------------------------------------------
PYRC_STRP8      ----------------------------------------------------------------------
PYRC_STRP6      ----------------------------------------------------------------------
PYRC_STRP3      ----------------------------------------------------------------------
PYRC_STRP1      ----------------------------------------------------------------------
MTAD_DESVV      ----------------------------------------------------------------------
HUTI_ROSDO      ----------------------------------------------------------------------
HUTI_CHLAD      ----------------------------------------------------------------------
ADEC_DEHE1      ----------------------------------------------------------------------
MTAD_SYMTH      ----------------------------------------------------------------------
HYDL_ARTAU      ----------------------------------------------------------------------
ADEC_THEAB      ----------------------------------------------------------------------
ADEC_GEOKA      ----------------------------------------------------------------------
ADEC_BRUSU      ----------------------------------------------------------------------
ADEC_BRUME      ----------------------------------------------------------------------
ADEC_BRUAB      ----------------------------------------------------------------------
ADEC_BRUA2      ----------------------------------------------------------------------
ADEC3_RHIME     ----------------------------------------------------------------------
PYRC_CLOD6      ----------------------------------------------------------------------
PYRC_CARHZ      ----------------------------------------------------------------------
MTAD_SYNFM      ----------------------------------------------------------------------
MTAD_NATPD      ----------------------------------------------------------------------
MTAD_DESVH      ----------------------------------------------------------------------
ALLB_ENTFA      ----------------------------------------------------------------------
HYDA_RHIRD      ----------------------------------------------------------------------
ADEC_BACA2      ----------------------------------------------------------------------
ADEC1_BACSK     ----------------------------------------------------------------------
PYRC_LACGA      ----------------------------------------------------------------------
HUTI_PSEU2      ----------------------------------------------------------------------
HUTI_PSEHT      ----------------------------------------------------------------------
HUTI_PSE14      ----------------------------------------------------------------------
HUTI_MESSB      ----------------------------------------------------------------------
ADEC_SILST      ----------------------------------------------------------------------
ADEC_CENSY      ----------------------------------------------------------------------
PYRC_LACPL      ----------------------------------------------------------------DTPERV
HUTI_METNO      ----------------------------------------------------------------------
HUTI_HERA2      ----------------------------------------------------------------------
HUTI_HAHCH      ----------------------------------------------------------------------
ADEC_PETMO      ----------------------------------------------------------------------
ADEC_LISIN      ----------------------------------------------------------------------
ADEC_CLOD6      ----------------------------------------------------------------------
HUTI_BACHD      ----------------------------------------------------------------------
ADEC_LISMO      ----------------------------------------------------------------------
PYRC_LACLA      ----------------------------------------------------------------------
PYRC_BACSU      ----------------------------------------------------------------------
HUTI_TREDE      ----------------------------------------------------------------------
ADEC_LISMF      ----------------------------------------------------------------------
ADEC_CLOAB      ----------------------------------------------------------------------
ADEC2_BACSK     ----------------------------------------------------------------------
HUTI_STRPD      ----------------------------------------------------------------------
ADEC_RHOSK      ----------------------------------------------------------------------
ADEC_RHOS4      ----------------------------------------------------------------------
ADEC_RHOS1      ----------------------------------------------------------------------
ADEC_BACSU      ----------------------------------------------------------------------
PYRC_STRT2      ----------------------------------------------------------------------
PYRC_STRT1      ----------------------------------------------------------------------
MTAD_METAC      ----------------------------------------------------------------------
HUTI_BURCJ      ----------------------------------------------------------------------
HUTI_BRASO      ----------------------------------------------------------------------
ADEC_STAMF      ----------------------------------------------------------------------
ADEC_MOOTA      ----------------------------------------------------------------------
ADEC1_RHIL3     ----------------------------------------------------------------------
PYRC_STRR6      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_LACJO      ----------------------------------------------------------------------
PYRC_LACH4      ----------------------------------------------------------------------
PYRC_LACDB      ----------------------------------------------------------------------
PYRC_LACDA      ----------------------------------------------------------------------
NDED_ALCXX      ----------------------------------------------------------------------
HUTI_STRPZ      ----------------------------------------------------------------------
HUTI_STRPM      ----------------------------------------------------------------------
HUTI_STRPG      ----------------------------------------------------------------------
HUTI_STRPF      ----------------------------------------------------------------------
HUTI_STRPC      ----------------------------------------------------------------------
HUTI_STRPB      ----------------------------------------------------------------------
HUTI_STRP8      ----------------------------------------------------------------------
HUTI_STRP1      ----------------------------------------------------------------------
HUTI_STAAW      ----------------------------------------------------------------------
HUTI_STAAT      ----------------------------------------------------------------------
HUTI_STAAS      ----------------------------------------------------------------------
HUTI_STAAR      ----------------------------------------------------------------------
HUTI_STAAE      ----------------------------------------------------------------------
HUTI_STAAC      ----------------------------------------------------------------------
HUTI_STAA8      ----------------------------------------------------------------------
HUTI_STAA3      ----------------------------------------------------------------------
HUTI_COLP3      ----------------------------------------------------------------------
HUTI_BURCM      ----------------------------------------------------------------------
HUTI_BACSU      ----------------------------------------------------------------------
HUTI_ARTAT      ----------------------------------------------------------------------
ADEC_SHIFL      ----------------------------------------------------------------------
ADEC_SHIF8      ----------------------------------------------------------------------
ADEC_CLOB1      ----------------------------------------------------------------------
ADEC2_LACSS     ----------------------------------------------------------------------
MTAD_BACC3      ----------------------------------------------------------------------
MTAD_BACC0      ----------------------------------------------------------------------
MTAD_BACAN      ----------------------------------------------------------------------
MTAD_BACAH      ----------------------------------------------------------------------
MTAD_BACAC      ----------------------------------------------------------------------
MTAD_BACAA      ----------------------------------------------------------------------
HYDA_BURPI      ----------------------------------------------------------------------
HUTI_PSESM      ----------------------------------------------------------------------
HUTI_DANRE      ----------------------------------------------------------------------
ADEC_CLOBL      ----------------------------------------------------------------------
HUTI_STRSV      ----------------------------------------------------------------------
HUTI_STRGC      ----------------------------------------------------------------------
HUTI_GEOKA      ----------------------------------------------------------------------
HUTI_ERWT9      ----------------------------------------------------------------------
HUTI_BACA2      ----------------------------------------------------------------------
DPYS_MOUSE      ----------------------------------------------------------------------
ALLB_DEIRA      ----------------------------------------------------------------------
ADEC_DEHSC      ----------------------------------------------------------------------
ADEC_DEHSB      ----------------------------------------------------------------------
ADEC_CLOBM      ----------------------------------------------------------------------
ADEC_CLOB6      ----------------------------------------------------------------------
ADEC2_AGRT5     ----------------------------------------------------------------------
PYRC_WOLTR      ----------------------------------------------------------------------
