[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF67677.1

[Show Plain Result]


## Summary of Sequence Search
    1::220
    1::220     e-131 100%  220 aa  NUOB_SALTY RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-131 100%  220 aa  NUOB_SALTI RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-131 100%  220 aa  NUOB_SALSV RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-131 100%  220 aa  NUOB_SALPK RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-131 100%  220 aa  NUOB_SALPC RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-131 100%  220 aa  NUOB_SALPB RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-131 100%  220 aa  NUOB_SALPA RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-131 100%  220 aa  NUOB_SALNS RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-131 100%  220 aa  NUOB_SALHS RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-131 100%  220 aa  NUOB_SALG2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-131 100%  220 aa  NUOB_SALEP RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-131 100%  220 aa  NUOB_SALDC RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-131 100%  220 aa  NUOB_SALCH RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-131 100%  220 aa  NUOB_SALAR RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-131 100%  220 aa  NUOB_SALA4 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_SHISS RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_SHIFL RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_SHIF8 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_SHIBS RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_SHIB3 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ESCF3 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECOUT RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECOSM RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECOSE RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECOLU RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECOLC RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECOL6 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECOL5 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECOK1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECOHS RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECODH RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECOBW RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECO8A RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECO81 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECO7I RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECO5E RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECO57 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECO55 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECO45 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECO27 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-129  99%  220 aa  NUOB_ECO24 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::220     e-128  99%  220 aa  NUOB_SHIDS RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-127  99%  224 aa  NUOB_KLEP7 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-127  99%  224 aa  NUOB_KLEP3 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-127  98%  224 aa  NUOB_CITK8 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-127  98%  224 aa  NUOB_ENT38 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-123  95%  224 aa  NUOB_SERP5 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-123  95%  224 aa  NUOB_ENTS8 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-122  94%  224 aa  NUOB_PHOLL RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-122  93%  224 aa  NUOB_EDWI9 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-121  93%  224 aa  NUOB_PROMH RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-120  93%  225 aa  NUOB_YERPY RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-120  93%  225 aa  NUOB_YERPS RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-120  93%  225 aa  NUOB_YERPP RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-120  93%  225 aa  NUOB_YERPN RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-120  93%  225 aa  NUOB_YERPG RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-120  93%  225 aa  NUOB_YERPE RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-120  93%  225 aa  NUOB_YERPB RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-120  93%  225 aa  NUOB_YERPA RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-120  93%  225 aa  NUOB_YERE8 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-120  91%  224 aa  NUOB_ERWT9 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-120  91%  224 aa  NUOB_PECCP RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-120  91%  224 aa  NUOB_PECCC RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-120  91%  224 aa  NUOB_ERWCT RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::227     e-117  92%  227 aa  NUOB_YERP3 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-113  86%  224 aa  NUOB_SODGM RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-107  79%  224 aa  NUOB_PSEFS RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-107  78%  224 aa  NUOB_PSEPF RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-107  78%  224 aa  NUOB_PSEU2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-107  78%  224 aa  NUOB_PSESM RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-107  78%  224 aa  NUOB_PSE14 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-107  78%  224 aa  NUOB_PSEF5 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-105  78%  225 aa  NUOB_PSEMY RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-105  79%  225 aa  NUOB_PSEA7 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-105  79%  225 aa  NUOB_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-105  79%  225 aa  NUOB_PSEAB RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-105  79%  225 aa  NUOB_PSEA8 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-104  77%  224 aa  NUOB_AZOVD RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-104  77%  225 aa  NUOB_PSEPK RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-104  77%  225 aa  NUOB_PSEP1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-104  79%  224 aa  NUOB_SHEON RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-104  77%  225 aa  NUOB_PSEPG RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-104  77%  225 aa  NUOB_PSEE4 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::225     e-104  77%  225 aa  NUOB_PSEPW RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-103  78%  224 aa  NUOB_AERS4 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     e-103  78%  224 aa  NUOB_AERHH RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::223     e-101  78%  223 aa  NUOB_TOLAT RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     2e-99  77%  236 aa  NUOB_BLOPB RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::226     5e-99  75%  226 aa  NUOB_CHRSD RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     7e-99  75%  224 aa  NUOB_BUCAT RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     7e-99  75%  224 aa  NUOB_BUCAI RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     7e-99  75%  224 aa  NUOB_BUCA5 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     1e-97  75%  224 aa  NUOB_BAUCH RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     6e-97  77%  225 aa  NUOB_ACIBY RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     6e-97  77%  225 aa  NUOB_ACIBT RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     6e-97  77%  225 aa  NUOB_ACIBS RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     6e-97  77%  225 aa  NUOB_ACIBC RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     6e-97  77%  225 aa  NUOB_ACIB5 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     6e-97  77%  225 aa  NUOB_ACIB3 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::222     1e-96  75%  222 aa  NUOB_PSYWF RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::222     2e-96  75%  222 aa  NUOB_PSYCK RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::222     2e-96  75%  222 aa  NUOB_PSYA2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::224     2e-96  76%  225 aa  NUOB_ACIAD RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::223     3e-93  72%  223 aa  NUOB_BLOFL RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::223     5e-93  72%  223 aa  NUOB_BUCAP RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::212     1e-92  73%  222 aa  NUOB_BUCBP RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::223     2e-89  67%  225 aa  NUOB_BUCCC RecName: Full=NADH-quinone oxidoreductase subunit B;    
   29::219     3e-83  69%  221 aa  NUOB1_NITMU RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    2::212     1e-82  66%  212 aa  NUOB1_NITOC RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   22::209     5e-80  68%  213 aa  NUOB_METCA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   44::231     1e-76  68%  231 aa  NUOB2_ACICJ RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   20::211     1e-75  64%  211 aa  NUOB1_GLUDA RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    2::213     3e-71  59%  213 aa  NUOB_SHEWM RecName: Full=NADH-quinone oxidoreductase subunit B;    
   25::203     4e-66  65%  205 aa  NUOB2_RHOSK RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   25::203     4e-66  65%  205 aa  NUOB2_RHOS4 RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   25::203     6e-66  65%  205 aa  NUOB2_RHOS1 RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   13::174     1e-65  67%  205 aa  NUOB1_RHOP5 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    7::208     2e-65  58%  208 aa  NUOB_RHOP2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::172     2e-65  64%  791 aa  NUBCD_GEOMG RecName: Full=NADH-quinone oxidoreductase subunit
    6::175     2e-65  64%  794 aa  NUBCD_GEOBB RecName: Full=NADH-quinone oxidoreductase subunit
   14::174     5e-65  67%  205 aa  NUOB2_RHOPB RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   25::203     5e-65  63%  205 aa  NUOB1_RHOS5 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    3::172     8e-65  68%  792 aa  NUBCD_GEOSL RecName: Full=NADH-quinone oxidoreductase subunit
    9::174     4e-64  65%  793 aa  NUBCD_GEOUR RecName: Full=NADH-quinone oxidoreductase subunit
   17::177     5e-64  68%  208 aa  NUOB1_RHOPS RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   17::177     4e-62  66%  208 aa  NUOB2_RHOPT RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   17::177     4e-62  66%  208 aa  NUOB2_RHOPA RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    1::163     2e-59  61%  794 aa  NUBCD_PELCD RecName: Full=NADH-quinone oxidoreductase subunit
    5::179     3e-58  60%  787 aa  NUBCD_SYNFM RecName: Full=NADH-quinone oxidoreductase subunit
    3::161     2e-53  58%  170 aa  NUOB_GEOUR RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::161     4e-53  57%  170 aa  NUOB_GEOSF RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::153     3e-52  56%  168 aa  NUOB_CAMFF RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::161     8e-52  55%  170 aa  NUOB_GEOSM RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::161     2e-51  55%  170 aa  NUOB_GEOBB RecName: Full=NADH-quinone oxidoreductase subunit B;    
   16::161     2e-51  58%  178 aa  NUOB_DEIDV RecName: Full=NADH-quinone oxidoreductase subunit B;    
   50::199     9e-51  58%  213 aa  NUOB1_ACIBL RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    3::150     3e-50  55%  271 aa  NUOB_FRASC RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     3e-50  55%  281 aa  NUOB_FRAAA RecName: Full=NADH-quinone oxidoreductase subunit B;    
    6::151     4e-50  56%  164 aa  NUOB_PARUW RecName: Full=NADH-quinone oxidoreductase subunit B;    
   30::176     4e-50  62%  187 aa  NUOB_BDEBA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   13::159     6e-50  59%  170 aa  NUOB_METI4 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    5::160     6e-50  58%  264 aa  NUOB1_CHLSY RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    5::160     6e-50  58%  264 aa  NUOB1_CHLAA RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    3::150     8e-50  55%  264 aa  NUOB_FRASN RecName: Full=NADH-quinone oxidoreductase subunit B;    
    9::160     1e-49  60%  268 aa  NUOB2_ROSCS RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    5::160     1e-49  58%  264 aa  NUOB2_CHLAD RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    7::160     1e-49  60%  268 aa  NUOB1_ROSS1 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    3::161     2e-49  56%  169 aa  NUOB_GEOLS RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::161     4e-49  53%  170 aa  NUOB_GEOMG RecName: Full=NADH-quinone oxidoreductase subunit B;    
   16::154     5e-49  59%  186 aa  NUOB1_CHLT3 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   25::187     8e-49  56%  191 aa  NUOB2_OPITP RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    5::152     8e-49  54%  188 aa  NUOB1_SOLUE RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    3::161     1e-48  52%  170 aa  NUOB_GEOSL RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::153     1e-48  54%  184 aa  NUOB_BEUC1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   32::181     2e-48  58%  196 aa  NUOB_BACFR RecName: Full=NADH-quinone oxidoreductase subunit B;    
   32::181     2e-48  58%  196 aa  NUOB_BACFN RecName: Full=NADH-quinone oxidoreductase subunit B;    
    5::155     2e-48  54%  171 aa  NUOB_ARCB4 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     2e-48  54%  184 aa  NUOB_ACIC1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   23::159     4e-48  62%  169 aa  NUOB_CLOB8 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::153     4e-48  52%  226 aa  NUOB2_SALAI RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   17::155     4e-48  56%  179 aa  NUOB1_HERA2 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    3::153     5e-48  52%  226 aa  NUOB2_SALTO RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    3::150     3e-47  51%  184 aa  NUOB_RHOSR RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     3e-47  51%  184 aa  NUOB_RHOOB RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     3e-47  53%  184 aa  NUOB1_STRCO RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   14::161     3e-47  55%  171 aa  NUOB1_OPITP RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   24::166     3e-47  56%  174 aa  NUOB2_THEYD RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   15::163     5e-47  55%  175 aa  NUOB_HELMI RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::160     5e-47  56%  173 aa  NUOB_DESHY RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::160     5e-47  56%  173 aa  NUOB_DESHD RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::155     5e-47  53%  167 aa  NUOB1_ROSCS RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    3::150     6e-47  53%  184 aa  NUOB1_STRGG RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    8::162     8e-47  51%  182 aa  NUOB_FLAJ1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   11::185     1e-46  53%  251 aa  NUOB_RUBXD RecName: Full=NADH-quinone oxidoreductase subunit B;    
