[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF67603.1

[Show Plain Result]


## Summary of Sequence Search
    1::146
    1::91      7e-10  32%  137 aa  YEMD_SCHPO RecName: Full=Uncharacterized lyase C29B12.13;        
   26::115     3e-05  30%  191 aa  GFA_XANCP RecName: Full=Glutathione-dependent
   26::115     3e-05  30%  191 aa  GFA_XANC8 RecName: Full=Glutathione-dependent
   26::115     4e-05  30%  191 aa  GFA_XANCB RecName: Full=Glutathione-dependent
   23::112     2e-04  28%  189 aa  GFA_RHIME RecName: Full=Glutathione-dependent
  300::371     5e-04  35%  491 aa  STK33_MOUSE RecName: Full=Serine/threonine-protein kinase 33;      
  122::214     0.001  44%  295 aa  CG046_XENLA RecName: Full=Uncharacterized protein C7orf46 homolog;
    1::146

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQTFTGRCLCGQSHFTVDVEMLDVYACHCTLCQKWSGGIAMYLEACGQPQLAPLSPEPPYFSSSSRGERY
YEMD_SCHPO      MPEYEGNCLCKAIHLKAIIEEPKLSCCHCETCRIWCSSPFMAFSCTQKPSVSE-NENVGKYASSSFAERI
GFA_XANCP       ----TLQCLCASNKVTVDVASQSAHACGCSKCWKPEGAKFSVVAVAPRDKVTVTAPEKKIVDESATIQRH
GFA_XANC8       ----TLQCLCASNKVTVDVASQSAHACGCSKCWKPEGAKFSVVAVAPRDKVTVTAPEKKIVDESATIQRH
GFA_XANCB       ----TLQCLCASDKVTVDVASQSAHACGCSKCWKPEGAKFSVVAVAPRDKVTVTAPEKKIVDESATIQRH
GFA_RHIME       ----TLKCKCASNPVTVRIQTAHNHACGCTKCWKPEGAIFAQIAVVGRDNVNVTSEKLQVVDPSATIQRY
STK33_MOUSE     -------------------------------CDIWSIGVIMFILLCGEPPFLANSEEKLY-ELIKKGELR
CG046_XENLA     ------RCRC--KHFADEHSLAGTY--HCTKCTKCSGFHSSFTCGCGQPAYAPVGHDVPYFSSLAEGMRL


                         .         .         *         .         .         .         .:140
query           FCSGCGCPLWFRLTDTDRYFIPWTLLELNEVDRRRLILAAEIxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YEMD_SCHPO      FCKNCGTTLYFAYTNKNPYFI-------------------------------------------------
GFA_XANCP       ACTGCGVHLYGRIENKDHAF--------------------------------------------------
GFA_XANC8       ACTGCGVHLYGRIENKDHAF--------------------------------------------------
GFA_XANCB       ACTGCGVHLYGRIENKDHAF--------------------------------------------------
GFA_RHIME       ACRDCGTHMYGRIENTKHPF--------------------------------------------------
STK33_MOUSE     FEN----PVWESVSDSAKN----TLKQLMKVDPAHRITAKEL----------------------------
CG046_XENLA     DASGTGAP--------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxx
YEMD_SCHPO      ------
GFA_XANCP       ------
GFA_XANC8       ------
GFA_XANCB       ------
GFA_RHIME       ------
STK33_MOUSE     ------
CG046_XENLA     ------