MTAD_CLOTH      ----------------------------------------------------------------------
MTAD_BACCR      ----------------------------------------------------------------------
MTAD_BACC7      ----------------------------------------------------------------------
MTAD_BACC4      ----------------------------------------------------------------------
MTAD_BACC2      ----------------------------------------------------------------------
MTAD_BACC1      ----------------------------------------------------------------------
HUTI_VIBFM      ----------------------------------------------------------------------
HUTI_VIBF1      ----------------------------------------------------------------------
HUTI_STRP6      ----------------------------------------------------------------------
HUTI_STRP3      ----------------------------------------------------------------------
HUTI_PSEPU      ----------------------------------------------------------------------
HUTI_PSEA7      ----------------------------------------------------------------------
HUTI_BACCN      ----------------------------------------------------------------------
GUAD_ECOLI      ----------------------------------------------------------------------
ALLB_STRCO      ----------------------------------------------------------------------
ADEC_SHISS      ----------------------------------------------------------------------
ADEC_SHIBS      ----------------------------------------------------------------------
ADEC_ECOUT      ----------------------------------------------------------------------
ADEC_ECOSE      ----------------------------------------------------------------------
ADEC_ECOLC      ----------------------------------------------------------------------
ADEC_ECOL6      ----------------------------------------------------------------------
ADEC_ECOL5      ----------------------------------------------------------------------
ADEC_ECOK1      ----------------------------------------------------------------------
ADEC_ECO8A      ----------------------------------------------------------------------
ADEC_ECO81      ----------------------------------------------------------------------
ADEC_ECO7I      ----------------------------------------------------------------------
ADEC_ECO55      ----------------------------------------------------------------------
ADEC_ECO45      ----------------------------------------------------------------------
ADEC_ECO24      ----------------------------------------------------------------------
ADEC_DESVH      ----------------------------------------------------------------------
ADEC4_RHIME     ----------------------------------------------------------------------
ADEC2_OENOB     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GYRIPVQPEAKGHEAQWFSNLMAFRPARADDGQLAFLGLGESLVAGMNDGVRMAPGFSSSDQDKTALRQV
AEPA_PECCC      YYQRGYFYDAAKSTEQNIASLKGLR-EKYHQGNLS-INLYKLFMDGMDSGAMYQPYPNGNVVEQKQINDN
YTCJ_BACSU      --------------------------------------------------------------DDETLGRL
ADEC1_LACSS     ----------------------------------------------------------------------
HUTI_ALKMQ      ----------------------------------------------------------------------
ALLB_DESHY      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ALLB_DESHD      ----------------------------------------------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
HUTI_FUSNN      ----------------------------------------------------------------------
ADEC_RHISN      ----------------------------------------------------------------------
ADEC_METBU      ----------------------------------------------------------------------
ADEC1_RHIME     ----------------------------------------------------------------------
ADEC1_RHIEC     ----------------------------------------------------------------------
HUTI_KLEP7      ----------------------------------------------------------------------
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
HUTI_BRASB      ----------------------------------------------------------------------
HUTI_ALKOO      ----------------------------------------------------------------------
ADEC1_DESPS     ----------------------------------------------------------------------
HUTI_PARDP      ----------------------------------------------------------------------
HUTI_VIBVY      ----------------------------------------------------------------------
HUTI_VIBVU      ----------------------------------------------------------------------
HUTI_VIBHB      ----------------------------------------------------------------------
ADEC1_AGRT5     ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
ADEC_LISW6      ----------------------------------------------------------------------
ADEC_KOSOT      ----------------------------------------------------------------------
ADEC_OCHA4      ----------------------------------------------------------------------
HUTI_RUBXD      ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
ALLB_BACLD      ----------------------------------------------------------------------
ADEC_SILPO      ----------------------------------------------------------------------
ADEC_DESAA      ----------------------------------------------------------------------
NDAD_ALCXX      ----------------------------------------------------------------------
HUTI_SYMTH      ----------------------------------------------------------------------
HUTI_KLEP3      ----------------------------------------------------------------------
ADEC_RHOS5      ----------------------------------------------------------------------
PYRC_STRP8      ----------------------------------------------------------------------
PYRC_STRP6      ----------------------------------------------------------------------
PYRC_STRP3      ----------------------------------------------------------------------
PYRC_STRP1      ----------------------------------------------------------------------
MTAD_DESVV      ----------------------------------------------------------------------
HUTI_ROSDO      ----------------------------------------------------------------------
HUTI_CHLAD      ----------------------------------------------------------------------
ADEC_DEHE1      ----------------------------------------------------------------------
MTAD_SYMTH      ----------------------------------------------------------------------
HYDL_ARTAU      ----------------------------------------------------------------------
ADEC_THEAB      ----------------------------------------------------------------------
ADEC_GEOKA      ----------------------------------------------------------------------
ADEC_BRUSU      ----------------------------------------------------------------------
ADEC_BRUME      ----------------------------------------------------------------------
ADEC_BRUAB      ----------------------------------------------------------------------
ADEC_BRUA2      ----------------------------------------------------------------------
ADEC3_RHIME     ----------------------------------------------------------------------
PYRC_CLOD6      ----------------------------------------------------------------------
PYRC_CARHZ      ----------------------------------------------------------------------
MTAD_SYNFM      ----------------------------------------------------------------------
MTAD_NATPD      ----------------------------------------------------------------------
MTAD_DESVH      ----------------------------------------------------------------------
ALLB_ENTFA      ----------------------------------------------------------------------
HYDA_RHIRD      ----------------------------------------------------------------------
ADEC_BACA2      ----------------------------------------------------------------------
ADEC1_BACSK     ----------------------------------------------------------------------
PYRC_LACGA      ----------------------------------------------------------------------
HUTI_PSEU2      ----------------------------------------------------------------------
HUTI_PSEHT      ----------------------------------------------------------------------
HUTI_PSE14      ----------------------------------------------------------------------
HUTI_MESSB      ----------------------------------------------------------------------
ADEC_SILST      ----------------------------------------------------------------------
ADEC_CENSY      ----------------------------------------------------------------------
PYRC_LACPL      ATMVARQQEAHVHVAQYAS----ITTGRTSEQLVDFAGIGAFAVSNDGSGVQTAGTMFAAMQG-------
HUTI_METNO      ----------------------------------------------------------------------
HUTI_HERA2      ----------------------------------------------------------------------
HUTI_HAHCH      ----------------------------------------------------------------------
ADEC_PETMO      ----------------------------------------------------------------------
ADEC_LISIN      ----------------------------------------------------------------------
ADEC_CLOD6      ----------------------------------------------------------------------
HUTI_BACHD      ----------------------------------------------------------------------
ADEC_LISMO      ----------------------------------------------------------------------
PYRC_LACLA      ----------------------------------------------------------------------
PYRC_BACSU      ----------------------------------------------------------------------
HUTI_TREDE      ----------------------------------------------------------------------
ADEC_LISMF      ----------------------------------------------------------------------
ADEC_CLOAB      ----------------------------------------------------------------------
ADEC2_BACSK     ----------------------------------------------------------------------
HUTI_STRPD      ----------------------------------------------------------------------
ADEC_RHOSK      ----------------------------------------------------------------------