    8::154     1e-46  52%  167 aa  NUOB3_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit B 3; 
    8::154     1e-46  52%  167 aa  NUOB2_RHIME RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    8::154     1e-46  52%  167 aa  NUOB2_RHIE6 RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   16::158     1e-46  57%  169 aa  NUOB_WOLSU RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     1e-46  51%  184 aa  NUOB_MYCUA RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     1e-46  51%  184 aa  NUOB_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     1e-46  51%  184 aa  NUOB_MYCTA RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     1e-46  51%  184 aa  NUOB_MYCMM RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     1e-46  51%  184 aa  NUOB_MYCBT RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     1e-46  51%  184 aa  NUOB_MYCBP RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     1e-46  51%  184 aa  NUOB_MYCBO RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::155     1e-46  52%  167 aa  NUOB2_ROSS1 RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    3::150     1e-46  53%  184 aa  NUOB1_STRAW RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    3::150     2e-46  51%  184 aa  NUOB_MYCPA RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     2e-46  51%  184 aa  NUOB_MYCA1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   31::171     2e-46  57%  184 aa  NUOB2_SOLUE RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    7::160     2e-46  54%  174 aa  NUOB_RICBR RecName: Full=NADH-quinone oxidoreductase subunit B;    
    8::164     2e-46  54%  172 aa  NUOB_BREBN RecName: Full=NADH-quinone oxidoreductase subunit B;    
   12::166     2e-46  52%  193 aa  NUOB_AKKM8 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   24::157     3e-46  58%  172 aa  NUOB_SULNB RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::161     4e-46  50%  181 aa  NUOB_FLAPJ RecName: Full=NADH-quinone oxidoreductase subunit B;    
    4::161     4e-46  50%  181 aa  NUOB_DEIRA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   31::180     4e-46  56%  198 aa  NUOB_BACV8 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    6::167     4e-46  54%  199 aa  NUOB1_THEYD RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   24::156     5e-46  59%  169 aa  NUOB_NITSB RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::160     7e-46  54%  174 aa  NUOB_RICCK RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     7e-46  51%  184 aa  NUOB_RHOE4 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   20::157     7e-46  54%  186 aa  NUOB_LEPBL RecName: Full=NADH-quinone oxidoreductase subunit B;    
   20::157     7e-46  54%  186 aa  NUOB_LEPBJ RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     9e-46  51%  185 aa  NUOB_THEFY RecName: Full=NADH-quinone oxidoreductase subunit B;    
    2::160     9e-46  53%  171 aa  NUOB_RICTY RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::160     9e-46  53%  174 aa  NUOB_RICRS RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::160     9e-46  53%  174 aa  NUOB_RICRO RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::160     9e-46  53%  174 aa  NUOB_RICPU RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::160     9e-46  53%  174 aa  NUOB_RICCN RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::160     9e-46  53%  174 aa  NUOB_RICB8 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::160     9e-46  53%  174 aa  NUOB_RICAE RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     9e-46  51%  184 aa  NUOB_MYCA9 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    6::148     9e-46  54%  159 aa  NUOB_HELAH RecName: Full=NADH-quinone oxidoreductase subunit B;    
   45::192     9e-46  54%  235 aa  NUOB2_STRGG RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    2::160     1e-45  53%  174 aa  NUOB_RICPR RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::160     1e-45  53%  174 aa  NUOB_RICFE RecName: Full=NADH-quinone oxidoreductase subunit B;    
    8::157     1e-45  53%  166 aa  NUOB_MOOTA RecName: Full=NADH-quinone oxidoreductase subunit B;    
    6::148     1e-45  53%  159 aa  NUOB_HELPJ RecName: Full=NADH-quinone oxidoreductase subunit B;    
    6::148     1e-45  53%  159 aa  NUOB_HELPG RecName: Full=NADH-quinone oxidoreductase subunit B;    
    6::148     1e-45  53%  159 aa  NUOB_HELP2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   16::154     1e-45  57%  169 aa  NUOB_SULDN RecName: Full=NADH-quinone oxidoreductase subunit B;    
    6::148     1e-45  53%  159 aa  NUOB_HELPY RecName: Full=NADH-quinone oxidoreductase subunit B;    
    6::148     1e-45  53%  159 aa  NUOB_HELPS RecName: Full=NADH-quinone oxidoreductase subunit B;    
    6::148     1e-45  53%  159 aa  NUOB_HELPH RecName: Full=NADH-quinone oxidoreductase subunit B;    
   34::169     1e-45  59%  232 aa  NUOB2_STRCO RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   30::165     1e-45  59%  203 aa  NUOB2_STRAW RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   22::156     1e-45  56%  166 aa  NUOB1_SYMTH RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   14::164     3e-45  55%  170 aa  NUOB_GEOTN RecName: Full=NADH-quinone oxidoreductase subunit B;    
   14::164     3e-45  55%  170 aa  NUOB_GEOKA RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::160     3e-45  52%  174 aa  NUOB_RICM5 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   14::156     4e-45  53%  167 aa  NUOB_CAMJR RecName: Full=NADH-quinone oxidoreductase subunit B;    
   14::156     4e-45  53%  167 aa  NUOB_CAMJJ RecName: Full=NADH-quinone oxidoreductase subunit B;    
   14::156     4e-45  53%  167 aa  NUOB_CAMJE RecName: Full=NADH-quinone oxidoreductase subunit B;    
   14::156     4e-45  53%  167 aa  NUOB_CAMJD RecName: Full=NADH-quinone oxidoreductase subunit B;    
   14::156     4e-45  53%  167 aa  NUOB_CAMJ8 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   16::157     4e-45  55%  170 aa  NUOB_CAMC1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    5::151     6e-45  53%  185 aa  NUOB_PROAC RecName: Full=NADH-quinone oxidoreductase subunit B;    
   14::164     6e-45  55%  170 aa  NUOB_GEOSW RecName: Full=NADH-quinone oxidoreductase subunit B;    
   13::179     7e-45  50%  213 aa  NUOB_SALRD RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::160     7e-45  52%  181 aa  NUOB2_CYTH3 RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   64::210     7e-45  52%  213 aa  NDUS7_SOLTU RecName: Full=NADH-ubiquinone oxidoreductase 20 kDa
   18::162     1e-44  55%  187 aa  NUOB_MYXXD RecName: Full=NADH-quinone oxidoreductase subunit B;    
   23::157     1e-44  56%  186 aa  NUOB_LEPBP RecName: Full=NADH-quinone oxidoreductase subunit B;    
   23::157     1e-44  56%  186 aa  NUOB_LEPBA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   16::158     1e-44  51%  169 aa  NUOB_HELHP RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::164     1e-44  52%  172 aa  NUOB_BACWK RecName: Full=NADH-quinone oxidoreductase subunit B;    
   14::149     1e-44  59%  188 aa  NUOB1_SALTO RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   14::149     1e-44  59%  188 aa  NUOB1_SALAI RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    3::150     1e-44  49%  184 aa  NUOB_MYCSS RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     1e-44  49%  184 aa  NUOB_MYCSJ RecName: Full=NADH-quinone oxidoreductase subunit B;    
   16::158     1e-44  53%  169 aa  NUOB_CAMHC RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::171     1e-44  51%  177 aa  NUOB_ANOFW RecName: Full=NADH-quinone oxidoreductase subunit B;    
    2::162     2e-44  54%  166 aa  NUOB_CARHZ RecName: Full=NADH-quinone oxidoreductase subunit B;    
   24::157     2e-44  56%  170 aa  NUOB_CAMC5 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   22::171     2e-44  52%  179 aa  NUOB_BACHK RecName: Full=NADH-quinone oxidoreductase subunit B;    
   22::171     2e-44  52%  179 aa  NUOB_BACCZ RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::164     2e-44  52%  172 aa  NUOB_BACCR RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::164     2e-44  52%  172 aa  NUOB_BACCQ RecName: Full=NADH-quinone oxidoreductase subunit B;    
   10::164     2e-44  52%  172 aa  NUOB_BACCN RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::164     2e-44  52%  172 aa  NUOB_BACC7 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::164     2e-44  52%  172 aa  NUOB_BACC4 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::164     2e-44  52%  172 aa  NUOB_BACC3 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::164     2e-44  52%  172 aa  NUOB_BACC2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::164     2e-44  52%  172 aa  NUOB_BACC1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::164     2e-44  52%  172 aa  NUOB_BACC0 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::164     2e-44  52%  172 aa  NUOB_BACAN RecName: Full=NADH-quinone oxidoreductase subunit B;    
   22::171     2e-44  52%  179 aa  NUOB_BACAH RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::164     2e-44  52%  172 aa  NUOB_BACAC RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::164     2e-44  52%  172 aa  NUOB_BACAA RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::160     3e-44  51%  174 aa  NUOB_RICAH RecName: Full=NADH-quinone oxidoreductase subunit B;    
   12::149     3e-44  54%  186 aa  NUOB_LEPIN RecName: Full=NADH-quinone oxidoreductase subunit B;    
   12::149     3e-44  54%  186 aa  NUOB_LEPIC RecName: Full=NADH-quinone oxidoreductase subunit B;    
    4::151     3e-44  51%  202 aa  NUOB2_ACIBL RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    1::150     6e-44  52%  161 aa  NUOB_COXBU RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::150     6e-44  52%  161 aa  NUOB_COXBR RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::150     6e-44  52%  161 aa  NUOB_COXBN RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::150     6e-44  52%  161 aa  NUOB_COXB2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    1::150     6e-44  52%  161 aa  NUOB_COXB1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   13::152     8e-44  54%  163 aa  NUOB_PELPD RecName: Full=NADH-quinone oxidoreductase subunit B;    
   38::184     8e-44  58%  196 aa  NUOB_DESRM RecName: Full=NADH-quinone oxidoreductase subunit B;    
   25::166     8e-44  55%  191 aa  NUOB_AZOPC RecName: Full=NADH-quinone oxidoreductase subunit B;    
   10::172     8e-44  52%  250 aa  NUOB2_HERA2 RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   16::173     1e-43  50%  237 aa  NDHK_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   15::181     1e-43  48%  182 aa  NUOB1_ANADE RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    7::181     2e-43  46%  242 aa  NDHK_CHAGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   20::156     2e-43  55%  185 aa  NUOB_THERP RecName: Full=NADH-quinone oxidoreductase subunit B;    
   32::185     2e-43  52%  250 aa  NDHK_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   15::181     4e-43  48%  182 aa  NUOB2_ANASK RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   15::183     4e-43  48%  183 aa  NUOB2_ANADF RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    9::160     4e-43  53%  213 aa  NDHK_JASNU RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    3::150     5e-43  52%  158 aa  NUOB2_ACIF5 RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   32::182     5e-43  52%  280 aa  NDHK_STAPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::166     5e-43  52%  232 aa  NDHK1_GLOVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K
   13::156     7e-43  54%  178 aa  NUOB1_CYTH3 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    4::180     7e-43  48%  247 aa  NDHK_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
    9::160     7e-43  52%  238 aa  NDHK_CRYJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   46::196     9e-43  53%  200 aa  NUOB_DEHSC RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::181     9e-43  48%  182 aa  NUOB_ANAD2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::169     9e-43  48%  237 aa  NDHK_THEEB RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   20::177     9e-43  51%  244 aa  NDHK_PROM5 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   13::153     1e-42  56%  160 aa  NUOB_AMOA5 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::181     1e-42  49%  247 aa  NDHK_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   16::150     2e-42  54%  159 aa  NUOB_VESOH RecName: Full=NADH-quinone oxidoreductase subunit B;    
   46::196     2e-42  52%  200 aa  NUOB_DEHE1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   21::177     2e-42  50%  244 aa  NDHK_SYNS9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   19::176     2e-42  51%  242 aa  NDHK_SYNR3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
    4::175     2e-42  48%  245 aa  NDHK_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
    4::175     2e-42  48%  245 aa  NDHK_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   15::171     2e-42  50%  238 aa  NDHK1_CYAP4 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K
   16::150     2e-42  54%  159 aa  NUOB_RUTMC RecName: Full=NADH-quinone oxidoreductase subunit B;    
   20::177     2e-42  51%  244 aa  NDHK_PROMS RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   20::177     2e-42  51%  244 aa  NDHK_PROM9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   20::177     2e-42  51%  241 aa  NDHK_PROM2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   20::177     2e-42  51%  244 aa  NDHK_PROM0 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   53::207     2e-42  50%  274 aa  NDHK_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   19::152     3e-42  55%  160 aa  NUOB_POLSQ RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::152     3e-42  55%  160 aa  NUOB_POLNS RecName: Full=NADH-quinone oxidoreductase subunit B;    
   46::194     3e-42  53%  200 aa  NUOB_DEHSB RecName: Full=NADH-quinone oxidoreductase subunit B;    
   10::176     3e-42  49%  190 aa  NUOB_CHLPB RecName: Full=NADH-quinone oxidoreductase subunit B;    
    9::173     3e-42  50%  212 aa  NDHK_SOYBN RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::178     3e-42  50%  225 aa  NDHK_BARVE RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    3::153     3e-42  48%  220 aa  NUOB_SACEN RecName: Full=NADH-quinone oxidoreductase subunit B;    
   50::196     3e-42  53%  199 aa  NDUS7_CAEEL RecName: Full=Probable NADH dehydrogenase [ubiquinone]
   12::164     3e-42  52%  255 aa  NDHK_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   10::168     3e-42  50%  244 aa  NDHK_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
    9::160     3e-42  52%  227 aa  NDHK_PEA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    4::175     3e-42  48%  245 aa  NDHK_NOSP7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