ADEC_RHOS4      ----------------------------------------------------------------------
ADEC_RHOS1      ----------------------------------------------------------------------
ADEC_BACSU      ----------------------------------------------------------------------
PYRC_STRT2      ----------------------------------------------------------------------
PYRC_STRT1      ----------------------------------------------------------------------
MTAD_METAC      ----------------------------------------------------------------------
HUTI_BURCJ      -------------------------------------------------------GFSLAQTER-----V
HUTI_BRASO      ----------------------------------------------------------------------
ADEC_STAMF      ----------------------------------------------------------------------
ADEC_MOOTA      ----------------------------------------------------------------------
ADEC1_RHIL3     ----------------------------------------------------------------------
PYRC_STRR6      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_LACJO      ----------------------------------------------------------------------
PYRC_LACH4      ----------------------------------------------------------------------
PYRC_LACDB      ----------------------------------------------------------------------
PYRC_LACDA      ----------------------------------------------------------------------
NDED_ALCXX      ----------------------------------------------------------------------
HUTI_STRPZ      ----------------------------------------------------------------------
HUTI_STRPM      ----------------------------------------------------------------------
HUTI_STRPG      ----------------------------------------------------------------------
HUTI_STRPF      ----------------------------------------------------------------------
HUTI_STRPC      ----------------------------------------------------------------------
HUTI_STRPB      ----------------------------------------------------------------------
HUTI_STRP8      ----------------------------------------------------------------------
HUTI_STRP1      ----------------------------------------------------------------------
HUTI_STAAW      ----------------------------------------------------------------------
HUTI_STAAT      ----------------------------------------------------------------------
HUTI_STAAS      ----------------------------------------------------------------------
HUTI_STAAR      ----------------------------------------------------------------------
HUTI_STAAE      ----------------------------------------------------------------------
HUTI_STAAC      ----------------------------------------------------------------------
HUTI_STAA8      ----------------------------------------------------------------------
HUTI_STAA3      ----------------------------------------------------------------------
HUTI_COLP3      ----------------------------------------------------------------------
HUTI_BURCM      -------------------------------------------------------GFSLAQTER-----V
HUTI_BACSU      ----------------------------------------------------------------------
HUTI_ARTAT      ----------------------------------------------------------------------
ADEC_SHIFL      ----------------------------------------------------------------------
ADEC_SHIF8      ----------------------------------------------------------------------
ADEC_CLOB1      ----------------------------------------------------------------------
ADEC2_LACSS     ----------------------------------------------------------------------
MTAD_BACC3      ----------------------------------------------------------------------
MTAD_BACC0      ----------------------------------------------------------------------
MTAD_BACAN      ----------------------------------------------------------------------
MTAD_BACAH      ----------------------------------------------------------------------
MTAD_BACAC      ----------------------------------------------------------------------
MTAD_BACAA      ----------------------------------------------------------------------
HYDA_BURPI      ----------------------------------------------------------------------
HUTI_PSESM      ----------------------------------------------------------------------
HUTI_DANRE      ----------------------------------------------------------------------
ADEC_CLOBL      ----------------------------------------------------------------------
HUTI_STRSV      ----------------------------------------------------------------------
HUTI_STRGC      ----------------------------------------------------------------------
HUTI_GEOKA      ----------------------------------------------------------------------
HUTI_ERWT9      ----------------------------------------------------------------------
HUTI_BACA2      ----------------------------------------------------------------------
DPYS_MOUSE      ----------------------------------------------------------------------
ALLB_DEIRA      ----------------------------------------------------------------------
ADEC_DEHSC      ----------------------------------------------------------------------
ADEC_DEHSB      ----------------------------------------------------------------------
ADEC_CLOBM      ----------------------------------------------------------------------
ADEC_CLOB6      ----------------------------------------------------------------------
ADEC2_AGRT5     ----------------------------------------------------------------------
PYRC_WOLTR      ----------------------------------------------------------------------
MTAD_CLOTH      ----------------------------------------------------------------------
MTAD_BACCR      ----------------------------------------------------------------------
MTAD_BACC7      ----------------------------------------------------------------------
MTAD_BACC4      ----------------------------------------------------------------------
MTAD_BACC2      ----------------------------------------------------------------------
MTAD_BACC1      ----------------------------------------------------------------------
HUTI_VIBFM      ----------------------------------------------------------------------
HUTI_VIBF1      ----------------------------------------------------------------------
HUTI_STRP6      ----------------------------------------------------------------------
HUTI_STRP3      ----------------------------------------------------------------------
HUTI_PSEPU      ----------------------------------------------------------------------
HUTI_PSEA7      ----------------------------------------------------------------------
HUTI_BACCN      ----------------------------------------------------------------------
GUAD_ECOLI      ----------------------------------------------------------------------
ALLB_STRCO      ----------------------------------------------------------------------
ADEC_SHISS      ----------------------------------------------------------------------
ADEC_SHIBS      ----------------------------------------------------------------------
ADEC_ECOUT      ----------------------------------------------------------------------
ADEC_ECOSE      ----------------------------------------------------------------------
ADEC_ECOLC      ----------------------------------------------------------------------
ADEC_ECOL6      ----------------------------------------------------------------------
ADEC_ECOL5      ----------------------------------------------------------------------
ADEC_ECOK1      ----------------------------------------------------------------------
ADEC_ECO8A      ----------------------------------------------------------------------
ADEC_ECO81      ----------------------------------------------------------------------
ADEC_ECO7I      ----------------------------------------------------------------------
ADEC_ECO55      ----------------------------------------------------------------------
ADEC_ECO45      ----------------------------------------------------------------------
ADEC_ECO24      ----------------------------------------------------------------------
ADEC_DESVH      ----------------------------------------------------------------------
ADEC4_RHIME     ----------------------------------------------------------------------
ADEC2_OENOB     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ATFAAKRGIPLEIHAYTDDSADAILTIFEQVAQQYDLRPLRWSIAHLNTGSPQTLERMRKLGLAYTVQMG
AEPA_PECCC      VAAALKAGFSVHVHAIGDKAQQSILDAF---AANKKINPLARVIAHNQVFEPQGVQK-------------
YTCJ_BACSU      IRKAREKGMEVAVHAIGDLAFEKVLNAIEKHPPKNGRHD---RLIHAQVLDNELIERAARMPIALDLQ--
ADEC1_LACSS     ----------------------------------------------------------------------
HUTI_ALKMQ      ----------------------------------------------------------------------
ALLB_DESHY      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ALLB_DESHD      ----------------------------------------------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
HUTI_FUSNN      ----------------------------------------------------------------------
ADEC_RHISN      ----------------------------------------------------------------------
ADEC_METBU      ----------------------------------------------------------------------
ADEC1_RHIME     ----------------------------------------------------------------------
ADEC1_RHIEC     ----------------------------------------------------------------------
HUTI_KLEP7      ----------------------------------------------------------------------
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
HUTI_BRASB      ----------------------------------------------------------------------
HUTI_ALKOO      ----------------------------------------------------------------------
ADEC1_DESPS     ----------------------------------------------------------------------
HUTI_PARDP      ----------------------------------------------------------------------
HUTI_VIBVY      ----------------------------------------------------------------------
HUTI_VIBVU      ----------------------------------------------------------------------
HUTI_VIBHB      ----------------------------------------------------------------------
ADEC1_AGRT5     ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
ADEC_LISW6      ----------------------------------------------------------------------
ADEC_KOSOT      ----------------------------------------------------------------------
ADEC_OCHA4      ----------------------------------------------------------------------
HUTI_RUBXD      ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
ALLB_BACLD      ----------------------------------------------------------------------
ADEC_SILPO      ----------------------------------------------------------------------
ADEC_DESAA      ----------------------------------------------------------------------
NDAD_ALCXX      ----------------------------------------------------------------------
HUTI_SYMTH      ----------------------------------------------------------------------
HUTI_KLEP3      ----------------------------------------------------------------------
ADEC_RHOS5      ----------------------------------------------------------------------
PYRC_STRP8      ----------------------------------------------------------------------
PYRC_STRP6      ----------------------------------------------------------------------
PYRC_STRP3      ----------------------------------------------------------------------
PYRC_STRP1      ----------------------------------------------------------------------
MTAD_DESVV      ----------------------------------------------------------------------
HUTI_ROSDO      ----------------------------------------------------------------------
HUTI_CHLAD      ----------------------------------------------------------------------
ADEC_DEHE1      ----------------------------------------------------------------------
MTAD_SYMTH      ----------------------------------------------------------------------
HYDL_ARTAU      ----------------------------------------------------------------------
ADEC_THEAB      ----------------------------------------------------------------------
ADEC_GEOKA      ----------------------------------------------------------------------
ADEC_BRUSU      ----------------------------------------------------------------------
ADEC_BRUME      ----------------------------------------------------------------------
ADEC_BRUAB      ----------------------------------------------------------------------
ADEC_BRUA2      ----------------------------------------------------------------------
ADEC3_RHIME     ----------------------------------------------------------------------
PYRC_CLOD6      ----------------------------------------------------------------------
PYRC_CARHZ      ----------------------------------------------------------------------
MTAD_SYNFM      ----------------------------------------------------------------------
MTAD_NATPD      ----------------------------------------------------------------------
MTAD_DESVH      ----------------------------------------------------------------------
ALLB_ENTFA      ----------------------------------------------------------------------
HYDA_RHIRD      ----------------------------------------------------------------------
ADEC_BACA2      ----------------------------------------------------------------------
ADEC1_BACSK     ----------------------------------------------------------------------
PYRC_LACGA      ----------------------------------------------------------------------
HUTI_PSEU2      ----------------------------------------------------------------------
HUTI_PSEHT      ----------------------------------------------------------------------
HUTI_PSE14      ----------------------------------------------------------------------
HUTI_MESSB      ----------------------------------------------------------------------
ADEC_SILST      ----------------------------------------------------------------------
ADEC_CENSY      ----------------------------------------------------------------------
PYRC_LACPL      ---AAKVGLPLAAHV-EDDSADRLVSEAAQVARDVMLAEVHYHVCHVSTASLRVIRNAKAAGINVTCEVS
HUTI_METNO      ----------------------------------------------------------------------
HUTI_HERA2      ----------------------------------------------------------------------
HUTI_HAHCH      ----------------------------------------------------------------------
ADEC_PETMO      ----------------------------------------------------------------------
ADEC_LISIN      ----------------------------------------------------------------------
ADEC_CLOD6      ----------------------------------------------------------------------
HUTI_BACHD      ----------------------------------------------------------------------
ADEC_LISMO      ----------------------------------------------------------------------
PYRC_LACLA      ----------------------------------------------------------------------
PYRC_BACSU      ----------------------------------------------------------------------
HUTI_TREDE      ----------------------------------------------------------------------
ADEC_LISMF      ----------------------------------------------------------------------
ADEC_CLOAB      ----------------------------------------------------------------------
ADEC2_BACSK     ----------------------------------------------------------------------
HUTI_STRPD      ----------------------------------------------------------------------
ADEC_RHOSK      ----------------------------------------------------------------------
ADEC_RHOS4      ----------------------------------------------------------------------
ADEC_RHOS1      ----------------------------------------------------------------------
ADEC_BACSU      ----------------------------------------------------------------------
PYRC_STRT2      ----------------------------------------------------------------------
PYRC_STRT1      ----------------------------------------------------------------------
MTAD_METAC      ----------------------------------------------------------------------
HUTI_BURCJ      FEAATRRGLPVKLHAEQLSNAGG-----TALAARY--RAL--SADHLEFLDEAGIEAMKAAGTVAVLLPG
HUTI_BRASO      ----------------------------------------------------------------------
ADEC_STAMF      ----------------------------------------------------------------------
ADEC_MOOTA      ----------------------------------------------------------------------
ADEC1_RHIL3     ----------------------------------------------------------------------
PYRC_STRR6      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_LACJO      ----------------------------------------------------------------------
PYRC_LACH4      ----------------------------------------------------------------------
PYRC_LACDB      ----------------------------------------------------------------------
PYRC_LACDA      ----------------------------------------------------------------------
NDED_ALCXX      ----------------------------------------------------------------------
HUTI_STRPZ      ----------------------------------------------------------------------
HUTI_STRPM      ----------------------------------------------------------------------
HUTI_STRPG      ----------------------------------------------------------------------
HUTI_STRPF      ----------------------------------------------------------------------
HUTI_STRPC      ----------------------------------------------------------------------
HUTI_STRPB      ----------------------------------------------------------------------
HUTI_STRP8      ----------------------------------------------------------------------
HUTI_STRP1      ----------------------------------------------------------------------
HUTI_STAAW      ----------------------------------------------------------------------
HUTI_STAAT      ----------------------------------------------------------------------
HUTI_STAAS      ----------------------------------------------------------------------
HUTI_STAAR      ----------------------------------------------------------------------
HUTI_STAAE      ----------------------------------------------------------------------
HUTI_STAAC      ----------------------------------------------------------------------
HUTI_STAA8      ----------------------------------------------------------------------
HUTI_STAA3      ----------------------------------------------------------------------
HUTI_COLP3      ----------------------------------------------------------------------
HUTI_BURCM      FEAATRRGLPVKLHAEQLSNAGG-----TALAARY--RAL--SADHLEFLDEAGIEAMKAAGTVAVLLPG
HUTI_BACSU      ----------------------------------------------------------------------
HUTI_ARTAT      ----------------------------------------------------------------------
ADEC_SHIFL      ----------------------------------------------------------------------
ADEC_SHIF8      ----------------------------------------------------------------------
ADEC_CLOB1      ----------------------------------------------------------------------
ADEC2_LACSS     ----------------------------------------------------------------------
MTAD_BACC3      ----------------------------------------------------------------------
MTAD_BACC0      ----------------------------------------------------------------------
MTAD_BACAN      ----------------------------------------------------------------------
MTAD_BACAH      ----------------------------------------------------------------------
MTAD_BACAC      ----------------------------------------------------------------------
MTAD_BACAA      ----------------------------------------------------------------------
HYDA_BURPI      ----------------------------------------------------------------------
HUTI_PSESM      ----------------------------------------------------------------------
HUTI_DANRE      ----------------------------------------------------------------------