    9::172     3e-42  50%  229 aa  NDHK_COFAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    3::150     4e-42  50%  158 aa  NUOB_THISH RecName: Full=NADH-quinone oxidoreductase subunit B;    
   11::172     4e-42  50%  182 aa  NUOB2_SORC5 RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   20::177     4e-42  51%  244 aa  NDHK_PROMP RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   29::177     4e-42  52%  250 aa  NDHK_PROM3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   21::175     4e-42  50%  246 aa  NDHK_PAUCH RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     4e-42  53%  227 aa  NDHK_MAIZE RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     4e-42  53%  225 aa  NDHK_HORVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    1::180     4e-42  47%  250 aa  NDHK_CYAP8 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
    9::160     6e-42  51%  225 aa  NDHK_DRANE RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   10::156     8e-42  53%  189 aa  NUOB_CHLTE RecName: Full=NADH-quinone oxidoreductase subunit B;    
   10::161     8e-42  53%  190 aa  NUOB_CHLCH RecName: Full=NADH-quinone oxidoreductase subunit B;    
   24::181     8e-42  52%  197 aa  NUOB_BACTN RecName: Full=NADH-quinone oxidoreductase subunit B;    
   31::179     8e-42  52%  246 aa  NDHK_SYNSC RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
    3::164     8e-42  50%  207 aa  NDHK_PSINU RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   42::190     8e-42  51%  252 aa  NDHK_PROM4 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
    9::160     8e-42  53%  225 aa  NDHK_ORYSJ RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     8e-42  53%  225 aa  NDHK_ORYSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     8e-42  53%  225 aa  NDHK_ORYSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     8e-42  53%  225 aa  NDHK_ORYNI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::178     8e-42  49%  225 aa  NDHK_OLIPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::178     8e-42  49%  225 aa  NDHK_NASOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::178     8e-42  50%  225 aa  NDHK_LOBMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::178     8e-42  49%  225 aa  NDHK_LEPVR RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::178     8e-42  49%  225 aa  NDHK_ARATH RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::178     8e-42  49%  229 aa  NDHK_AETCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   31::179     1e-41  52%  246 aa  NDHK_SYNPX RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   34::183     1e-41  51%  248 aa  NDHK_SYNPW RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   10::168     1e-41  50%  244 aa  NDHK_SYNJB RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   29::177     1e-41  51%  250 aa  NDHK_PROMM RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
    9::160     1e-41  52%  212 aa  NDHK_PHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     1e-41  52%  225 aa  NDHK_LEMMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    1::180     1e-41  46%  247 aa  NDHK_CYAP7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   27::178     1e-41  49%  250 aa  NDHK_ANGEV RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   18::166     1e-41  51%  232 aa  NDHK1_ACAM1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K
   10::161     1e-41  52%  190 aa  NUOB_PROA2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   21::177     1e-41  48%  242 aa  NDHK_PROMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
    9::178     1e-41  49%  225 aa  NDHK_CAPBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::178     1e-41  49%  229 aa  NDHK_AETGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    1::152     2e-41  47%  177 aa  NUOB_HYDS0 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    4::150     2e-41  48%  179 aa  NUOB_AQUAE RecName: Full=NADH-quinone oxidoreductase subunit B;    
    9::160     2e-41  51%  225 aa  NDHK_TOBAC RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   37::185     2e-41  51%  253 aa  NDHK_SYNS3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
    9::160     2e-41  51%  229 aa  NDHK_PIPCE RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   32::181     2e-41  51%  261 aa  NDHK_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     2e-41  51%  225 aa  NDHK_NICTO RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     2e-41  51%  225 aa  NDHK_NICSY RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     2e-41  51%  235 aa  NDHK_IPOPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     2e-41  51%  225 aa  NDHK_GOSHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     2e-41  51%  225 aa  NDHK_GOSBA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     2e-41  51%  225 aa  NDHK_CARPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     2e-41  51%  225 aa  NDHK_ATRBE RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     2e-41  51%  225 aa  NDHK_ARAHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    3::150     2e-41  51%  158 aa  NUOB_METFK RecName: Full=NADH-quinone oxidoreductase subunit B;    
   29::165     2e-41  52%  194 aa  NUOB1_SORC5 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   18::169     2e-41  50%  235 aa  NDHK_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   27::176     2e-41  51%  243 aa  NDHK_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   18::169     2e-41  50%  235 aa  NDHK_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
    9::160     2e-41  52%  227 aa  NDHK_SPIOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   15::182     2e-41  45%  243 aa  NDHK_MARPO RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     2e-41  51%  225 aa  NDHK_CALFG RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    3::150     3e-41  52%  159 aa  NUOB_VEREI RecName: Full=NADH-quinone oxidoreductase subunit B;    
    9::160     3e-41  52%  225 aa  NDHK_WHEAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     3e-41  52%  227 aa  NDHK_SORBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     3e-41  52%  227 aa  NDHK_SACOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     3e-41  52%  227 aa  NDHK_SACHY RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   28::182     3e-41  48%  249 aa  NDHK_PROMT RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
   28::182     3e-41  48%  249 aa  NDHK_PROM1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
    9::160     3e-41  52%  225 aa  NDHK_LOLPR RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   10::163     3e-41  51%  225 aa  NDHK_LACSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    7::163     3e-41  52%  225 aa  NDHK_HELAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    7::163     3e-41  52%  225 aa  NDHK_GUIAB RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     3e-41  51%  225 aa  NDHK_DIOEL RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   15::180     3e-41  48%  247 aa  NDHK_CYAA5 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
    9::178     3e-41  49%  225 aa  NDHK_CRUWA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     3e-41  52%  225 aa  NDHK_BRADI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     3e-41  52%  225 aa  NDHK_AGRST RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    3::150     4e-41  47%  184 aa  NUOB_NOCSJ RecName: Full=NADH-quinone oxidoreductase subunit B;    
   10::156     4e-41  52%  189 aa  NUOB_CHLP8 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    4::157     4e-41  52%  195 aa  NUOB2_CHLT3 RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    9::160     4e-41  51%  225 aa  NDHK_PANGI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     4e-41  51%  225 aa  NDHK_NUPAD RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     4e-41  51%  225 aa  NDHK_EUCGG RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     4e-41  51%  225 aa  NDHK_DAUCA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   12::185     5e-41  49%  189 aa  NUOB_PELPB RecName: Full=NADH-quinone oxidoreductase subunit B;    
   12::184     5e-41  49%  189 aa  NUOB_PELLD RecName: Full=NADH-quinone oxidoreductase subunit B;    
   22::180     5e-41  47%  182 aa  NDUS7_RECAM RecName: Full=NADH-ubiquinone oxidoreductase 20 kDa
    5::172     5e-41  49%  240 aa  NDHK_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K; 
    7::180     5e-41  49%  226 aa  NDHK_LUPLU RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     5e-41  50%  230 aa  NDHK_LOTJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     5e-41  51%  239 aa  NDHK_ACOCL RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     5e-41  51%  239 aa  NDHK_ACOAM RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   30::179     5e-41  50%  248 aa  NDHK1_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K
   11::156     6e-41  53%  189 aa  NUOB_PROVI RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     6e-41  47%  184 aa  NUOB_NOCFA RecName: Full=NADH-quinone oxidoreductase subunit B;    
    9::160     6e-41  51%  225 aa  NDHK_SOLTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     6e-41  51%  225 aa  NDHK_SOLLC RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     6e-41  51%  225 aa  NDHK_SOLBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     6e-41  51%  227 aa  NDHK_RANMC RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     6e-41  51%  227 aa  NDHK_PELHO RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    8::173     6e-41  50%  225 aa  NDHK_FAGEA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   34::183     6e-41  50%  244 aa  NDHK_CHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   28::178     6e-41  48%  247 aa  NDHK_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   12::161     8e-41  52%  189 aa  NUOB_CHLL2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    9::160     8e-41  51%  225 aa  NDHK_VITVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     8e-41  51%  261 aa  NDHK_CYCTA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   12::185     1e-40  48%  189 aa  NUOB_CHLPD RecName: Full=NADH-quinone oxidoreductase subunit B;    
   16::160     1e-40  52%  225 aa  NDHK_NYMAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     1e-40  50%  225 aa  NDHK_LIRTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     1e-40  50%  227 aa  NDHK_DRIGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     1e-40  51%  226 aa  NDHK_CUCSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    6::171     1e-40  48%  249 aa  NDHK2_GLOVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K
    9::160     1e-40  50%  225 aa  NDHK_PLAOC RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     1e-40  51%  225 aa  NDHK_OENPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     1e-40  51%  225 aa  NDHK_OENGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     1e-40  51%  225 aa  NDHK_OENEH RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     1e-40  51%  225 aa  NDHK_OENBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     1e-40  51%  225 aa  NDHK_OENAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    7::160     1e-40  51%  225 aa  NDHK_NANDO RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   16::170     1e-40  51%  209 aa  NDHK2_ACAM1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K
    9::160     2e-40  51%  225 aa  NDHK_MANES RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   30::181     2e-40  49%  263 aa  NDHK_HUPLU RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   10::160     2e-40  50%  222 aa  NDHK_CHLSC RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     2e-40  49%  225 aa  NDHK_ILLOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     2e-40  49%  200 aa  NDHK_BUXMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    9::160     2e-40  50%  225 aa  NDHK_AMBTC RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   19::150     3e-40  53%  158 aa  NUOB_HALHL RecName: Full=NADH-quinone oxidoreductase subunit B;    
   23::160     3e-40  54%  227 aa  NDHK_CITSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    7::160     3e-40  51%  228 aa  NDHK_CERDE RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   34::193     4e-40  48%  201 aa  NUOB1_RHOPB RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   20::166     4e-40  58%  172 aa  NUOB1_ANADF RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    5::150     5e-40  51%  159 aa  NUOB_ACIAC RecName: Full=NADH-quinone oxidoreductase subunit B;    
    5::155     5e-40  47%  174 aa  NUOB2_CHLSY RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    5::155     5e-40  47%  174 aa  NUOB2_CHLAA RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    5::155     5e-40  47%  174 aa  NUOB1_CHLAD RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    5::150     7e-40  51%  159 aa  NUOB_DIAST RecName: Full=NADH-quinone oxidoreductase subunit B;    
    5::150     7e-40  51%  159 aa  NUOB_ACISJ RecName: Full=NADH-quinone oxidoreductase subunit B;    
   33::192     7e-40  48%  200 aa  NUOB2_RHOP5 RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    9::160     7e-40  49%  227 aa  NDHK_TRACE RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   13::172     7e-40  47%  219 aa  NDHK2_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K
    3::150     9e-40  45%  184 aa  NUOB_MYCS2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   38::171     9e-40  54%  187 aa  NUOB_DESVM RecName: Full=NADH-quinone oxidoreductase subunit B;    
    5::150     2e-39  51%  159 aa  NUOB_DELAS RecName: Full=NADH-quinone oxidoreductase subunit B;    
   32::186     2e-39  50%  194 aa  NUOB_XANP2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   27::175     2e-39  48%  178 aa  NDUS7_DICDI RecName: Full=NADH dehydrogenase [ubiquinone]
    5::136     3e-39  48%  171 aa  NUOB_SULSY RecName: Full=NADH-quinone oxidoreductase subunit B;    
   30::184     3e-39  50%  192 aa  NUOB_AZOC5 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   20::172     3e-39  54%  173 aa  NUOB1_ANASK RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   64::210     3e-39  49%  213 aa  NDUS7_PONAB RecName: Full=NADH dehydrogenase [ubiquinone]
   64::210     3e-39  49%  213 aa  NDUS7_PANTR RecName: Full=NADH dehydrogenase [ubiquinone]
   64::210     3e-39  49%  213 aa  NDUS7_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone]
   64::210     3e-39  49%  213 aa  NDUS7_GORGO RecName: Full=NADH dehydrogenase [ubiquinone]
   23::160     3e-39  54%  225 aa  NDHK_POPTR RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   23::160     3e-39  54%  225 aa  NDHK_POPAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
    3::150     3e-39  45%  184 aa  NUOB_MYCGI RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     5e-39  45%  184 aa  NUOB_MYCVP RecName: Full=NADH-quinone oxidoreductase subunit B;    
    4::169     5e-39  46%  259 aa  NDHK2_CYAP4 RecName: Full=NAD(P)H-quinone oxidoreductase subunit K
   20::172     6e-39  54%  173 aa  NUOB2_ANADE RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   66::212     6e-39  48%  215 aa  NDUS7_BRAOL RecName: Full=NADH-ubiquinone oxidoreductase 20 kDa