ADEC_CLOBL      ----------------------------------------------------------------------
HUTI_STRSV      ----------------------------------------------------------------------
HUTI_STRGC      ----------------------------------------------------------------------
HUTI_GEOKA      ----------------------------------------------------------------------
HUTI_ERWT9      ----------------------------------------------------------------------
HUTI_BACA2      ----------------------------------------------------------------------
DPYS_MOUSE      ----------------------------------------------------------------------
ALLB_DEIRA      ----------------------------------------------------------------------
ADEC_DEHSC      ----------------------------------------------------------------------
ADEC_DEHSB      ----------------------------------------------------------------------
ADEC_CLOBM      ----------------------------------------------------------------------
ADEC_CLOB6      ----------------------------------------------------------------------
ADEC2_AGRT5     ----------------------------------------------------------------------
PYRC_WOLTR      ----------------------------------------------------------------------
MTAD_CLOTH      ----------------------------------------------------------------------
MTAD_BACCR      ----------------------------------------------------------------------
MTAD_BACC7      ----------------------------------------------------------------------
MTAD_BACC4      ----------------------------------------------------------------------
MTAD_BACC2      ----------------------------------------------------------------------
MTAD_BACC1      ----------------------------------------------------------------------
HUTI_VIBFM      ----------------------------------------------------------------------
HUTI_VIBF1      ----------------------------------------------------------------------
HUTI_STRP6      ----------------------------------------------------------------------
HUTI_STRP3      ----------------------------------------------------------------------
HUTI_PSEPU      ----------------------------------------------------------------------
HUTI_PSEA7      ----------------------------------------------------------------------
HUTI_BACCN      ----------------------------------------------------------------------
GUAD_ECOLI      ----------------------------------------------------------------------
ALLB_STRCO      ----------------------------------------------------------------------
ADEC_SHISS      ----------------------------------------------------------------------
ADEC_SHIBS      ----------------------------------------------------------------------
ADEC_ECOUT      ----------------------------------------------------------------------
ADEC_ECOSE      ----------------------------------------------------------------------
ADEC_ECOLC      ----------------------------------------------------------------------
ADEC_ECOL6      ----------------------------------------------------------------------
ADEC_ECOL5      ----------------------------------------------------------------------
ADEC_ECOK1      ----------------------------------------------------------------------
ADEC_ECO8A      ----------------------------------------------------------------------
ADEC_ECO81      ----------------------------------------------------------------------
ADEC_ECO7I      ----------------------------------------------------------------------
ADEC_ECO55      ----------------------------------------------------------------------
ADEC_ECO45      ----------------------------------------------------------------------
ADEC_ECO24      ----------------------------------------------------------------------
ADEC_DESVH      ----------------------------------------------------------------------
ADEC4_RHIME     ----------------------------------------------------------------------
ADEC2_OENOB     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           PYFEGLAIRDANPPGATDNSPPVRLALDKGLVVAGGTDSTRIGIAGVWHAIEYHITGIASGGSVRKPASE
AEPA_PECCC      ----------------------------------------------------------------------
YTCJ_BACSU      PHFVA-----SDFPWVIDRLGKDRMKISKGILCAGGSDAPIEPVLGIQSAVLRKSSHEQNGPSYNE--SE
ADEC1_LACSS     ----------------------------------------------------------------------
HUTI_ALKMQ      ----------------------------------------------------------------------
ALLB_DESHY      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ALLB_DESHD      ----------------------------------------------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
HUTI_FUSNN      ----------------------------------------------------------------------
ADEC_RHISN      ----------------------------------------------------------------------
ADEC_METBU      ----------------------------------------------------------------------
ADEC1_RHIME     ----------------------------------------------------------------------
ADEC1_RHIEC     ----------------------------------------------------------------------
HUTI_KLEP7      ----------------------------------------------------------------------
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
HUTI_BRASB      ----------------------------------------------------------------------
HUTI_ALKOO      ----------------------------------------------------------------------
ADEC1_DESPS     ----------------------------------------------------------------------
HUTI_PARDP      ----------------------------------------------------------------------
HUTI_VIBVY      ----------------------------------------------------------------------
HUTI_VIBVU      ----------------------------------------------------------------------
HUTI_VIBHB      ----------------------------------------------------------------------
ADEC1_AGRT5     ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
ADEC_LISW6      ----------------------------------------------------------------------
ADEC_KOSOT      ----------------------------------------------------------------------
ADEC_OCHA4      ----------------------------------------------------------------------
HUTI_RUBXD      ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
ALLB_BACLD      ----------------------------------------------------------------------
ADEC_SILPO      ----------------------------------------------------------------------
ADEC_DESAA      ----------------------------------------------------------------------
NDAD_ALCXX      ----------------------------------------------------------------------
HUTI_SYMTH      ----------------------------------------------------------------------
HUTI_KLEP3      ----------------------------------------------------------------------
ADEC_RHOS5      ----------------------------------------------------------------------
PYRC_STRP8      ----------------------------------------------------------------------
PYRC_STRP6      ----------------------------------------------------------------------
PYRC_STRP3      ----------------------------------------------------------------------
PYRC_STRP1      ----------------------------------------------------------------------
MTAD_DESVV      ----------------------------------------------------------------------
HUTI_ROSDO      ----------------------------------------------------------------------
HUTI_CHLAD      ----------------------------------------------------------------------
ADEC_DEHE1      ----------------------------------------------------------------------
MTAD_SYMTH      ---------------------PVAKMRRKGVAVGFGTDGA--SSENMLHILEMRIGAIQAKELEGDPAV-
HYDL_ARTAU      ----------------------------------------------------------------------
ADEC_THEAB      ----------------------------------------------------------------------
ADEC_GEOKA      ----------------------------------------------------------------------
ADEC_BRUSU      ----------------------------------------------------------------------
ADEC_BRUME      ----------------------------------------------------------------------
ADEC_BRUAB      ----------------------------------------------------------------------
ADEC_BRUA2      ----------------------------------------------------------------------
ADEC3_RHIME     ----------------------------------------------------------------------
PYRC_CLOD6      ----------------------------------------------------------------------
PYRC_CARHZ      ----------------------------------------------------------------------
MTAD_SYNFM      ----------------------------------------------------------------------
MTAD_NATPD      ----------------------------------------------------------------------
MTAD_DESVH      ----------------------------------------------------------------------
ALLB_ENTFA      ----------------------------------------------------------------------
HYDA_RHIRD      ----------------------------------------------------------------------
ADEC_BACA2      ----------------------------------------------------------------------
ADEC1_BACSK     ----------------------------------------------------------------------
PYRC_LACGA      ----------------------------------------------------------------------
HUTI_PSEU2      ----------------------------------------------------------------------
HUTI_PSEHT      ----------------------------------------------------------------------
HUTI_PSE14      ----------------------------------------------------------------------
HUTI_MESSB      ----------------------------------------------------------------------
ADEC_SILST      ----------------------------------------------------------------------
ADEC_CENSY      ----------------------------------------------------------------------
PYRC_LACPL      PHHLLLCDEDINP--MLKMNPPLRSAKDRAALVAGLLDGTIDMIAGSMKTAAFGITGIETAFATLYTATR
HUTI_METNO      ----------------------------------------------------------------------
HUTI_HERA2      ----------------------------------------------------------------------