   47::213     6e-39  44%  216 aa  NDUS7_BOVIN RecName: Full=NADH dehydrogenase [ubiquinone]
   19::166     1e-38  46%  171 aa  NUOB_ORITI RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::166     1e-38  46%  171 aa  NUOB_ORITB RecName: Full=NADH-quinone oxidoreductase subunit B;    
   17::176     1e-38  48%  183 aa  NUOB_DESDA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   13::148     1e-38  51%  156 aa  NDUS7_PARTE RecName: Full=NADH-ubiquinone oxidoreductase 20 kDa
   19::150     1e-38  57%  159 aa  NUOB2_AZOSB RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   69::215     1e-38  48%  218 aa  NDUS7_ARATH RecName: Full=NADH-ubiquinone oxidoreductase 20 kDa
   77::221     2e-38  48%  224 aa  NDUS7_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone]
   21::162     4e-38  49%  167 aa  NUOB_NEOSM RecName: Full=NADH-quinone oxidoreductase subunit B;    
   30::185     4e-38  48%  194 aa  NUOB_GRABC RecName: Full=NADH-quinone oxidoreductase subunit B;    
   16::161     7e-38  48%  178 aa  NUOB_DEIGD RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::156     9e-38  49%  167 aa  NUOB_MAGSM RecName: Full=NADH-quinone oxidoreductase subunit B;    
   24::153     9e-38  54%  171 aa  NUOB2_CHRVO RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   23::182     1e-37  46%  191 aa  NUOB2_GLUDA RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   17::158     1e-37  49%  181 aa  NQO6_THET8 RecName: Full=NADH-quinone oxidoreductase subunit 6;    
   17::158     1e-37  49%  181 aa  NQO6_THET2 RecName: Full=NADH-quinone oxidoreductase subunit 6;    
   26::186     2e-37  47%  194 aa  NUOB_AGRT5 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   22::177     3e-37  44%  185 aa  NUOB_RHORT RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::150     3e-37  50%  159 aa  NUOB_RHOFD RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     3e-37  46%  158 aa  NUOB_NITEC RecName: Full=NADH-quinone oxidoreductase subunit B;    
   36::178     3e-37  49%  186 aa  NUOB_MAGSA RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     3e-37  46%  158 aa  NUOB_NITEU RecName: Full=NADH-quinone oxidoreductase subunit B;    
   30::190     7e-37  43%  194 aa  NUOB_RHOCS RecName: Full=NADH-quinone oxidoreductase subunit B;    
   53::185     7e-37  52%  193 aa  NUOB_PHEZH RecName: Full=NADH-quinone oxidoreductase subunit B;    
    2::165     1e-36  43%  175 aa  NUOB_ANAMM RecName: Full=NADH-quinone oxidoreductase subunit B;    
   17::180     1e-36  43%  190 aa  NUOB_ANAMF RecName: Full=NADH-quinone oxidoreductase subunit B;    
   56::190     1e-36  50%  202 aa  NDUS7_TRYBB RecName: Full=NADH dehydrogenase [ubiquinone]
   19::153     1e-36  49%  158 aa  NUOB_METPP RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::150     1e-36  47%  158 aa  NUOB2_NITMU RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   16::150     2e-36  51%  158 aa  NUOB_AZOSE RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     4e-36  46%  158 aa  NUOB_JANMA RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     4e-36  46%  158 aa  NUOB_HERAR RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     5e-36  46%  158 aa  NUOB_ACIF2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   16::150     5e-36  50%  158 aa  NUOB1_AZOSB RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    3::150     5e-36  46%  158 aa  NUOB1_ACIF5 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   18::177     5e-36  45%  186 aa  NUOB1_ACICJ RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    6::150     6e-36  48%  159 aa  NUOB_VARPS RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     6e-36  45%  158 aa  NUOB_THICR RecName: Full=NADH-quinone oxidoreductase subunit B;    
    5::155     6e-36  48%  158 aa  NUOB_LEGPC RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::167     6e-36  48%  172 aa  NUOB_EHRRW RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::167     6e-36  48%  172 aa  NUOB_EHRRG RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     6e-36  51%  159 aa  NUOB_BURVG RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     6e-36  51%  159 aa  NUOB_BURTA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     6e-36  51%  159 aa  NUOB_BURS3 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     6e-36  51%  159 aa  NUOB_BURM1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     6e-36  51%  159 aa  NUOB_BURCM RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     6e-36  51%  159 aa  NUOB_BURCJ RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     6e-36  51%  159 aa  NUOB_BURCH RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     6e-36  51%  159 aa  NUOB_BURCC RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     6e-36  51%  159 aa  NUOB_BURCA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     6e-36  51%  159 aa  NUOB_BURA4 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     6e-36  51%  159 aa  NUOB1_BURPS RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   19::150     6e-36  51%  159 aa  NUOB1_BURP6 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   19::150     6e-36  51%  159 aa  NUOB1_BURP1 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   19::150     6e-36  51%  159 aa  NUOB1_BURP0 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   19::150     6e-36  51%  159 aa  NUOB1_BURMS RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   19::150     6e-36  51%  159 aa  NUOB1_BURMA RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   19::150     6e-36  51%  159 aa  NUOB1_BURM9 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   19::150     6e-36  51%  159 aa  NUOB1_BURM7 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    3::150     8e-36  46%  160 aa  NUOB_RALEJ RecName: Full=NADH-quinone oxidoreductase subunit B;    
    6::150     8e-36  48%  159 aa  NUOB_POLNA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::153     8e-36  48%  158 aa  NUOB_LEPCP RecName: Full=NADH-quinone oxidoreductase subunit B;    
   27::167     8e-36  46%  179 aa  NUOB_EHRCR RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     8e-36  50%  158 aa  NUOB_ALHEH RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     8e-36  44%  158 aa  NUOB2_NITOC RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
    3::150     1e-35  45%  160 aa  NUOB_RALME RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     1e-35  45%  160 aa  NUOB_RALEH RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     1e-35  46%  159 aa  NUOB_POLSJ RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     1e-35  45%  160 aa  NUOB_CUPTR RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     1e-35  46%  160 aa  NUOB_RALSO RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     1e-35  46%  160 aa  NUOB_RALPJ RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     1e-35  50%  159 aa  NUOB_BURXL RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     1e-35  50%  159 aa  NUOB_BURPP RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     1e-35  50%  159 aa  NUOB_BURP8 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     2e-35  46%  158 aa  NUOB_LARHH RecName: Full=NADH-quinone oxidoreductase subunit B;    
   80::223     2e-35  46%  226 aa  NDUS7_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase 19.3 kDa
   19::150     3e-35  50%  158 aa  NUOB1_CHRVO RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
    7::180     4e-35  43%  184 aa  NUOB_XYLFT RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::180     4e-35  43%  184 aa  NUOB_XYLF2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::176     4e-35  48%  184 aa  NUOB_XANCP RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::176     4e-35  48%  184 aa  NUOB_XANCB RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::176     4e-35  48%  184 aa  NUOB_XANC8 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     4e-35  46%  160 aa  NUOB_NEIMF RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     4e-35  46%  160 aa  NUOB_NEIMB RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     4e-35  46%  160 aa  NUOB_NEIG2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
    5::155     4e-35  47%  158 aa  NUOB_LEGPL RecName: Full=NADH-quinone oxidoreductase subunit B;    
    5::155     4e-35  47%  158 aa  NUOB_LEGPH RecName: Full=NADH-quinone oxidoreductase subunit B;    
    5::155     4e-35  47%  158 aa  NUOB_LEGPA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::164     4e-35  47%  174 aa  NUOB_ANAPZ RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::176     5e-35  44%  184 aa  NUOB_XYLFM RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::176     5e-35  44%  184 aa  NUOB_XYLFA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::176     7e-35  48%  184 aa  NUOB_STRMK RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::176     7e-35  48%  184 aa  NUOB_STRM5 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::176     9e-35  47%  184 aa  NUOB_XANOR RecName: Full=NADH-quinone oxidoreductase subunit B;    
   24::174     9e-35  47%  182 aa  NUOB_XANOP RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::176     9e-35  47%  184 aa  NUOB_XANOM RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::176     9e-35  47%  184 aa  NUOB_XANC5 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::176     9e-35  47%  184 aa  NUOB_XANAC RecName: Full=NADH-quinone oxidoreductase subunit B;    
   14::169     1e-34  45%  177 aa  NUOB_ROSDO RecName: Full=NADH-quinone oxidoreductase subunit B;    
   31::190     1e-34  45%  198 aa  NUOB_OLICO RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     1e-34  46%  160 aa  NUOB_NEIG1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   40::161     1e-34  56%  226 aa  NDHK_MORIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit K,
   25::166     2e-34  48%  168 aa  NUOB_WOLWR RecName: Full=NADH-quinone oxidoreductase subunit B;    
   25::166     2e-34  48%  168 aa  NUOB_WOLPM RecName: Full=NADH-quinone oxidoreductase subunit B;    
   31::179     2e-34  48%  187 aa  NUOB_SPHWW RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::149     2e-34  46%  158 aa  NUOB_FRAP2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   27::186     2e-34  45%  194 aa  NUOB_BRASB RecName: Full=NADH-quinone oxidoreductase subunit B;    
   20::150     2e-34  48%  158 aa  NUOB_BORPD RecName: Full=NADH-quinone oxidoreductase subunit B;    
   30::165     2e-34  46%  167 aa  NUOB_WOLPP RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::149     2e-34  46%  158 aa  NUOB_FRATW RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::149     2e-34  46%  158 aa  NUOB_FRATT RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::149     2e-34  46%  158 aa  NUOB_FRATO RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::149     2e-34  46%  158 aa  NUOB_FRATN RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::149     2e-34  46%  158 aa  NUOB_FRATM RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::149     2e-34  46%  158 aa  NUOB_FRATH RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::149     2e-34  46%  158 aa  NUOB_FRATF RecName: Full=NADH-quinone oxidoreductase subunit B;    
    7::149     2e-34  46%  158 aa  NUOB_FRAT1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::150     2e-34  48%  158 aa  NUOB_DECAR RecName: Full=NADH-quinone oxidoreductase subunit B;    
   25::162     3e-34  47%  168 aa  NUOB_WOLTR RecName: Full=NADH-quinone oxidoreductase subunit B;    
   15::150     3e-34  47%  158 aa  NUOB_THIDA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   20::150     3e-34  48%  158 aa  NUOB_BORA1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::154     3e-34  53%  167 aa  NUOB2_BURP1 RecName: Full=Putative NADH-quinone oxidoreductase
   19::169     3e-34  47%  177 aa  NUOB_SPHAL RecName: Full=NADH-quinone oxidoreductase subunit B;    
   11::166     3e-34  45%  174 aa  NUOB_SILST RecName: Full=NADH-quinone oxidoreductase subunit B;    
    3::150     3e-34  46%  160 aa  NUOB_NEIMA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   31::179     3e-34  47%  187 aa  NUOB_ERYLH RecName: Full=NADH-quinone oxidoreductase subunit B;    
   40::199     4e-34  45%  207 aa  NUOB_NITWN RecName: Full=NADH-quinone oxidoreductase subunit B;    
   20::150     4e-34  48%  158 aa  NUOB_BORPE RecName: Full=NADH-quinone oxidoreductase subunit B;    
   20::150     4e-34  48%  158 aa  NUOB_BORPA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   20::150     4e-34  48%  158 aa  NUOB_BORBR RecName: Full=NADH-quinone oxidoreductase subunit B;    
   35::194     6e-34  45%  202 aa  NUOB_NITHX RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::185     6e-34  44%  193 aa  NUOB_BRASO RecName: Full=NADH-quinone oxidoreductase subunit B;    
   35::194     6e-34  44%  202 aa  NUOB_BRAJA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   14::169     1e-33  44%  177 aa  NUOB_SILPO RecName: Full=NADH-quinone oxidoreductase subunit B;    
   23::173     1e-33  46%  181 aa  NUOB_NOVAD RecName: Full=NADH-quinone oxidoreductase subunit B;    
   39::185     1e-33  45%  193 aa  NUOB_CAUCR RecName: Full=NADH-quinone oxidoreductase subunit B;    
   46::192     1e-33  45%  200 aa  NUOB_CAUCN RecName: Full=NADH-quinone oxidoreductase subunit B;    
   43::188     2e-33  45%  196 aa  NUOB_CAUSK RecName: Full=NADH-quinone oxidoreductase subunit B;    
   12::167     2e-33  44%  175 aa  NQO6_PARDP RecName: Full=NADH-quinone oxidoreductase subunit 6;    
   17::165     2e-33  46%  173 aa  NUOB_PELUB RecName: Full=NADH-quinone oxidoreductase subunit B;    
   24::190     2e-33  45%  198 aa  NUOB1_RHOPT RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   24::190     2e-33  45%  198 aa  NUOB1_RHOPA RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   37::183     3e-33  44%  191 aa  NUOB_PARL1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   31::185     4e-33  46%  193 aa  NUOB_AGRRK RecName: Full=NADH-quinone oxidoreductase subunit B;    
   25::191     4e-33  45%  199 aa  NUOB2_RHOPS RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   26::154     4e-33  51%  167 aa  NUOB2_BURPS RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   26::154     4e-33  51%  167 aa  NUOB2_BURP6 RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   26::154     4e-33  51%  167 aa  NUOB2_BURP0 RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   26::154     4e-33  51%  167 aa  NUOB2_BURMS RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   26::154     4e-33  51%  167 aa  NUOB2_BURMA RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   26::154     4e-33  51%  167 aa  NUOB2_BURM9 RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   26::154     4e-33  51%  167 aa  NUOB2_BURM7 RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   15::166     4e-33  45%  174 aa  NUOB1_RHOSK RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   15::166     4e-33  45%  174 aa  NUOB1_RHOS4 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   17::168     4e-33  45%  176 aa  NUOB1_RHOS1 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   11::163     4e-33  44%  173 aa  NQO6_PARDE RecName: Full=NADH-quinone oxidoreductase subunit 6;    