HUTI_HAHCH      ----------------------------------------------------------------------
ADEC_PETMO      ----------------------------------------------------------------------
ADEC_LISIN      ----------------------------------------------------------------------
ADEC_CLOD6      ----------------------------------------------------------------------
HUTI_BACHD      ----------------------------------------------------------------------
ADEC_LISMO      ----------------------------------------------------------------------
PYRC_LACLA      ----------------------------------------------------------------------
PYRC_BACSU      ----------------------------------------------------------------------
HUTI_TREDE      ----------------------------------------------------------------------
ADEC_LISMF      ----------------------------------------------------------------------
ADEC_CLOAB      ----------------------------------------------------------------------
ADEC2_BACSK     ----------------------------------------------------------------------
HUTI_STRPD      ----------------------------------------------------------------------
ADEC_RHOSK      ----------------------------------------------------------------------
ADEC_RHOS4      ----------------------------------------------------------------------
ADEC_RHOS1      ----------------------------------------------------------------------
ADEC_BACSU      ----------------------------------------------------------------------
PYRC_STRT2      ----------------------------------------------------------------------
PYRC_STRT1      ----------------------------------------------------------------------
MTAD_METAC      ----------------------------------------------------------------------
HUTI_BURCJ      AYY---FIRET-------QLPPIELLRKHGVPIALATDHN----PGT-SPLESLLLTLNMGCTL-----F
HUTI_BRASO      ----------------------------------------------------------------------
ADEC_STAMF      ----------------------------------------------------------------------
ADEC_MOOTA      ----------------------------------------------------------------------
ADEC1_RHIL3     ----------------------------------------------------------------------
PYRC_STRR6      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_LACJO      ----------------------------------------------------------------------
PYRC_LACH4      ----------------------------------------------------------------------
PYRC_LACDB      ----------------------------------------------------------------------
PYRC_LACDA      ----------------------------------------------------------------------
NDED_ALCXX      ----------------------------------------------------------------------
HUTI_STRPZ      ----------------------------------------------------------------------
HUTI_STRPM      ----------------------------------------------------------------------
HUTI_STRPG      ----------------------------------------------------------------------
HUTI_STRPF      ----------------------------------------------------------------------
HUTI_STRPC      ----------------------------------------------------------------------
HUTI_STRPB      ----------------------------------------------------------------------
HUTI_STRP8      ----------------------------------------------------------------------
HUTI_STRP1      ----------------------------------------------------------------------
HUTI_STAAW      ----------------------------------------------------------------------
HUTI_STAAT      ----------------------------------------------------------------------
HUTI_STAAS      ----------------------------------------------------------------------
HUTI_STAAR      ----------------------------------------------------------------------
HUTI_STAAE      ----------------------------------------------------------------------
HUTI_STAAC      ----------------------------------------------------------------------
HUTI_STAA8      ----------------------------------------------------------------------
HUTI_STAA3      ----------------------------------------------------------------------
HUTI_COLP3      ----------------------------------------------------------------------
HUTI_BURCM      AYY---FIRET-------QLPPIELLRKHGVPIALATDHN----PGT-SPLESLLLTLNMGCTL-----F
HUTI_BACSU      ----------------------------------------------------------------------
HUTI_ARTAT      ----------------------------------------------------------------------
ADEC_SHIFL      ----------------------------------------------------------------------
ADEC_SHIF8      ----------------------------------------------------------------------
ADEC_CLOB1      ----------------------------------------------------------------------
ADEC2_LACSS     ----------------------------------------------------------------------
MTAD_BACC3      ----------------------------------------------------------------------
MTAD_BACC0      ----------------------------------------------------------------------
MTAD_BACAN      ----------------------------------------------------------------------
MTAD_BACAH      ----------------------------------------------------------------------
MTAD_BACAC      ----------------------------------------------------------------------
MTAD_BACAA      ----------------------------------------------------------------------
HYDA_BURPI      ----------------------------------------------------------------------
HUTI_PSESM      ----------------------------------------------------------------------
HUTI_DANRE      --------------------PRARDMLDAGVIVALGSDFNPNAYCFSMPMV-MHLACVMM----------
ADEC_CLOBL      ----------------------------------------------------------------------
HUTI_STRSV      ----------------------------------------------------------------------
HUTI_STRGC      ----------------------------------------------------------------------
HUTI_GEOKA      ----------------------------------------------------------------------
HUTI_ERWT9      ----------------------------------------------------------------------
HUTI_BACA2      ----------------------------------------------------------------------
DPYS_MOUSE      ----------------------------------------------------------------------
ALLB_DEIRA      ----------------------------------------------------------------------
ADEC_DEHSC      ----------------------------------------------------------------------
ADEC_DEHSB      ----------------------------------------------------------------------
ADEC_CLOBM      ----------------------------------------------------------------------
ADEC_CLOB6      ----------------------------------------------------------------------
ADEC2_AGRT5     ----------------------------------------------------------------------
PYRC_WOLTR      ----------------------------------------------------------------------
MTAD_CLOTH      ----------------------------------------------------------------------
MTAD_BACCR      ----------------------------------------------------------------------
MTAD_BACC7      ----------------------------------------------------------------------
MTAD_BACC4      ----------------------------------------------------------------------
MTAD_BACC2      ----------------------------------------------------------------------
MTAD_BACC1      ----------------------------------------------------------------------
HUTI_VIBFM      ----------------------------------------------------------------------
HUTI_VIBF1      ----------------------------------------------------------------------
HUTI_STRP6      ----------------------------------------------------------------------
HUTI_STRP3      ----------------------------------------------------------------------
HUTI_PSEPU      ----------------------------------------------------------------------
HUTI_PSEA7      ----------------------------------------------------------------------
HUTI_BACCN      ----------------------------------------------------------------------
GUAD_ECOLI      ----------------------------------------------------------------------
ALLB_STRCO      ----------------------------------------------------------------------
ADEC_SHISS      ----------------------------------------------------------------------
ADEC_SHIBS      ----------------------------------------------------------------------
ADEC_ECOUT      ----------------------------------------------------------------------
ADEC_ECOSE      ----------------------------------------------------------------------
ADEC_ECOLC      ----------------------------------------------------------------------
ADEC_ECOL6      ----------------------------------------------------------------------
ADEC_ECOL5      ----------------------------------------------------------------------
ADEC_ECOK1      ----------------------------------------------------------------------
ADEC_ECO8A      ----------------------------------------------------------------------
ADEC_ECO81      ----------------------------------------------------------------------
ADEC_ECO7I      ----------------------------------------------------------------------
ADEC_ECO55      ----------------------------------------------------------------------
ADEC_ECO45      ----------------------------------------------------------------------
ADEC_ECO24      ----------------------------------------------------------------------
ADEC_DESVH      ----------------------------------------------------------------------
ADEC4_RHIME     ----------------------------------------------------------------------
ADEC2_OENOB     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RLTRLEALALYTRHAAWLAFAEQHRGQLSVGKQADLAVLNQPFMTMPEDRIDTIRAVLTLVDGRIVHESx
AEPA_PECCC      ----------------------------------------------------------------------
YTCJ_BACSU      CLPVYEAIKLYTEGSAGIIYKEKSRGKIAEGYDADFTVLSGDPFAIDPAQLHLLEIKKTVINGQIVYE--
ADEC1_LACSS     ----------------------------------------------------------------------
HUTI_ALKMQ      ----------------------------------------------------------------------
ALLB_DESHY      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ALLB_DESHD      ----------------------------------------------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
HUTI_FUSNN      ----------------------------------------------------------------------
ADEC_RHISN      ----------------------------------------------------------------------
ADEC_METBU      ----------------------------------------------------------------------
ADEC1_RHIME     ----------------------------------------------------------------------
ADEC1_RHIEC     ----------------------------------------------------------------------
HUTI_KLEP7      ----------------------------------------------------------------------
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
HUTI_BRASB      ----------------------------------------------------------------------
HUTI_ALKOO      ----------------------------------------------------------------------
ADEC1_DESPS     ----------------------------------------------------------------------
HUTI_PARDP      ----------------------------------------------------------------------
HUTI_VIBVY      ----------------------------------------------------------------------
HUTI_VIBVU      ----------------------------------------------------------------------
HUTI_VIBHB      ----------------------------------------------------------------------
ADEC1_AGRT5     ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
ADEC_LISW6      ----------------------------------------------------------------------
ADEC_KOSOT      ----------------------------------------------------------------------
ADEC_OCHA4      ----------------------------------------------------------------------
HUTI_RUBXD      ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
ALLB_BACLD      ----------------------------------------------------------------------
ADEC_SILPO      ----------------------------------------------------------------------
ADEC_DESAA      ----------------------------------------------------------------------
NDAD_ALCXX      ----------------------------------------------------------------------
HUTI_SYMTH      ----------------------------------------------------------------------
HUTI_KLEP3      ----------------------------------------------------------------------
ADEC_RHOS5      ----------------------------------------------------------------------
PYRC_STRP8      ----------------------------------------------------------------------
PYRC_STRP6      ----------------------------------------------------------------------
PYRC_STRP3      ----------------------------------------------------------------------
PYRC_STRP1      ----------------------------------------------------------------------
MTAD_DESVV      ----------------------------------------------------------------------
HUTI_ROSDO      ----------------------------------------------------------------------
HUTI_CHLAD      ----------------------------------------------------------------------
ADEC_DEHE1      ----------------------------------------------------------------------
MTAD_SYMTH      -YTAYDAVAMATIEAARVLGMESEIGSLEPGKKADLILIDRPHLTPNHDVFALIAVVMTIVDGRIVYE--
HYDL_ARTAU      ----------------------------------------------------------------------
ADEC_THEAB      ----------------------------------------------------------------------
ADEC_GEOKA      ----------------------------------------------------------------------
ADEC_BRUSU      ----------------------------------------------------------------------
ADEC_BRUME      ----------------------------------------------------------------------
ADEC_BRUAB      ----------------------------------------------------------------------
ADEC_BRUA2      ----------------------------------------------------------------------
ADEC3_RHIME     ----------------------------------------------------------------------
PYRC_CLOD6      ----------------------------------------------------------------------
PYRC_CARHZ      ----------------------------------------------------------------------
MTAD_SYNFM      ----------------------------------------------------------------------
MTAD_NATPD      ----------------------------------------------------------------------
MTAD_DESVH      ----------------------------------------------------------------------
ALLB_ENTFA      ----------------------------------------------------------------------
HYDA_RHIRD      ----------------------------------------------------------------------
ADEC_BACA2      ----------------------------------------------------------------------
ADEC1_BACSK     ----------------------------------------------------------------------
PYRC_LACGA      ----------------------------------------------------------------------
HUTI_PSEU2      ----------------------------------------------------------------------
HUTI_PSEHT      ----------------------------------------------------------------------
HUTI_PSE14      ----------------------------------------------------------------------
HUTI_MESSB      ----------------------------------------------------------------------
ADEC_SILST      ----------------------------------------------------------------------
ADEC_CENSY      ----------------------------------------------------------------------
PYRC_LACPL      LLTLGRLIELMSTRPAEL-FGLNTAGRLVVGAPADLTIINSPFIGWPVYG----NVLMTLVDGKLAY---
HUTI_METNO      ----------------------------------------------------------------------
HUTI_HERA2      RLTPAEALNAATVNSAFAIRQHERVGSLAVGMQADLALLNLPDERHIGYKFGTNPVAIVIKTGRVVRRN-
HUTI_HAHCH      ----------------------------------------------------------------------
ADEC_PETMO      ----------------------------------------------------------------------
ADEC_LISIN      ----------------------------------------------------------------------
ADEC_CLOD6      ----------------------------------------------------------------------
HUTI_BACHD      ----------------------------------------------------------------------
ADEC_LISMO      ----------------------------------------------------------------------
PYRC_LACLA      ----------------------------------------------------------------------
PYRC_BACSU      ----------------------------------------------------------------------
HUTI_TREDE      ----------------------------------------------------------------------
ADEC_LISMF      ----------------------------------------------------------------------
ADEC_CLOAB      ----------------------------------------------------------------------
ADEC2_BACSK     ----------------------------------------------------------------------
HUTI_STRPD      RLTPLEVLNAVTINAAYSVNRQERVGSLTVGKEADIAIFDAPNIDYP-----------------------
ADEC_RHOSK      ----------------------------------------------------------------------
ADEC_RHOS4      ----------------------------------------------------------------------
ADEC_RHOS1      ----------------------------------------------------------------------
ADEC_BACSU      ----------------------------------------------------------------------
PYRC_STRT2      ----------------------------------------------------------------------
PYRC_STRT1      ----------------------------------------------------------------------
MTAD_METAC      ----------------------------------------------------------------------
HUTI_BURCJ      RMTVPEVLQGVTRHAAAALGRADRHGALEVGRQADFAV--------------------------------
HUTI_BRASO      ----------------------------------------------------------------------
ADEC_STAMF      ----------------------------------------------------------------------
ADEC_MOOTA      ----------------------------------------------------------------------
ADEC1_RHIL3     ----------------------------------------------------------------------
PYRC_STRR6      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_LACJO      ----------------------------------------------------------------------
PYRC_LACH4      ----------------------------------------------------------------------
PYRC_LACDB      ----------------------------------------------------------------------
PYRC_LACDA      ----------------------------------------------------------------------
NDED_ALCXX      ----------------------------------------------------------------------
HUTI_STRPZ      RLTPIEVLNAVTINAAYSVNRQERVGSLTVGKEADIAIFDAPNIDYP-----------------------
HUTI_STRPM      RLTPIEVLNAVTINAAYSVNRQERVGSLTVGKEADIAIFDAPNIDYP-----------------------
HUTI_STRPG      RLTPIEVLNAVTINAAYSVNRQERVGSLTVGKEADIAIFDAPNIDYP-----------------------
HUTI_STRPF      RLTPIEVLNAVTINAAYSVNRQERVGSLTVGKEADIAIFDAPNIDYP-----------------------
HUTI_STRPC      RLTPIEVLNAVTINAAYSVNRQERVGSLTVGKEADIAIFDAPNIDYP-----------------------
HUTI_STRPB      RLTPIEVLNAVTINAAYSVNRQERVGSLTVGKEADIAIFDAPNIDYP-----------------------
HUTI_STRP8      RLTPIEVLNAVTINAAYSVNRQERVGSLTVGKEADIAIFDAPNIDYP-----------------------
HUTI_STRP1      RLTPIEVLNAVTINAAYSVNRQERVGSLTVGKEADIAIFDAPNIDYP-----------------------
HUTI_STAAW      ----------------------------------------------------------------------
HUTI_STAAT      ----------------------------------------------------------------------
HUTI_STAAS      ----------------------------------------------------------------------
HUTI_STAAR      ----------------------------------------------------------------------
HUTI_STAAE      ----------------------------------------------------------------------
HUTI_STAAC      ----------------------------------------------------------------------
HUTI_STAA8      ----------------------------------------------------------------------
HUTI_STAA3      ----------------------------------------------------------------------
HUTI_COLP3      ----------------------------------------------------------------------
HUTI_BURCM      RMTVPEVLQGVTRHAAAALGRADRHGALEIGRQADFAV--------------------------------
HUTI_BACSU      ----------------------------------------------------------------------
HUTI_ARTAT      ----------------------------------------------------------------------