   19::185     5e-33  44%  193 aa  NUOB_RHILO RecName: Full=NADH-quinone oxidoreductase subunit B;    
   32::186     5e-33  45%  194 aa  NUOB_RHIL3 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   14::169     5e-33  44%  177 aa  NUOB_JANSC RecName: Full=NADH-quinone oxidoreductase subunit B;    
   20::179     6e-33  43%  187 aa  NUOB_METSB RecName: Full=NADH-quinone oxidoreductase subunit B;    
   36::185     8e-33  44%  190 aa  NUOB_HYPNA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   38::183     1e-32  45%  188 aa  NUOB_MARMM RecName: Full=NADH-quinone oxidoreductase subunit B;    
   14::169     1e-32  44%  177 aa  NUOB_DINSH RecName: Full=NADH-quinone oxidoreductase subunit B;    
   27::169     1e-32  45%  177 aa  NUOB_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit B;    
   13::178     1e-32  42%  186 aa  NUOB2_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   44::186     2e-32  44%  194 aa  NUOB_RHILW RecName: Full=NADH-quinone oxidoreductase subunit B;    
   16::182     2e-32  42%  190 aa  NUOB_MESSB RecName: Full=NADH-quinone oxidoreductase subunit B;    
   44::186     2e-32  44%  194 aa  NUOB1_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   44::186     2e-32  44%  194 aa  NUOB1_RHIE6 RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   19::185     3e-32  44%  193 aa  NUOB_BARBK RecName: Full=NADH-quinone oxidoreductase subunit B;    
   14::178     3e-32  46%  182 aa  NUOB2_SYMTH RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   26::172     4e-32  43%  180 aa  NUOB_BEII9 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   42::184     4e-32  44%  192 aa  NUOB1_RHIME RecName: Full=NADH-quinone oxidoreductase subunit B 1; 
   32::187     5e-32  44%  195 aa  NUOB_METS4 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   34::189     5e-32  44%  197 aa  NUOB_METNO RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::185     2e-31  44%  193 aa  NUOB_BARHE RecName: Full=NADH-quinone oxidoreductase subunit B;    
   42::184     2e-31  44%  192 aa  NUOB_SINMW RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::185     2e-31  43%  193 aa  NUOB_BART1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   55::187     3e-31  46%  195 aa  NUOB_METRJ RecName: Full=NADH-quinone oxidoreductase subunit B;    
   19::185     3e-31  43%  193 aa  NUOB_BARQU RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::185     4e-31  41%  193 aa  NUOB_OCHA4 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   55::187     4e-31  46%  195 aa  NUOB_METPB RecName: Full=NADH-quinone oxidoreductase subunit B;    
   55::187     4e-31  46%  195 aa  NUOB_METEP RecName: Full=NADH-quinone oxidoreductase subunit B;    
   55::187     4e-31  46%  195 aa  NUOB_METC4 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::185     4e-31  42%  193 aa  NUOB_BRUSU RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::185     4e-31  42%  193 aa  NUOB_BRUSI RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::185     4e-31  42%  193 aa  NUOB_BRUO2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::185     4e-31  42%  193 aa  NUOB_BRUME RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::185     4e-31  42%  193 aa  NUOB_BRUMB RecName: Full=NADH-quinone oxidoreductase subunit B;    
   26::185     4e-31  42%  193 aa  NUOB_BRUC2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   24::156     4e-31  46%  174 aa  NUOB2_RHOS5 RecName: Full=NADH-quinone oxidoreductase subunit B 2; 
   54::185     6e-31  47%  193 aa  NUOB_BRUAB RecName: Full=NADH-quinone oxidoreductase subunit B;    
   54::185     6e-31  47%  193 aa  NUOB_BRUA2 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   54::185     6e-31  47%  193 aa  NUOB_BRUA1 RecName: Full=NADH-quinone oxidoreductase subunit B;    
   30::187     5e-30  45%  195 aa  NUOB_AGRVS RecName: Full=NADH-quinone oxidoreductase subunit B;    
   47::201     7e-22  40%  255 aa  HYCG_ECOLI RecName: Full=Formate hydrogenlyase subunit 7;       
   20::129     6e-21  40%  148 aa  Y516_METJA RecName: Full=Uncharacterized protein MJ0516;
   43::163     4e-20  42%  252 aa  HYFI_ECOLI RecName: Full=Hydrogenase-4 component I;       
   20::134     6e-17  43%  151 aa  Y1363_METJA RecName: Full=Uncharacterized protein MJ1363;
   52::134     7e-06  33%  230 aa  FRHG_METJA RecName: Full=Coenzyme F420 hydrogenase subunit gamma;  
   53::164     9e-06  35%  259 aa  FRHG_METBF RecName: Full=Coenzyme F420 hydrogenase subunit gamma;  
   56::162     1e-04  30%  236 aa  FRHG_METTH RecName: Full=Coenzyme F420 hydrogenase subunit gamma;  
   59::152     2e-04  33%  243 aa  FRHG_METVO RecName: Full=Coenzyme F420 hydrogenase subunit gamma;  
   65::167     3e-04  34%  308 aa  MVHG_METTH RecName: Full=F420-non-reducing hydrogenase subunit G;  
   79::181     8e-04  29%  288 aa  VHUG_METJA RecName: Full=F420-non-reducing hydrogenase vhu subunit
    1::220

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SALTY      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SALTI      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SALSV      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SALPK      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SALPC      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SALPB      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SALPA      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SALNS      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SALHS      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SALG2      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SALEP      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SALDC      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SALCH      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SALAR      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SALA4      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SHISS      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SHIFL      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SHIF8      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SHIBS      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SHIB3      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ESCF3      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECOUT      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECOSM      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECOSE      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECOLU      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECOLI      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECOLC      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECOL6      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECOL5      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECOK1      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECOHS      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECODH      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECOBW      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECO8A      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECO81      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECO7I      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECO5E      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECO57      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECO55      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECO45      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECO27      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ECO24      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SHIDS      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_KLEP7      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKSVYMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_KLEP3      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKSVYMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_CITK8      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEINKSVYMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ENT38      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEINKSVYMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_SERP5      MDYTLTRIDPNGENDRYPLQKQEVVADPLDQQVHRTVYMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
NUOB_ENTS8      MDYTLTRIDPDGENDRYPLQKQEIVTDPLEQHVHRSVYMGKLHDMVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_PHOLL      MDYTLTRIDPNGENDRYPLQKQEIVADPLEQHVHRSVYMGKLHDMVNWGRKNSLWPYNFGLSCCYVEMAT
NUOB_EDWI9      MDYTLTRIDPDGDNDRYPLQKQEVVSDPLEQHVHRSVYMGKLHDMVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_PROMH      MDYTLTRIDPNGENDRYPLQSQEIVSDPLDAHVHRSVYMGKLHDVVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_YERPY      MDYTLTRIDPNGENDRYPLQTQETVSDPLEQHVHRSVYMGKLHDMVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_YERPS      MDYTLTRIDPNGENDRYPLQTQETVSDPLEQHVHRSVYMGKLHDMVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_YERPP      MDYTLTRIDPNGENDRYPLQTQETVSDPLEQHVHRSVYMGKLHDMVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_YERPN      MDYTLTRIDPNGENDRYPLQTQETVSDPLEQHVHRSVYMGKLHDMVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_YERPG      MDYTLTRIDPNGENDRYPLQTQETVSDPLEQHVHRSVYMGKLHDMVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_YERPE      MDYTLTRIDPNGENDRYPLQTQETVSDPLEQHVHRSVYMGKLHDMVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_YERPB      MDYTLTRIDPNGENDRYPLQTQETVSDPLEQHVHRSVYMGKLHDMVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_YERPA      MDYTLTRIDPNGENDRYPLQTQETVSDPLEQHVHRSVYMGKLHDMVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_YERE8      MDYTLTRIDPNGENDRYPLQTQETVSDPLEQHVHRSVYMGKLHDMVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_ERWT9      MDYTLTRIDPNGENDRYPLQKQEIVTDPLEKHVYQNVYMGKLHDMVNWGRKNSLWPFNFGLSCCYVEMTT
NUOB_PECCP      MDYTLTRIEPDGENDRYPLQRQEIVSDPLEQHVHRSVYMGKLHDTVNWGRQNSLWPYNFGLSCCYVEMVT
NUOB_PECCC      MDYTLTRIEPDGENDRYPLQRQEIVSDPLEQHVHRSVYMGKLHDTVNWGRQNSLWPYNFGLSCCYVEMVT
NUOB_ERWCT      MDYTLTRIEPDGENDRYPLQRQEIVSDPLEQHVHRSVYMGKLHDTVNWGRQNSLWPYNFGLSCCYVEMVT
NUOB_YERP3      MDYTLTRIDPNGENDRYPLQTQETVSDPLEQHVHRSVYMGKLHDMVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_SODGM      MDYTLTRAEPDGDNERYPLQKQEIVADPLEQHVHRSVYLGKLHNAVNWGRGNSLWPYNFGLSCCYVEMTT
NUOB_PSEFS      MQYNLTRIDPDAPNDQYPIGERETVSDPLEDQVHKNIYMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_PSEPF      MQYNLTRIDPDAPNEQYPIGQRETVSDPLEDQVHKNIFMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_PSEU2      MQYNLTRIDPDAPNEQYPIGKRETVSDPLEDQVHKNIYMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_PSESM      MQYNLTRIDPDAPNEQYPIGKRETVSDPLEDQVHKNIYMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_PSE14      MQYNLTRIDPDAPNEQYPIGKRETVSDPLEDQVHKNIYMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_PSEF5      MQYNLTRIDPDAPNDQYPIGERETVSDPLEDQVHKNIFMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_PSEMY      MQYKLTRVDPNAPNEAYPIGQRELVSDPLEDQVHKNIYMGKLEEVINWGRKNSLWPYNFGLSCCYVEMTT
NUOB_PSEA7      MQYKLTRIDPDAANDQYPIGERETVADPLEGQVHKNIFMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_PSEAE      MQYKLTRIDPDAANDQYPIGERETVADPLEGQVHKNIFMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_PSEAB      MQYKLTRIDPDAANDQYPIGERETVADPLEGQVHKNIFMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_PSEA8      MQYKLTRIDPDAANDQYPIGERETVADPLEGQVHKNIFMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_AZOVD      MQYKLTRIDPDASYEQYPIGERETVTDPSEGQVHRNIFMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_PSEPK      MQYNLTRIDPDAPNEQYPVGERETVTDQLEDQVHKNIFMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_PSEP1      MQYNLTRIDPDAPNEQYPVGERETVTDQLEDQVHKNIFMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_SHEON      MKYTLTRIDPDAPVERYPQEQRQTVDDPLAQEATRGIMMGRLEDTVNWGRKNSLWPYNFGISCCYVEMCT
NUOB_PSEPG      MQYNLTRIDPDAPNEQYPVGERETVTDQLEDQVHKNIYMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_PSEE4      MQYNLTRIDPDAPNEQYPVGERETVTDQLEDQVHKNIYMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_PSEPW      MQYNLTRIDPDAPNEQYPVGERETVTDQLEDQVHKNIYMGKLEDVVNWGRKNSLWPYNFGLSCCYVEMTT
NUOB_AERS4      MKYTLTRIDPDAPVERYPQEQSQTVDDPLAQDATRGIMMGRLEDTVNWGRKNSLWPYNFGISCCYVEMCT
NUOB_AERHH      MKYTLTRIDPDAPVERYPQEQRQTVEDPLAQEASRGIMIGRLEDTVNWGRKNSLWPYNFGISCCYVEMCT
NUOB_TOLAT      MKYTLTRIDPNAPIERYPAEKKQTVNDPL-QEVGRGILLGKLENVVNWGRKNSLWPYNFGISCCYVEMTT
NUOB_BLOPB      MKYTLTRTD-NSEDEQYPLQEKKIVTDPLEKNIQRNVFFGKLHKIVNWGRGNSLWPYNFGLSCCYVEMTT
NUOB_CHRSD      MQYTLTRADPAPDGASYPLGRRESTSDPMQEQVHRNVFTGKLEDVVNWGRKHSLWPYNFGLSCCYVEMTT
NUOB_BUCAT      MNYTLTKADSDNNNKKYPKQTIESVSDPLEEYLKKNIFMGKLHKLVNWGRKNSLWPYNFGLSCCYVEMVS
NUOB_BUCAI      MNYTLTKADSDNNNKKYPKQTIESVSDPLEEYLKKNIFMGKLHKLVNWGRKNSLWPYNFGLSCCYVEMVS
NUOB_BUCA5      MNYTLTKADSDNNNKKYPKQTIESVSDPLEEYLKKNIFMGKLHKLVNWGRKNSLWPYNFGLSCCYVEMVS
NUOB_BAUCH      MNYTLTRILSNSKENRKSLQEDDSATLLIEQHVNSNIYLGKLKSIVKWGRGNSLWPYNFGLSCCYVEMTT
NUOB_ACIBY      MKYTLTRANPDA--DQYPLQDRQIVTDPLEEEVNKNVFMTRLEDVVNWGRKNSLWPFNFGTSCCYVEYAT
NUOB_ACIBT      MKYTLTRANPDA--DQYPLQDRQIVTDPLEEEVNKNVFMTRLEDVVNWGRKNSLWPFNFGTSCCYVEYAT
NUOB_ACIBS      MKYTLTRANPDA--DQYPLQDRQIVTDPLEEEVNKNVFMTRLEDVVNWGRKNSLWPFNFGTSCCYVEYAT
NUOB_ACIBC      MKYTLTRANPDA--DQYPLQDRQIVTDPLEEEVNKNVFMTRLEDVVNWGRKNSLWPFNFGTSCCYVEYAT
NUOB_ACIB5      MKYTLTRANPDA--DQYPLQDRQIVTDPLEEEVNKNVFMTRLEDVVNWGRKNSLWPFNFGTSCCYVEYAT
NUOB_ACIB3      MKYTLTRANPDA--DQYPLQDRQIVTDPLEEEVNKNVFMTRLEDVVNWGRKNSLWPFNFGTSCCYVEYAT
NUOB_PSYWF      MKYTLTRANPDA--DTYPAQTRQTVNNPIEDEVNRNVFMGKLEDMVNWGRKNSLWPFNFGTSCCYVEYAT
NUOB_PSYCK      MKYTLTKANPDA--DVYPAQTSQTVNDPMEDEVNKNVFMGRLEDLVNWGRKHSLWPFNFGTSCCYVEYAT
NUOB_PSYA2      MKYTLTKANPDA--DVYPAQTSQTVNDPMEDEVNKNVFMGRLEDLVNWGRKHSLWPFNFGTSCCYVEYAT
NUOB_ACIAD      MKYTLTRANPDA--NQYPLQERQVVNDPLQEEVNKNVFMTRLHNVVNWGRKNSVWPFNFGTSCCYVEYAT
NUOB_BLOFL      MKYTLTLARTNQDDDSYPEQDQKPVADPLDKQIEKNVYFGKLHKAVNWGRSNSLWPYNFGLSCCYVEMTT
NUOB_BUCAP      MNYTLTRAERKSQR-HYPNETTQSTIDPIEGYLKKNILMGKLHKIVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_BUCBP      MKYTLTRVNISDDDQNYPREKKIQVSDPTKKYIQKNVFMGTLHNLVNWGRKNSLWPYNFGLSCCYVEMVT
NUOB_BUCCC      MKYTLTRVNTNSISKKYPLRSLKKTSDPIKKQIKNNIFFGTISKIMNWGRKNSLWPYNFGLSCCYVEMVS
NUOB1_NITMU     -----------------------------EEDGRRSVLLTRLQDLVAWGRKNSVWPYNFGLSCCYVEMAT
NUOB1_NITOC     ---------------RWRLSKPQAATSSFEDAIRRNLLFAQLQDLVAWGRKNSLWPYNFGLSCCYVEMVT
NUOB_METCA      -----------------------------EEALRRNILFARLDDLVRWGRKNSIWPFNFGLSCCYVEMAT
NUOB2_ACICJ     --------------------------------VRRNVALGRLEDMVAWGRKYSIWPFNFGLSCCYVEMAT
NUOB1_GLUDA     ----------------------------MTETVKRNLVMGRLQDFVSWGQKNSIWPFNFGLSCCYVEMAT
NUOB_SHEWM      ---------------RWQLSKPEIITQTMQEVVEKNLLVTRLEDLVAWGRSNSLWPFNFGLSCCYVEMAT
NUOB2_RHOSK     ----------------------------------------RLDDLVAWSRKHSLWPFNFGLSCCYVEMAT
NUOB2_RHOS4     ----------------------------------------RLDDLVAWSRKHSLWPFNFGLSCCYVEMAT
NUOB2_RHOS1     ----------------------------------------RLDDLVAWSRKHSLWPFNFGLSCCYVEMAT
NUOB1_RHOP5     ---------------------------PIEEQMARTSLFTRLEDLVAWSRKNSLWPFNFGLSCCYVEQVT
NUOB_RHOP2      ----------------HALQPAEPVS--VEQHMALSSLFTTLEDLTAWSRKHSLWPFNFGLSCCYVEQVT
NUBCD_GEOMG     -----------------------------ETEIPQNIVLTRLDDLINWGRANSLWPMFFGLSCCFVEMMT