ADEC_SHIFL      ----------------------------------------------------------------------
ADEC_SHIF8      ----------------------------------------------------------------------
ADEC_CLOB1      ----------------------------------------------------------------------
ADEC2_LACSS     ----------------------------------------------------------------------
MTAD_BACC3      ----------------------------------------------------------------------
MTAD_BACC0      ----------------------------------------------------------------------
MTAD_BACAN      ----------------------------------------------------------------------
MTAD_BACAH      ----------------------------------------------------------------------
MTAD_BACAC      ----------------------------------------------------------------------
MTAD_BACAA      ----------------------------------------------------------------------
HYDA_BURPI      ----------------------------------------------------------------------
HUTI_PSESM      ----------------------------------------------------------------------
HUTI_DANRE      KMSMPEALAASTINAAYALNRSQTHGSLEVGKQGDLVIINAP----------------------------
ADEC_CLOBL      ----------------------------------------------------------------------
HUTI_STRSV      ----------------------------------------------------------------------
HUTI_STRGC      ----------------------------------------------------------------------
HUTI_GEOKA      ----------------------------------------------------------------------
HUTI_ERWT9      ----------------------------------------------------------------------
HUTI_BACA2      ----------------------------------------------------------------------
DPYS_MOUSE      ----------------------------------------------------------------------
ALLB_DEIRA      ----------------------------------------------------------------------
ADEC_DEHSC      ----------------------------------------------------------------------
ADEC_DEHSB      ----------------------------------------------------------------------
ADEC_CLOBM      ----------------------------------------------------------------------
ADEC_CLOB6      ----------------------------------------------------------------------
ADEC2_AGRT5     ----------------------------------------------------------------------
PYRC_WOLTR      ----------------------------------------------------------------------
MTAD_CLOTH      ----------------------------------------------------------------------
MTAD_BACCR      ----------------------------------------------------------------------
MTAD_BACC7      ----------------------------------------------------------------------
MTAD_BACC4      ----------------------------------------------------------------------
MTAD_BACC2      ----------------------------------------------------------------------
MTAD_BACC1      ----------------------------------------------------------------------
HUTI_VIBFM      KLTPEESLRGVTCHAAQALGLQNFRGKIAVGMEADFAIWQLESPAELSYRLGVPDLIARVVDGEIFHE--
HUTI_VIBF1      KLTPEESLRGVTCHAAQALGLQHFRGKIAVGMEADFAIWQLESPAELSYRLGVPDLIARVVDGEIFHE--
HUTI_STRP6      RLTPIEVLNAVTINAAYSVNRQERVGSLTVGKEADIAIFDAP----------------------------
HUTI_STRP3      RLTPIEVLNAVTINAAYSVNRQERVGSLTVGKEADIAIFDAP----------------------------
HUTI_PSEPU      ----------------------------------------------------------------------
HUTI_PSEA7      ----------------------------------------------------------------------
HUTI_BACCN      ----------------------------------------------------------------------
GUAD_ECOLI      ----------------------------------------------------------------------
ALLB_STRCO      ----------------------------------------------------------------------
ADEC_SHISS      ----------------------------------------------------------------------
ADEC_SHIBS      ----------------------------------------------------------------------
ADEC_ECOUT      ----------------------------------------------------------------------
ADEC_ECOSE      ----------------------------------------------------------------------
ADEC_ECOLC      ----------------------------------------------------------------------
ADEC_ECOL6      ----------------------------------------------------------------------
ADEC_ECOL5      ----------------------------------------------------------------------
ADEC_ECOK1      ----------------------------------------------------------------------
ADEC_ECO8A      ----------------------------------------------------------------------
ADEC_ECO81      ----------------------------------------------------------------------
ADEC_ECO7I      ----------------------------------------------------------------------
ADEC_ECO55      ----------------------------------------------------------------------
ADEC_ECO45      ----------------------------------------------------------------------
ADEC_ECO24      ----------------------------------------------------------------------
ADEC_DESVH      ----------------------------------------------------------------------
ADEC4_RHIME     ----------------------------------------------------------------------
ADEC2_OENOB     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxx
AEPA_PECCC      ------
YTCJ_BACSU      ------
ADEC1_LACSS     ------
HUTI_ALKMQ      ------
ALLB_DESHY      ------
ALLB_ECOSE      ------
ALLB_ECOLU      ------
ALLB_ECOLI      ------
ALLB_ECOLC      ------
ALLB_ECOHS      ------
ALLB_ECODH      ------
ALLB_ECOBW      ------
ALLB_ECO8A      ------
ALLB_ECO55      ------
ALLB_ECO24      ------
ALLB_DESHD      ------
ALLB_ECOSM      ------
HUTI_FUSNN      ------
ADEC_RHISN      ------
ADEC_METBU      ------
ADEC1_RHIME     ------
ADEC1_RHIEC     ------
HUTI_KLEP7      ------
ALLB_SALTY      ------
ALLB_SALTI      ------
ALLB_SALPK      ------
ALLB_SALPB      ------
ALLB_SALPA      ------
ALLB_SALNS      ------
ALLB_SALHS      ------
ALLB_SALEP      ------
ALLB_SALDC      ------
ALLB_SALA4      ------
HUTI_BRASB      ------
HUTI_ALKOO      ------
ADEC1_DESPS     ------
HUTI_PARDP      ------
HUTI_VIBVY      ------
HUTI_VIBVU      ------
HUTI_VIBHB      ------
ADEC1_AGRT5     ------
ALLB_ECOUT      ------
ALLB_ECOL6      ------
ALLB_ECOL5      ------
ALLB_ECOK1      ------
ALLB_ECO81      ------
ALLB_ECO45      ------
ALLB_ECO27      ------
ADEC_LISW6      ------
ADEC_KOSOT      ------
ADEC_OCHA4      ------
HUTI_RUBXD      ------
ALLB_SALCH      ------
ALLB_BACLD      ------
ADEC_SILPO      ------
ADEC_DESAA      ------
NDAD_ALCXX      ------
HUTI_SYMTH      ------
HUTI_KLEP3      ------
ADEC_RHOS5      ------
PYRC_STRP8      ------
PYRC_STRP6      ------
PYRC_STRP3      ------
PYRC_STRP1      ------
MTAD_DESVV      ------
HUTI_ROSDO      ------
HUTI_CHLAD      ------
ADEC_DEHE1      ------
MTAD_SYMTH      ------
HYDL_ARTAU      ------
ADEC_THEAB      ------
ADEC_GEOKA      ------
ADEC_BRUSU      ------
ADEC_BRUME      ------
ADEC_BRUAB      ------
ADEC_BRUA2      ------
ADEC3_RHIME     ------
PYRC_CLOD6      ------
PYRC_CARHZ      ------
MTAD_SYNFM      ------
MTAD_NATPD      ------
MTAD_DESVH      ------
ALLB_ENTFA      ------
HYDA_RHIRD      ------
ADEC_BACA2      ------
ADEC1_BACSK     ------
PYRC_LACGA      ------
HUTI_PSEU2      ------
HUTI_PSEHT      ------
HUTI_PSE14      ------
HUTI_MESSB      ------
ADEC_SILST      ------
ADEC_CENSY      ------
PYRC_LACPL      ------
HUTI_METNO      ------
HUTI_HERA2      ------
HUTI_HAHCH      ------
ADEC_PETMO      ------
ADEC_LISIN      ------
ADEC_CLOD6      ------
HUTI_BACHD      ------
ADEC_LISMO      ------
PYRC_LACLA      ------
PYRC_BACSU      ------
HUTI_TREDE      ------
ADEC_LISMF      ------
ADEC_CLOAB      ------
ADEC2_BACSK     ------
HUTI_STRPD      ------
ADEC_RHOSK      ------
ADEC_RHOS4      ------
ADEC_RHOS1      ------
ADEC_BACSU      ------
PYRC_STRT2      ------
PYRC_STRT1      ------
MTAD_METAC      ------
HUTI_BURCJ      ------
HUTI_BRASO      ------
ADEC_STAMF      ------
ADEC_MOOTA      ------
ADEC1_RHIL3     ------
PYRC_STRR6      ------
PYRC_STRPN      ------
PYRC_LACJO      ------
PYRC_LACH4      ------
PYRC_LACDB      ------
PYRC_LACDA      ------
NDED_ALCXX      ------
HUTI_STRPZ      ------
HUTI_STRPM      ------
HUTI_STRPG      ------
HUTI_STRPF      ------
HUTI_STRPC      ------
HUTI_STRPB      ------
HUTI_STRP8      ------
HUTI_STRP1      ------
HUTI_STAAW      ------
HUTI_STAAT      ------
HUTI_STAAS      ------
HUTI_STAAR      ------
HUTI_STAAE      ------
HUTI_STAAC      ------
HUTI_STAA8      ------
HUTI_STAA3      ------
HUTI_COLP3      ------
HUTI_BURCM      ------
HUTI_BACSU      ------
HUTI_ARTAT      ------
ADEC_SHIFL      ------
ADEC_SHIF8      ------
ADEC_CLOB1      ------
ADEC2_LACSS     ------
MTAD_BACC3      ------
MTAD_BACC0      ------
MTAD_BACAN      ------
MTAD_BACAH      ------
MTAD_BACAC      ------
MTAD_BACAA      ------
HYDA_BURPI      ------
HUTI_PSESM      ------
HUTI_DANRE      ------
ADEC_CLOBL      ------
HUTI_STRSV      ------
HUTI_STRGC      ------
HUTI_GEOKA      ------
HUTI_ERWT9      ------
HUTI_BACA2      ------
DPYS_MOUSE      ------
ALLB_DEIRA      ------
ADEC_DEHSC      ------
ADEC_DEHSB      ------
ADEC_CLOBM      ------
ADEC_CLOB6      ------
ADEC2_AGRT5     ------
PYRC_WOLTR      ------
MTAD_CLOTH      ------
MTAD_BACCR      ------
MTAD_BACC7      ------
MTAD_BACC4      ------
MTAD_BACC2      ------
MTAD_BACC1      ------
HUTI_VIBFM      ------
HUTI_VIBF1      ------
HUTI_STRP6      ------
HUTI_STRP3      ------
HUTI_PSEPU      ------
HUTI_PSEA7      ------
HUTI_BACCN      ------
GUAD_ECOLI      ------
ALLB_STRCO      ------
ADEC_SHISS      ------
ADEC_SHIBS      ------
ADEC_ECOUT      ------
ADEC_ECOSE      ------
ADEC_ECOLC      ------
ADEC_ECOL6      ------
ADEC_ECOL5      ------
ADEC_ECOK1      ------
ADEC_ECO8A      ------
ADEC_ECO81      ------
ADEC_ECO7I      ------
ADEC_ECO55      ------
ADEC_ECO45      ------
ADEC_ECO24      ------
ADEC_DESVH      ------
ADEC4_RHIME     ------
ADEC2_OENOB     ------