NUBCD_GEOBB     -----------------------------DDKIPENVLLASLDDMINWGRANSLWPMFFGLSCCFVEMMT
NUOB2_RHOPB     ----------------------------VEEHMARTSLFARLEDLVAWSRKNSLWPFNFGLSCCYVEQVT
NUOB1_RHOS5     ----------------------------------------RLDDLVAWSRKHSLWPFNFGLSCCYVEMAT
NUBCD_GEOSL     -----------------------------ETEVQNNIILASLDDLINWGRANSLWPMFFGLSCCFVEMMT
NUBCD_GEOUR     ---------------------------------HNNVILANLDDLINWGRANSLWPMFFGLSCCFVEMMT
NUOB1_RHOPS     ----------------------------VEEHMARSNLFTTLEDLTAWSRKHSLWPFNFGLSCCYVEQVT
NUOB2_RHOPT     ----------------------------VEEHMALSSLFTTLEDLTAWSRKHSLWPFNFGLSCCYVEQVT
NUOB2_RHOPA     ----------------------------VEEHMALSSLFTTLEDLTAWSRKHSLWPFNFGLSCCYVEQVT
NUBCD_PELCD     ----------------------------MSESIPKNIILTTLDDAINWGRKNSMWPMFFGLSCCFVEMMG
NUBCD_SYNFM     -------------------------------------FLSAADFVLNWSRKYSLWPLFFGLSCCFVEEAT
NUOB_GEOUR      ----------------------------VEQPLGDNIVTASLDGLVNWARKSSIWPMTFGLACCAIEMMA
NUOB_GEOSF      ----------------------------VEQPLGDNIVTASLDGLVNWARKTSIWPMTFGLACCAIEMMA
NUOB_CAMFF      ----------------------------IENLVQNDVVLTRLDALFNWGRKNSLWPMIFGTACCAIEFMS
NUOB_GEOSM      ----------------------------VDQPLGENIITTSLDSLVNWARKSSIWPMTFGLACCAIEMMA
NUOB_GEOBB      ----------------------------VDQPLGENIITTSLDSLVNWARKSSIWPMTFGLACCAIEMMA
NUOB_DEIDV      ---------------------------------SEGILFSNLEKLVAWGRSNSLWPATFGLACCAIEMMS
NUOB1_ACIBL     ------------------------------EQPEEGIVLTTLDNAVNWIRKNSIWPMTFGLACCAIEMMS
NUOB_FRASC      ----------------------------LEEKLPGGVLLASVEKLANWSRRSSLWPATFGLACCAIEMMS
NUOB_FRAAA      ----------------------------LEEKLPGGVLLASVEKLANWSRRSSLWPATFGLACCAIEMMS
NUOB_PARUW      ------------------------------QQEKTPFLIAPLEKLVNWARSNSLWPAQFGLACCAIEMMS
NUOB_BDEBA      -------------------------------------FTSKLDAIVAWGRKNSLWPMPYGTACCGIEFMS
NUOB_METI4      --------------------------------IEGDVVVTRLDAAINWMRKNSLWPMPMGLACCAIELMA
NUOB1_CHLSY     --------------------------DPTQLELERQILLTTVNRFYNWGRRSSIWPMAFGLACCAIEMMA
NUOB1_CHLAA     --------------------------DPTQLELERQILLTTVNRFYNWGRRSSIWPMAFGLACCAIEMMA
NUOB_FRASN      ----------------------------LEEKLPGGVLLTTVEKLANWSRRSSLWPATFGLACCAIEMMS
NUOB2_ROSCS     ----------------------------LEAE-KQGVFLTTMQRFYNWGRRSSVWPLSFGLACCAIEMMA
NUOB2_CHLAD     --------------------------DPNQLELERQILLTTVNRFYNWGRRSSIWPMAFGLACCAIEMMA
NUOB1_ROSS1     ----------------------------IQLEAEKHVFLTTMQRFYNWGRRSSIWPLSFGLACCAIEMMA
NUOB_GEOLS      ----------------------------VNQPLGGNVTVTSLDKLVNWVRKSSIWPMTFGLACCAIEMMA
NUOB_GEOMG      ----------------------------VDQPLGDSFITASLDGLVNWARKSSIWPMTFGLACCAIEMMA
NUOB1_CHLT3     -----------------------------------------LDAITNWGRANSIWPMPMGLSCCAIEMMA
NUOB2_OPITP     -------------------------TPEIPPEVSQIARFAKLDDLLALGRANSLWPLTFGLACCAIEMMA
NUOB1_SOLUE     ----------------------------IQNQFEQNFITTNVDHVFNWARKSALWPLTFGLACCAIEMIA
NUOB_GEOSL      ----------------------------VDQPLGDNFITTSLDSLVNWARKSSIWPMTFGLACCAIEMMA
NUOB_BEUC1      ----------------------------IEEKAPSGFMLAKVSDLVGLIRKSSLWPVTMGLACCAIEMMA
NUOB_BACFR      -------------------------------EGGANVFVGVLDDLINWGRSNSLWPLTFATSCCGIEFMA
NUOB_BACFN      -------------------------------EGGANVFVGVLDDLINWGRSNSLWPLTFATSCCGIEFMA
NUOB_ARCB4      ----------------------------VESKLGDSIVTTRLDHAVNWGRSYSLWPMAFGTACCGIEFMA
NUOB_ACIC1      ----------------------------IEEKIPGGFLLTTVEKAVGWVRKSSLWPATFGLACCAIEMMA
NUOB_CLOB8      ----------------------------------------KLDDTLNYFRAHSFWPLTFGLACCAIEMMA
NUOB2_SALAI     ----------------------------IEEKLPAGVLLTSVEKLVNWSRKSSVWGATFGLACCAIEMMA
NUOB1_HERA2     -----------------------------------------LEGVVNWGRTKAMWPMLFGLACCAIEMMA
NUOB2_SALTO     ----------------------------IEEKLPAGVLLTSVEKFVNWSRKSSVWGATFGLACCAIEMMA
NUOB_RHOSR      ----------------------------IEEKLPSGFLLTTVEGLAGYVRKGSLWPASFGLACCAIEMMA
NUOB_RHOOB      ----------------------------IEEKLPSGFLLTTVEGLAGYVRKGSLWPASFGLACCAIEMMA
NUOB1_STRCO     ----------------------------LEEKLPSGFLLTTVEQAAGWVRKSSVFPATFGLACCAIEMMT
NUOB1_OPITP     --------------------------------IEGGIVVSKADAVINWIRTNSMWPMPMGLACCAIELMQ
NUOB2_THEYD     -----------------------------------NVIITTLDKVVNWGRSNSLWPLTFGLACCAIEMMA
NUOB_HELMI      ----------------------------VDELIKKNIIMTSLEAVFNWARGNSLWPLSSGLACCAIEMMA
NUOB_DESHY      -----------------------------------NVLLTSIDKVLNWGRGHSFWPVTFGLACCAIEMMA
NUOB_DESHD      -----------------------------------NVLLTSIDKVLNWGRGHSFWPVTFGLACCAIEMMA
NUOB1_ROSCS     ----------------------------IEQKADMGIVTASLEQVVNWSRSNAMWPLLFGLACCAIEMMG
NUOB1_STRGG     ----------------------------LEEKLPSGFVLTTVEQAAGWVRKSSVFPATFGLACCAIEMMT
NUOB_FLAJ1      ------------------------MVSPPEGLTGEGFFATKLNDVVGLARANSLWPLPFATSCCGIEFMA
NUOB_RUBXD      -----------------------------------NIITTSTDKLFNWARKNSLWPLQFGLACCAIEMMS
NUOB3_RHIEC     --------------------------------IRDSVLFTTADSVINWSRSSALWPETFGIACCAIEMIS
NUOB2_RHIME     --------------------------------IRDSVLFTTADSIISWSRRSALWPETFGIACCAIEMIS
NUOB2_RHIE6     --------------------------------IRDSVLFTTADSIINWSRSSALWPETFGIACCAIEMIS
NUOB_WOLSU      ------------------------------------VVLTTVDHLVNWGRSNSLWALTYGLACCAIEMMA
NUOB_MYCUA      ----------------------------LEEQLPGGILLSTVEKVAGYVRKNSLWPATFGLACCAIEMMA
NUOB_MYCTU      ----------------------------LEEQLPGGILLSTVEKVAGYVRKNSLWPATFGLACCAIEMMA
NUOB_MYCTA      ----------------------------LEEQLPGGILLSTVEKVAGYVRKNSLWPATFGLACCAIEMMA
NUOB_MYCMM      ----------------------------LEEQLPGGILLSTVEKVAGYVRKNSLWPATFGLACCAIEMMA
NUOB_MYCBT      ----------------------------LEEQLPGGILLSTVEKVAGYVRKNSLWPATFGLACCAIEMMA
NUOB_MYCBP      ----------------------------LEEQLPGGILLSTVEKVAGYVRKNSLWPATFGLACCAIEMMA
NUOB_MYCBO      ----------------------------LEEQLPGGILLSTVEKVAGYVRKNSLWPATFGLACCAIEMMA
NUOB2_ROSS1     ----------------------------IEQKADMGIVTASLEQLVNWSRSSAMWPLLFGLACCAIEMMG
NUOB1_STRAW     ----------------------------LEEKLPSGFLLTTVEQAAGWVRKASVFPATFGLACCAIEMMT
NUOB_MYCPA      ----------------------------LEEQLPGGILLSTVEKVAGYVRKNSLWPATFGLACCAIEMMA
NUOB_MYCA1      ----------------------------LEEQLPGGILLSTVEKVAGYVRKNSLWPATFGLACCAIEMMA
NUOB2_SOLUE     ----------------------------------EGIVMTTLDAAVNWARKNSIWPMTFGLACCAIEMMS
NUOB_RICBR      -------------------QEDELLNNELS---NRGVLLTKVDDVIGWARSNSLWPMTFGLACCAVEMMQ
NUOB_BREBN      ------------------------IAPELQEELNRNVMFTTLETVKGWVRSNSLWPLTFGLACCAIEMMG
NUOB_AKKM8      -------------------------TGVLDSNAEGNFVYTTLDAAINWIRKNSLWPMPMGLSCCAIEFMA
NUOB_SULNB      --------------------------------------------LVNWGRSNSLWPLTYGLACCAIEMMA
NUOB_FLAPJ      ------------------------IVEAPEGVTGEGFFATKLNDVVGLARANSMWPLPFATSCCGIEFMA
NUOB_DEIRA      ---------------------KELIDRDWQELESEGVLFSSLEKLVAWGRSNSLWPATFGLACCAIEMMS
NUOB_BACV8      -------------------------------EGGTKVLVGCLDDLINWGRSNSLWPLTFATSCCGIEFMA
NUOB1_THEYD     ----------------------DTVTEPVEIEQGANTIITTLDKIASWGRCSSLWPLTFGLACCAIEMMA
NUOB_NITSB      --------------------------------------------LVNWGRTNSLWVLTYGLACCAIEMMA
NUOB_RICCK      -------------------QEDEILNNKLS---NRGFLLTKVDDVIGWARANSLWPMTFGLACCAVEMMQ
NUOB_RHOE4      ----------------------------LEEKLPSGFLLTTVEGLAGYARKGSLWPATFGLACCAIEMMA
NUOB_LEPBL      --------------------------------------LGNIESVIQWGRGNSLWPFPFATACCGIEYMS
NUOB_LEPBJ      --------------------------------------LGNIESVIQWGRGNSLWPFPFATACCGIEYMS
NUOB_THEFY      ----------------------------LEEKLPSGVLLTTVEQIVGFVRKTSMWPATFGLACCAIEMMA
NUOB_RICTY      ------------KNDFY--QEDELLNSCL---TNRGFLLSKIDEVISWARANSLWPMTFGLACCAVEMMQ
NUOB_RICRS      -------------------QEDELLSNELS---NRGFLLTKVDDVIGWARANSLWPMTFGLACCAVEMMQ
NUOB_RICRO      -------------------QEDELLSNELS---NRGFLLTKVDDVIGWARANSLWPMTFGLACCAVEMMQ
NUOB_RICPU      -------------------QEDELLSNELS---NRGFLLTKVDDVIGWARANSLWPMTFGLACCAVEMMQ
NUOB_RICCN      -------------------QEDELLSNELS---NRGFLLTKVDDVIGWARANSLWPMTFGLACCAVEMMQ
NUOB_RICB8      -------------------QEDELLNNELS---NRGFLLTKVDDVIGWARSNSLWPMTFGLACCAVEMMQ
NUOB_RICAE      -------------------QEDELLSNELS---NRGFLLTKVDDVIGWARANSLWPMTFGLACCAVEMMQ
NUOB_MYCA9      ----------------------------LEEKLPSGFLLSTVETLAGYVRKGSLWPATFGLACCAIEMMS
NUOB_HELAH      ------------------------------------VVLSTLDKLLNWGRSNSLWPLTYGLACCAIEMMA
NUOB2_STRGG     --------------------------------------------VLNWGRRYSLWVFNFGLACCAIEFIA
NUOB_RICPR      ------------EHDFY--QEDELLNSGL---TNRGFLLSKVDEVISWARANSLWPMTFGLACCAVEMMQ
NUOB_RICFE      -------------------QEDELLNNELS---NRGFLLTKVDDVIGWARANSLWPMTFGLACCAVEMMQ
NUOB_MOOTA      ---------------------------PADPQIPDNIILSTVDAMLNYCRAHSFWPVTFGLACCAIEMMA
NUOB_HELPJ      ------------------------------------VILSTLDKLLNWGRSNSLWPLTYGLACCAIEMMA
NUOB_HELPG      ------------------------------------VVLSTLDKLLNWGRSNSLWPLTYGLACCAIEMMA
NUOB_HELP2      ------------------------------------VVLSTLDKLLNWGRSNSLWPLTYGLACCAIEMMA
NUOB_SULDN      ------------------------------------VALTSIDKIVNWGRSNSLWAMTYGLACCGIEMMA
NUOB_HELPY      ------------------------------------VVLSTLDKLLNWGRSNSLWPLTYGLACCAIEMMA
NUOB_HELPS      ------------------------------------VVLSTLDKLLNWGRSNSLWPLTYGLACCAIEMMA
NUOB_HELPH      ------------------------------------VVLSTLDKLLNWGRSNSLWPLTYGLACCAIEMMA
NUOB2_STRCO     --------------------------------------------VLNWGRRYSLWVFNFGLACCAIEFIA
NUOB2_STRAW     --------------------------------------------VLNWGRRYSLWVFNFGLACCAIEFIA
NUOB1_SYMTH     ---------------------------------------------LRWAQSNSIWPLTFGLACCAIEMMN
NUOB_GEOTN      ------------------------------EEVKRNVFFTTLEQLKGWARSNSLWPLTFGLACCAIEMMA
NUOB_GEOKA      ------------------------------EEVKRNVFLTTLEQLKGWARSSSLWPLTFGLACCAIEMMA
NUOB_RICM5      -------------------QEDELLSNELS---NRGFLLTKVDNVIGWARANSLWPMTFGLACCAVEMMQ
NUOB_CAMJR      ------------------------------------VVLTSVDKLVQWGRSNSLWALSYGLACCAIEMMA
NUOB_CAMJJ      ------------------------------------VVLTSVDKLVQWGRSNSLWALSYGLACCAIEMMA
NUOB_CAMJE      ------------------------------------VVLTSVDKLVQWGRSNSLWALSYGLACCAIEMMA
NUOB_CAMJD      ------------------------------------VVLTSVDKLVQWGRSNSLWALSYGLACCAIEMMA
NUOB_CAMJ8      ------------------------------------VVLTSVDKLVQWGRSNSLWALSYGLACCAIEMMA
NUOB_CAMC1      ------------------------------------VVLTTVDKLVQWGRSNSLWALSYGLACCAIEMMA
NUOB_PROAC      -----------------------------DADVPAGIVMTSMEAIVGWLRKTSFWPLTMGLACCAIEMIS
NUOB_GEOSW      ------------------------------EELKRNVFFTTLEQLKAWARSNSLWPLTFGLACCAIEMMG
NUOB_SALRD      -------------------------------------FTTRVDTFLNWARSNSLMPMPMGLACCAIEMMG
NUOB2_CYTH3     -------------------------------------FATSLDSVIGLARKNSLWPLPFATSCCGIEFMA
NDUS7_SOLTU     --------------------------------------ISKVDDLMNWARRGSIWPMTFGLACCAVEMMH
NUOB_MYXXD      --------------------------------------MGWLQSIVSWARKYSLFTYPYATACCGMEYMS
NUOB_LEPBP      -----------------------------------------LDNVVQWGQSFSLWPYPFATACCGIEYMS
NUOB_LEPBA      -----------------------------------------LDNVVQWGQSFSLWPYPFATACCGIEYMS
NUOB_HELHP      ------------------------------------IVLSSVDKLLNWSRSNSLWGVTYGLACCAIEMMA
NUOB_BACWK      -------------------------------ELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMG
NUOB1_SALTO     --------------------------------------------VLNWGRRYSLWVFNFGLACCAIEFIA
NUOB1_SALAI     --------------------------------------------VLNWGRRYSLWVFNFGLACCAIEFIA
NUOB_MYCSS      ----------------------------LEERLPGGILLSTVEKVAGYVRAGSLWPATFGLACCAIEMMS
NUOB_MYCSJ      ----------------------------LEERLPGGILLSTVEKVAGYVRAGSLWPATFGLACCAIEMMS
NUOB_CAMHC      ------------------------------------VVLTTIDKLVNWGRSNSLWAMNYGLACCAIEMMA
NUOB_ANOFW      ------------------------VSDQEMEEMRRNVFLTTLEQLKAWARSNSLWPLTFGLACCAIEMMG
NUOB_CARHZ      ----------------------EIKTIQSEEEIGKNVFLTTLDAVFNWARGNSLWPLTFGLACCAIEVMA
NUOB_CAMC5      --------------------------------------------LVQWGRSNSLWALSYGLACCAIEMMA
NUOB_BACHK      -------------------------------ELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMG
NUOB_BACCZ      -------------------------------ELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMG
NUOB_BACCR      -------------------------------ELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMG
NUOB_BACCQ      -------------------------------ELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMG
NUOB_BACCN      ---------------------------PQEQELERNIFFTTLEQIKGWARSNSLWPMTFGLACCAIEMMG
NUOB_BACC7      -------------------------------ELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMG
NUOB_BACC4      -------------------------------ELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMG
NUOB_BACC3      -------------------------------ELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMG
NUOB_BACC2      -------------------------------ELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMG
NUOB_BACC1      -------------------------------ELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMG
NUOB_BACC0      -------------------------------ELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMG
NUOB_BACAN      -------------------------------ELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMG
NUOB_BACAH      -------------------------------ELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMG
NUOB_BACAC      -------------------------------ELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMG
NUOB_BACAA      -------------------------------ELERNIFFSTLEQLKGWARSNSLWPMTFGLACCAIEMMG
NUOB_RICAH      -------------------QEDELLNNEIS---NRGFLLTKIDDIIGWARAHSLWPMTFGLACCAVEMMQ
NUOB_LEPIN      ------------------------------QALGDMVQLGNVESVIQWGRSYSLWPYPFATACCGIEYMS
NUOB_LEPIC      ------------------------------QALGDMVQLGNVESVIQWGRSYSLWPYPFATACCGIEYMS
NUOB2_ACIBL     ----------------------------IENKFEKNFLLSSVDYVFNWARKSSVWPMTFGLACCAIEMIT
NUOB_COXBU      ----------------------------MQQLLTKEGFLTSLDDLMRWARSGSLWPMTFGLACCAVEMMQ
NUOB_COXBR      ----------------------------MQQLLTKEGFLTSLDDLMRWARSGSLWPMTFGLACCAVEMMQ
NUOB_COXBN      ----------------------------MQQLLTKEGFLTSLDDLMRWARSGSLWPMTFGLACCAVEMMQ
NUOB_COXB2      ----------------------------MQQLLTKEGFLTSLDDLMRWARSGSLWPMTFGLACCAVEMMQ
NUOB_COXB1      ----------------------------MQQLLTKEGFLTSLDDLMRWARSGSLWPMTFGLACCAVEMMQ
NUOB_PELPD      -------------------------------------------ELIGWVRKFSIFPYPFVTACCGMEFMA
NUOB_DESRM      -------------------------------EVARTVSVGPLEKLLNLARANSLWPMGFGLACCAIELMA
NUOB_AZOPC      -----------------------------------NIAIAKLNDLINWGRSNSVWPLTFATSCCGIEFMC
NUOB2_HERA2     ----------------------------LEQQ---GVLFTTINKLYNWGRRSSVWPMQFGLXXXXXXXXX
NDHK_NEPOL      -----------------------VSSSPITQELANNLILTTLNDLYNWARLSSLWPLLYGTSCCFIEFAC
NUOB1_ANADE     ------------------------------REEAEGFLQGLVSKSLGWARKYSLFTYPFVTACCGMEYMT
NDHK_CHAGL      -----TQFQNSFNEDLFDSIKNPVKTSSDKEELSNSIILTTLNDFSNWARLSSLWPLLYGTSCCFIEFAA
NUOB_THERP      --------------------------------------------LFSWARRSSLWWLQFGLACCAIEMIS
NDHK_ADICA      ---------------------------PLQGGMSDSIFMASISDFSNWSRLSSLWPLLYGTSCCFIEFAS
NUOB2_ANASK     ------------------------------REEAEGFLQGLVSKSLGWARKYSLFTYPFVTACCGMEYMT
NUOB2_ANADF     ------------------------------REEAQGFLQGLVSKGLGWARKYSLFQYPFVTACCGMEFMT
NDHK_JASNU      ----------------------------LDQTVQNSVFSTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NUOB2_ACIF5     ----------------------------IEGLLEKGFVTTTIDTVVNWGRTGSLWPMTFGLACCAVEMMH
NDHK_STAPU      -----------------------------EENISDSVILTTFHDFTNWIRLSSLWPLLYGTSCCFIEFAS
NDHK1_GLOVI     -----------------PIERPEVTS-----ELTNNVVLTTLNDLYNWARLSSVWPLMYGTSCCFIEFAG
NUOB1_CYTH3     ------------------------------------IVVSQLEDVLNWARLSSLFPMSFGLACCAIEMMQ
NDHK_MICAN      --------NPTSEFKQIIEQQSEKILNPIEQDLSENVILTTVDDLYNWARLSSLWPMLYGTACCFIEFAA
NDHK_CRYJA      ----------------------------LDQTTSNSVISTTLNDLSNWARLSSLWPLLYGTSCCFIEFAS
NUOB_DEHSC      ------------------------------EEPPPGVFITSVEKVLNWSRHYSLWPVMFGLXXXXXXXXX
NUOB_ANAD2      ------------------------------REEAEGFLQGLVSKSLGWARKYSLFTYPFVTACCGMEYMT
NDHK_THEEB      -------------NTTSPAILNPIARPEVPQELAENIILTSLNDVYDWARLSSLWPLMYGTACCFIEFAA
NDHK_PROM5      -----------------PLGAPQVTTD-----LSENIIMTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NUOB_AMOA5      ------------------------------------VIMVALEDLLNWAERSSLWPITFGLACCAIEMMG
NDHK_MESVI      --------DTNERLINYNIEKPQVT-----QNVSNQLILTTLNDLYNWARLSSLWPLLYGTSCCFIEFAC
NUOB_VESOH      -----------------------------------------LDRVINWARTGSLWPMTFGLACCAVEMME
NUOB_DEHE1      ------------------------------EEPPPGVFVTSVEKVLNWSRHYSLWPVMFGLXXXXXXXXX
NDHK_SYNS9      -----------------------IGTPEVTNELSENIILTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_SYNR3      -----------------PVGSPEVTTD-----LSENVILTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_ANAVT      -------------NSDLTTQDKERIINPIEQDLSENVILTTVDDLYNWARLSSLWPLLFGTACCFIEFAA
NDHK_ANASP      -------------NSDLTTQDKERIINPIEQDLSENVILTTVDDLYNWARLSSLWPLLFGTACCFIEFAA
NDHK1_CYAP4     -----------------------IAAPEVPQELQENIILTSLNDVYSWCRLSSLWPLMYGTACCFIEFAA
NUOB_RUTMC      -----------------------------------------LNNVINWARTGSLWPMTFGLACCAVEMME
NDHK_PROMS      -----------------PLGAPQVTTD-----LSENIILTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_PROM9      -----------------PLGAPQVTTD-----LSENIILTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_PROM2      -----------------PLGAPQVTTD-----LSENIILTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_PROM0      -----------------PLGAPQVTTD-----LSENIILTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_CHLAT      -------------------------TPQVTQSLSNQLILTTLNDLYNWARLSSLWPLLYGTSCCFIEFAS
NUOB_POLSQ      --------------------------------------------LINWTRNGSLWPMTFGLACCAVEMMH
NUOB_POLNS      --------------------------------------------LINWTRNGSLWPMTFGLACCAVEMMH
NUOB_DEHSB      ------------------------------EEPPPGVFITSVEKVLNWSRHYSLWPVMFGLXXXXXXXXX
NUOB_CHLPB      ---------------------------------NHNVLVTSVDNVLNWARLSSLWPMGFGLACCAIEMMA
NDHK_SOYBN      ----------------------------LDQTTKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_BARVE      ----------------------------LDRTTKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NUOB_SACEN      ----------------------------LEEKLPNGILLANVEKLVNWTRKTSVWPAAFGLACCAIEMMT
NDUS7_CAEEL     --------------------------------------LARLDDVLNLAQRGSIWPLTFGLACCAVEMMH
NDHK_ZYGCR      ---------------------------PTKQNVYDSVVLTTLQDVSNWVRLSSLWPLLYGTSCCFIEFAS
NDHK_SYNJA      ----------------FPASAPQVTTD-----LSNNVVLTTVNDLYNWAKMSSLWPLLYGTACCFIEFAA
NDHK_PEA        ----------------------------LDQKTKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_NOSP7      -------------NSNLTTQDKQRIINPIEQDLSENVILTTVDDLYDWARLSSLWPLLFGTACCFIEFAA
NDHK_COFAR      ----------------------------LDRTAQNSVISTTLNDFSNWSRLSSLWPLLYGTSCCFIEFAS
NUOB_THISH      ----------------------------IEGVLEKGFVTTSADKLINWARTGSLWPMTFGLACCAVEMMH
NUOB2_SORC5     ---------PRGWEAKYESDGGGVITTSVDQTVNW---------LLNWGRSNSVWYMLFGLACCAIELMQ
NDHK_PROMP      -----------------PLGAPQVTTD-----LSENIIMTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_PROM3      -------------------------------ELSENIILTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_PAUCH      -------------------------TPTVTNDLSENIILTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_MAIZE      ----------------------------LDQTSSNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_HORVU      ----------------------------LDQTSSNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_CYAP8      -------MSPNPTPDLTTIQRQQIARGQVTQDLSENIILTTVDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_DRANE      ----------------------------LDRTTKNSVISTTLNDLSNWSRLSSLWPFLYGTSCCFIEFAS
NUOB_CHLTE      ---------------------------------NRNVLVTSVDNVMNWARLSSLWPMGFGLACCAIEMMA
NUOB_CHLCH      ---------------------------------NHNVLVTSVDNVLNWARLSSLWPMGFGLACCAIEMMA
NUOB_BACTN      --------------------------EKLVKELNTNVFLGVLDDLVNWGRSNSLWPLTFATSCCGIEFMA
NDHK_SYNSC      -------------------------------DLSENVILTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_PSINU      -----------------------ITINPMESLVSKSIILTNLNDFSNWARLSSLWPLLYGTSCCFIEFAS
NDHK_PROM4      -------------------------------ELSENIILTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_ORYSJ      ----------------------------LDQTSSNSVISTTLKDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_ORYSI      ----------------------------LDQTSSNSVISTTLKDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_ORYSA      ----------------------------LDQTSSNSVISTTLKDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_ORYNI      ----------------------------LDQTSSNSVISTTLKDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_OLIPU      ----------------------------LDRTTKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_NASOF      ----------------------------LDRTTKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_LOBMA      ----------------------------LDRTTKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_LEPVR      ----------------------------LDRTTTNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_ARATH      ----------------------------LDRTTKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_AETCO      ----------------------------LDRTTKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_SYNPX      -------------------------------DLSENVILTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_SYNPW      ------------------------------QDLSENVILTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_SYNJB      ----------------FPGAAPQVTTD-----LSNNVVLTTVNDLYNWAKMSSLWPLLYGTACCFIEFAA
NDHK_PROMM      -------------------------------DLSENIILTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_PHAVU      ----------------------------LDQTTQNSVISTTLNDFSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_LEMMI      ----------------------------LDQTMPNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAA
NDHK_CYAP7      -------MSPNSSSDLFTQEQKEKLLNPINQDLSENVILTTVDDLYNWARLSSLWPLLYGTACCFIEFAA
NDHK_ANGEV      ----------------------------LDKNMSNSIISTNLNDFSNWARLSSLWPLLYGTSCCFIEFAS
NDHK1_ACAM1     -------------------------------ELSENVILSSVSDLYDWARLSSLWPLMYGTACCFIEIAA
NUOB_PROA2      ---------------------------------NHNVLVTSVDNVLNWARLSSLWPMGFGLACCAIEMMA
NDHK_PROMA      -----------------------VAAPAVTSDLSENIILTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_CAPBU      ----------------------------LDRTTKNSVISTTLNDLSNWTRLSSLWPLLYGTSCCFIEFAS
NDHK_AETGR      ----------------------------LDRTTKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NUOB_HYDS0      ----------------------------MASSINGNGFITTTVDLLSWGRRNALWPVTIGLACCAIEMMH
NUOB_AQUAE      --------------------------------INSNGFVTTVEELLRWGRRNSLWPVTIGLACCAIEMMH
NDHK_TOBAC      ----------------------------LDRTTQNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_SYNS3      -------------------------------DLSENVILTSLDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_PIPCE      ----------------------------LDRTTQSSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_PHYPA      ------------------------------QENPNSVILTTFNDFTNWARLSSLWPLLYGTSCCFIEFAS
NDHK_NICTO      ----------------------------LDRTAQNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_NICSY      ----------------------------LDRTTQNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_IPOPU      ----------------------------LDRTAKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_GOSHI      ----------------------------LDRTTQNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_GOSBA      ----------------------------LDRTTQNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_CARPA      ----------------------------LDRTTQNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_ATRBE      ----------------------------LDRTAQNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_ARAHI      ----------------------------LDRTTKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NUOB_METFK      ----------------------------IEGVLEKGFVTTTLDTVINYTRTGSLWPMTFGLACCAVEMMH
NUOB1_SORC5     --------------------------------------------LLNWAKKYSLFQYPFVTACCGMEYMA
NDHK_SYNP6      ----------------------------ITQGLSENVILTTLDDLYNWARLSSLWPLMYGTACCFIEFAA
NDHK_SYNP2      ------------------------------QDLSENVILTTVDDLYNWARLSSLWPLLYGTACCFIEFAA
NDHK_SYNE7      ----------------------------ITQGLSENVILTTLDDLYNWARLSSLWPLMYGTACCFIEFAA
NDHK_SPIOL      ----------------------------LDQIAQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_MARPO      ------------EDNSTTMLKNSIESSFINKTLTNSIILTTFNDFSNWARLSSLWPLLYGTSCCFIEFAS
NDHK_CALFG      ----------------------------LDRTTQNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NUOB_VEREI      ------------------------------ENVMKEGFITTSYDVVNWAKTGSLWPMTFGLACCAVEMIH
NDHK_WHEAT      ----------------------------LDQTSSNSVISTTPNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_SORBI      ----------------------------LDQTSSNSVISTTPNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_SACOF      ----------------------------LDQTSSNSVISTTPNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_SACHY      ----------------------------LDQTSSNSVISTTPNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_PROMT      -------------------------TPTVTNDLSENIILTSLEDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_PROM1      -------------------------TPTVTNDLSENIILTSLEDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_LOLPR      ----------------------------LDQTSSNSVISTTPNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_LACSA      -----------------------------DRTTQNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_HELAN      ---------------------------PLFHRTTQNVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_GUIAB      ---------------------------PLFHRTTQNVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_DIOEL      ----------------------------LDQTTPNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_CYAA5      ------------------LQKEKILNPAVTQDLSENIILTTVDDLHNWARLSSLWPLLYGTACCFIEFAA
NDHK_CRUWA      ----------------------------LDRTTKNSVISTTLNDLSNWSELSSLWPLLYGTSCCFIEFAS
NDHK_BRADI      ----------------------------LDQTSSNSVISTTPNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_AGRST      ----------------------------LDQTSSNSVISTTPNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NUOB_NOCSJ      ----------------------------IEEKLPSGVLLSTVEGLAGYMRKASFWPASFGLACCAIEMMT
NUOB_CHLP8      ---------------------------------NRNVLVTSVDNVMNWARLSSLWPMGFGLACCAIEMMA
NUOB2_CHLT3     ----------------------------LDQKFDKGVVITAAENVLNWARLSSLWPMGFGLACCAIEMMA
NDHK_PANGI      ----------------------------LDRTTQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_NUPAD      ----------------------------LDRTTPNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_EUCGG      ----------------------------LARTTQNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_DAUCA      ----------------------------LDRTTQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NUOB_PELPB      -----------------------------------NVLITSVDNVLNWARLSSLWPMGFGLACCAIEMMA
NUOB_PELLD      -----------------------------------NVLVAPVDAVLNWARLSSLWPMGFGLACCAIEMMA
NDUS7_RECAM     ----------------------------LNNKQNKTEFISKMDELVNWARKGSLWPMTFGLACCAVEMMH
NDHK_TRIEI      -----------------PNQNQKII-NPIEQELSENIVLTTVDDLYNWAKLSSLWPLLYGTACCFIEFAA
NDHK_LUPLU      ---------------------------PLRDRTTQNVISTTLNELSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_LOTJA      ----------------------------IDRTTQNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_ACOCL      ----------------------------LDRTTPNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_ACOAM      ----------------------------LDRTTPNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK1_SYNY3     ------------------------------QDLSENVILTTVDDLYNWAKLSSLWPLLYGTACCFIEFAA
NUOB_PROVI      ----------------------------------QNVLVTSVDSVLNWARLSSLWPMGFGLACCAIEMMA
NUOB_NOCFA      ----------------------------LEEKLPSGFLLSTVESFAGYLRKGSVWPATFGLACCAIEMMA
NDHK_SOLTU      ----------------------------LDRTAPNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_SOLLC      ----------------------------LDRTAPNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_SOLBU      ----------------------------LDRTAPNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_RANMC      ----------------------------LNQTTQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_PELHO      ----------------------------LDRRTKNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_FAGEA      ---------------------------PLDRITPNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_CHAVU      ------------------------------QILSTSVILTTMNDLTNWARLSSLWPLLYGTSCCFIEFAS
NDHK_ANTFO      -----------------------------DETTSDSIILTTFNDFSNWARLSSLWPLLYGTSCCFIEFAS
NUOB_CHLL2      -----------------------------------NVVVTSVDNVLNWARLSSLWPMGFGLACCAIEMMA
NDHK_VITVI      ----------------------------LDRTTQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_CYCTA      ----------------------------LGQTTPNSVISTTLNDLSNWARLSSLWPLLYGTSCCFIEFAS
NUOB_CHLPD      -----------------------------------NVLITSVDNVLNWARLSSLWPMGFGLACCAIEMMA
NDHK_NYMAL      -----------------------------------SVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_LIRTU      ----------------------------LDRTTQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_DRIGR      ----------------------------LDRTTQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_CUCSA      ----------------------------LDRTTQTSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK2_GLOVI     ---------PQTDRMFFPPERPEVTS-----ELSNNVVLTTLNDLYNWARLSSVWPLMYGTACCFIEFAG
NDHK_PLAOC      ----------------------------LDRTTQNSVISTTPNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_OENPA      ----------------------------LARRTQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_OENGL      ----------------------------LARRTQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_OENEH      ----------------------------LARRTQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_OENBI      ----------------------------LARRTQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_OENAR      ----------------------------LARRTQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_NANDO      ---------------------------PLLDRITQNVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK2_ACAM1     ---------------------------PLEQELSDNVILTALDDLYDWVKMSSLYPFMFGTACCFMEFMG
NDHK_MANES      ----------------------------LDRTTQISVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_HUPLU      ----------------------------LDKTTSNSIVLTTFNDFSNWARLSSLWPLLYGTSCCFIESAS
NDHK_CHLSC      -----------------------------ERTAQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_ILLOL      ----------------------------LDRTTQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_BUXMI      ----------------------------VDRTTQNSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_AMBTC      ----------------------------LDRTTPNSVISTTPNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NUOB_HALHL      --------------------------------------------LINWARTGSLWPMTFGLACCAVEMMH
NDHK_CITSI      ------------------------------------------NDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_CERDE      ---------------------------PLFDRTTKNVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFAS
NUOB1_RHOPB     ---------PVGADDRFFLEVNNELAD-------KGFFVAATDDLITWARTGSLMWMTFGLACCAVEMMQ
NUOB1_ANADF     ----------------------------------------QLDKLINMARENSLWYLLFGLACCGIELMQ
NUOB_ACIAC      --------------------------------VMKEGFITTSYDVVNWAKTGSLWPMTFGLACCAVEMMH
NUOB2_CHLSY     -----------------------------EKAGNLGIVTTTLETVVNWGRTNAMWPLLFGLACCAIEMMG
NUOB2_CHLAA     -----------------------------EKAGNLGIVTTTLETVVNWGRTNAMWPLLFGLACCAIEMMG
NUOB1_CHLAD     -----------------------------EKAGNLGIVTTTLETVVNWGRTNAMWPLLFGLACCAIEMMG
NUOB_DIAST      --------------------------------VMKEGFITTSYDVVNWAKTGSLWPMTFGLACCAVEMMH
NUOB_ACISJ      --------------------------------VMKEGFITTSYDVVNWAKTGSLWPMTFGLACCAVEMMH
NUOB2_RHOP5     ---------PVGADDRFFVEVNNELSD-------KGFFVAATDDLITWARTGSLMWMTFGLACCAVEMMQ
NDHK_TRACE      ----------------------------LNRRTQNSVISTTPNELSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK2_SYNY3     -----------------PIQAPQVT-----KELSENVILTCLDDIYNWARLSTLYPMMFGTACCFMEFMA
NUOB_MYCS2      ----------------------------LEERLPGGILLSTVETVAGYVRKGSLWPATFGLACCAIEMMS
NUOB_DESVM      -------------------------------------------------RAMSLWPMTFGLACCAIEMMA
NUOB_DELAS      --------------------------------VMKEGFITTSYDVVNWAKTGSLWPMTFGLACCAVEMMH
NUOB_XANP2      --------------------------DPFFKEINKGFILTTADDLITWARTGSLMWMTFGLACCAVEMMQ
NDUS7_DICDI     ------------------------------------VVISKIDGLVNWARTGSLWPMTFGLACCAVEMMQ
NUOB_SULSY      ---------------------------------SSGIILTTVEEVLSWGRRNSLWPVSVGLACCAIEMMH
NUOB_AZOC5      --------------------------DPFYKEINKGFLVTTVDDLITWARTGSLMWMTFGLACCAVEMMQ
NUOB1_ANASK     ----------------------------------------QLDNLINLARASSLYYLTFGLACCGIELMQ
NDUS7_PONAB     --------------------------------------VAKLDDLVNWARRSSLWPMTFGLACCAVEMMH
NDUS7_PANTR     --------------------------------------VAKLDDLVNWARRSSLWPMTFGLACCAVEMMH
NDUS7_HUMAN     --------------------------------------VAKLDDLVNWARRSSLWPMTFGLACCAVEMMH
NDUS7_GORGO     --------------------------------------VAKLDDLVNWARRSSLWPMTFGLACCAVEMMH
NDHK_POPTR      ------------------------------------------NDLSNWSRLSSLWPLLYGTSCCFIEFAS
NDHK_POPAL      ------------------------------------------NDLSNWSRLSSLWPLLYGTSCCFIEFAS
NUOB_MYCGI      ----------------------------LEEKLPGGILLSTVEKVAGYVRKGSLWPATFGLACCAIEMMA
NUOB_MYCVP      ----------------------------LEERLPGGILLSTVEKVAGYVRKGSLWPATFGLACCAIEMMA
NDHK2_CYAP4     ---------PLDHSIRNPISSAEV-----PPELSENIILTSLDDIYNWARISSIYPLMYGTACCFIEFAA
NUOB2_ANADE     ----------------------------------------QLDNLINLARASSLYYLTFGLACCGIELMQ
NDUS7_BRAOL     --------------------------------------ISKVDDLMNWARRGSIWPMTFGLACCAVEMMH
NDUS7_BOVIN     -------------------QARAVVPKPAALPSSRGEYVAKLDDLINWARRSSLWPMTFGLACCAVEMMH
NUOB_ORITI      ---------------------------------NQGFILANLENLVSWARTRSLWPMTFGLACCAIEMMQ
NUOB_ORITB      ---------------------------------NQGFILANLENLVSWARTRSLWPMTFGLACCAIEMMQ
NUOB_DESDA      -------------------QPLEVSKDGLRFFPGAGAVIGPLNALVNWGRAGSIWPVTFGLACCAIEMMA
NDUS7_PARTE     ------------------------------------------NNLISWARQGSFWPLTFGLACCALEMMH
NUOB2_AZOSB     -----------------------------------------LCDMV---RSNSMWYLTFGLACCAVEMMQ
NDUS7_ARATH     --------------------------------------ISKVDDLMNWARTGSIWPMTFGLACCAVEMMH
NDUS7_MOUSE     ----------------------------------------KLDDLINWARRSSLWPMTFGLACCAVEMMH
NUOB_NEOSM      --------------------------------------VAKLDDLINWARSGSLWPMTFGLACCAVEMMH
NUOB_GRABC      ---------------------QEAVLRGITGEMDKGFVVANLDKLVNWARTGSLWPMTFGLACCAVEMIH
NUOB_DEIGD      ---------------------------------SEGVLFSTLEKLVAWGRSNSLWPATFGLACCAIEMMS
NUOB_MAGSM      --------------------------EELHQEVSDRGFLLTSADLVNWGRSMSMWPMTFGLACCAVEMMN
NUOB2_CHRVO     -------------------------------------------------QSGSLWYLSFGLACCAVEMMH
NUOB2_GLUDA     -----------------PGPEQDAVIKGITGEITEKGFVASLDKLVNWGRTGSLWPMSFGLACCAVEMIH
NQO6_THET8      ----------------------------------EGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMA
NQO6_THET2      ----------------------------------EGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMA
NUOB_AGRT5      ---------PVGSNDAY-------FTEINDELADKGFLVTSTDELITWARTGSLMWMQFGLACCAVELMQ
NUOB_RHORT      ---------------------QDLILGQVAREIEEKGFLSNVDSLVNWARAGSLWPMTFGLACCALEMIH
NUOB_RHOFD      ----------------------------------KEGFITTSYDSVNWAKTGSLWPMSFGLACCAVEMMH
NUOB_NITEC      ----------------------------IEGALDKGFVTTNLDSLINWGRTGSMWPMTFGLACCAVEMMQ
NUOB_MAGSA      ---------------------------------DKGFVLASVDAVVNWARTGSLWPMTFGLACCAVEMMH
NUOB_NITEU      ----------------------------IEGVLDKGFVTTSLDSLINWGRTGSMWPMTFGLACCAVEMMQ
NUOB_RHOCS      ---------------------QDAYLQAVQQEMDKGYLVARFDALMDWARTGSLWPMTFGLACCAVEMIH
NUOB_PHEZH      -------------------------------------------DLITWARTGSLMWMTFGLACCAVEMMQ
NUOB_ANAMM      ------------ENQQHQVLEQELWQGYKDRGFVVTKFSDLVDSVVRWSRSGSLWPMTFGLACCAVEMMH
NUOB_ANAMF      ------------ENQQHQVLEQELWQGYKDRGFVVTKFSDLVDSVVRWSRSGSLWPMTFGLACCAVEMMH
NDUS7_TRYBB     -----------------------------------------LHDLTEWCLAYSPWPLTFGLACCAVEMMH
NUOB_METPP      --------------------------------------------LINWSKTGSLWPMTFGLACCAVEMMH
NUOB2_NITMU     --------------------------------MEKGFVTTSLDSVINWGRTGSMWPMTFGLACCAVEMMQ
NUOB_AZOSE      -----------------------------------------LDAVINWTRTGSLWPMTFGLACCAVEMIH
NUOB_JANMA      ----------------------------IEGVLNEGFVTTTADKLINWTRTGSMWPMTFGLACCAVEMMH
NUOB_HERAR      ----------------------------IEGVLNEGFVTTTADKLINWTRTGSMWPMTFGLACCAVEMMH
NUOB_ACIF2      ----------------------------IEGILEKGFVTTSIDTVVNWSRTGSLWPMTFGLACCAVEMMH
NUOB1_AZOSB     -----------------------------------------LDAVINWTRTGSLWPMTFGLACCAVEMIH
NUOB1_ACIF5     ----------------------------IEGILEKGFVTTSIDTVVNWSRTGSLWPMTFGLACCAVEMMH
NUOB1_ACICJ     -----------------PGAEQEAVIRGITGEIGKGFVVANLDRLVNWARTGSLWPMTFGLACCAVEMIH
NUOB_VARPS      --------------------------------VMKEGFVTTTYDVVNWAKTGSLWPMTFGLACCAVEMMH
NUOB_THICR      ----------------------------IEGVLKEGVVTTSADKLINWARTGSLWPMTFGLACCAVEMMH
NUOB_LEGPC      -------------------------------ELEKKVFLTTVEKLVGWARSGSMWPMTFGLACCAVEMMH
NUOB_EHRRW      ------------------------------QSYNHRGFMTKLSDLMSWARSNSLWPMTFGLACCAVEMMH
NUOB_EHRRG      ------------------------------QSYNHRGFMTKLSDLMSWARSNSLWPMTFGLACCAVEMMH
NUOB_BURVG      --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB_BURTA      --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB_BURS3      --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB_BURM1      --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB_BURCM      --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB_BURCJ      --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB_BURCH      --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB_BURCC      --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB_BURCA      --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB_BURA4      --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB1_BURPS     --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB1_BURP6     --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB1_BURP1     --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB1_BURP0     --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB1_BURMS     --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB1_BURMA     --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB1_BURM9     --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB1_BURM7     --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB_RALEJ      ----------------------------IEGVLNEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMH
NUOB_POLNA      --------------------------------VFKEGFVTTSYDVVNWAKTGSLWPMTFGLACCAVEMMH
NUOB_LEPCP      --------------------------------------------LINWSKTGSLWPMTFGLACCAVEMMH
NUOB_EHRCR      -------------------------------------FSDLINYISNWARSNSLWPMTFGLACCAVEMMH
NUOB_ALHEH      --------------------------------------------VINWARTGSMWPMTFGLACCAVEMMQ
NUOB2_NITOC     ----------------------------IEGVLERGVVTTTADKLINWARTGSLWPMTFGLACCAVEMMH
NUOB_RALME      ----------------------------IEGVLNEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMH
NUOB_RALEH      ----------------------------IEGVLNEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMH
NUOB_POLSJ      ----------------------------LEGVFNEGFMTTSYDSVVNWAKTGSLWPMTFGLACCAVEMMH
NUOB_CUPTR      ----------------------------IEGVLNEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMH
NUOB_RALSO      ----------------------------IEGVLNEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMH
NUOB_RALPJ      ----------------------------IEGVLNEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMH
NUOB_BURXL      --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB_BURPP      --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB_BURP8      --------------------------------------------LINWTRTGSLWPMTFGLACCAVEMMH
NUOB_LARHH      ----------------------------IEGVLEKGFITTSADKVLNWTRTGSLWPMTFGLACCAVEMMH
NDUS7_NEUCR     -----------------------------------------LDSIVNWARQSSLWPMTFGLACCAVEMMH
NUOB1_CHRVO     --------------------------------------------LINYTRTGSLWPMTFGLACCAVEMMH
NUOB_XYLFT      IDRLMTNPIPDGQVDDILRPQGE---SPLLQ---KGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMH
NUOB_XYLF2      IDRLMTNPIPDGQVDDILRPQGE---SPLLQ---KGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMH
NUOB_XANCP      ---------PEGEN---PLLEKGYVTTSVDA-------------LLNWARTGSMWPMTFGLACCAVEMMH
NUOB_XANCB      ---------PEGEN---PLLEKGYVTTSVDA-------------LLNWARTGSMWPMTFGLACCAVEMMH
NUOB_XANC8      ---------PEGEN---PLLEKGYVTTSVDA-------------LLNWARTGSMWPMTFGLACCAVEMMH
NUOB_NEIMF      ----------------------------IEGVLKKGFITTSADTVLNYMRTGSLWPVTFGLACCAVEMMH
NUOB_NEIMB      ----------------------------IEGVLKKGFITTSADTVLNYMRTGSLWPVTFGLACCAVEMMH
NUOB_NEIG2      ----------------------------IEGVLKKGFITTSADTVLNYMRTGSLWPVTFGLACCAVEMMH
NUOB_LEGPL      -------------------------------ELEKKGFLTTVEKLVGWARSGSMWPMTFGLACCAVEMMH
NUOB_LEGPH      -------------------------------ELEKKGFLTTVEKLVGWARSGSMWPMTFGLACCAVEMMH
NUOB_LEGPA      -------------------------------ELEKKGFLTTVEKLVGWARSGSMWPMTFGLACCAVEMMH
NUOB_ANAPZ      -------------------------------------FSDLIERVLKWARSGSLWPMTFGLACCAVEMMH
NUOB_XYLFM      IDRLMTNPIPDGQVDDILRPQGE---SPLLQ---KGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMH
NUOB_XYLFA      IDRLMTNPIPDGQVDDILRPQGE---SPLLQ---KGYVTTSVDALLNWARTGSMWPMTFGLACCAVEMMH
NUOB_STRMK      ---------PEGDN---PLLEKGFVTTSVDA-------------LLNWARTGSMWPMTFGLACCAVEMMH
NUOB_STRM5      ---------PEGDN---PLLEKGFVTTSVDA-------------LLNWARTGSMWPMTFGLACCAVEMMH
NUOB_XANOR      ---------PEGEN---PLLEKGYVTTSVDA-------------LLNWARTGSMWPMTFGLACCAVEMMH
NUOB_XANOP      ---------PEGEN---PLLEKGYVTTSVDA-------------LLNWARTGSMWPMTFGLACCAVEMMH
NUOB_XANOM      ---------PEGEN---PLLEKGYVTTSVDA-------------LLNWARTGSMWPMTFGLACCAVEMMH
NUOB_XANC5      ---------PEGEN---PLLEKGYVTTSVDA-------------LLNWARTGSMWPMTFGLACCAVEMMH
NUOB_XANAC      ---------PEGEN---PLLEKGYVTTSVDA-------------LLNWARTGSMWPMTFGLACCAVEMMH
NUOB_ROSDO      ---------------------REVATQELNRELDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMMH
NUOB_OLICO      ---------PVGADDRYFLEINHELSD-------KGFFVAAADDLITWARTGSLMWMTFGLACCAVEMMQ
NUOB_NEIG1      ----------------------------IEGVLKKGFITTSADTVLNHMRTGSLWPVTFGLACCAVEMMH
NDHK_MORIN      ----------------------------------------------------------YGTSCCFIEFAS
NUOB_WOLWR      ---------------------------------------GDLTDYVNWARSGSLWPMTFGLACCAVEMMH
NUOB_WOLPM      ---------------------------------------GDLTDYVNWARSGSLWPMTFGLACCAVEMMH
NUOB_SPHWW      ----------------------------LQAEVNKGFLVTSAEELFQWARTGSLWWMTFGLACCAVEMIH
NUOB_FRAP2      ---------------------------------NKGFITASADALINWVRTGSLWPVTTGLACCAVEMMH
NUOB_BRASB      ---------PIGANDPYFLEVRHELSD-------KGFFVATADDLITWARTGSLMWMTFGLACCAVEMMQ
NUOB_BORPD      ---------------------------------------------LNWAKTGSMWPMTFGLACCAVEMMH
NUOB_WOLPP      --------------------------------------------IMNWARSGSLWPMTFGLACCAVEMMH
NUOB_FRATW      ---------------------------------NKGFITASADALINWVRTGSLWPVTTGLACCAVEMMH
NUOB_FRATT      ---------------------------------NKGFITASADALINWVRTGSLWPVTTGLACCAVEMMH
NUOB_FRATO      ---------------------------------NKGFITASADALINWVRTGSLWPVTTGLACCAVEMMH
NUOB_FRATN      ---------------------------------NKGFITASADALINWVRTGSLWPVTTGLACCAVEMMH
NUOB_FRATM      ---------------------------------NKGFITASADALINWVRTGSLWPVTTGLACCAVEMMH
NUOB_FRATH      ---------------------------------NKGFITASADALINWVRTGSLWPVTTGLACCAVEMMH
NUOB_FRATF      ---------------------------------NKGFITASADALINWVRTGSLWPVTTGLACCAVEMMH
NUOB_FRAT1      ---------------------------------NKGFITASADALINWVRTGSLWPVTTGLACCAVEMMH
NUOB_DECAR      --------------------------------------------LINYMRTGSLWPMTFGLACCAVEMIH
NUOB_WOLTR      ---------------------------------------GSLIDVINWARSGSLWPMTFGLACCAVEMMH
NUOB_THIDA      ----------------------------------------KADQLINYMRTGSMWPMTFGLACCAVEMMQ
NUOB_BORA1      ---------------------------------------------INWAKTGSMWPMTFGLACCAVEMMH
NUOB2_BURP1     -------------------------------------------------QKNSLWYMTFGLARCAVEMMH
NUOB_SPHAL      --------------------------DDLSGEVDKGFLVTSTEDLFNWARTGSLWWMTFGLACCAVEMIH
NUOB_SILST      ---------------------KEMVTQALNAELDKGFLLTSAEDIINWARTGSLHWMTFGLACCAVEMMH
NUOB_NEIMA      ----------------------------IEGVLKKGFITTSADTVLNYMRTGSLWPVTFGLACCAVEMMH
NUOB_ERYLH      ----------------------------LQTEVNKGFLVTSTEDLFQWARTGSLWWMTFGLACCAVEMIH
NUOB_NITWN      ---------PVGASDPYFLEVNHELSD-------KGFFVAAADDLITWARTGSLMWMTFGLACCAVEMMQ
NUOB_BORPE      ---------------------------------------------LNWAKTGSMWPMTFGLACCAVEMMH
NUOB_BORPA      ---------------------------------------------LNWAKTGSMWPMTFGLACCAVEMMH
NUOB_BORBR      ---------------------------------------------LNWAKTGSMWPMTFGLACCAVEMMH
NUOB_NITHX      ---------PVGAGDPYFLEVNHELSD-------KGFFVAATDDLITWARTGSLMWMTFGLACCAVEMMQ
NUOB_BRASO      ---------PVGAHDPYFLEVKHELSD-------KGFFVATADDLITWARTGSLMWMTFGLACCAVEMMQ
NUOB_BRAJA      ---------PVGANDPFFLEVNSELSD-------KGFFVAATDDLITWARTGSLMWMTFGLACCAVEMMQ
NUOB_SILPO      ---------------------KEVATQALNAELDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMMH
NUOB_NOVAD      --------------------------DSLNAEVNKGFLVTSTEELFQWARTGSLWWMTFGLACCAVEMIH
NUOB_CAUCR      -----------------------------QQLADKGFITAAADDLITWARTGSLMWMTFGLACCAVEMMQ
NUOB_CAUCN      -----------------------------QQLADKGFITAAADDLITWARTGSLMWMTFGLACCAVEMMQ
NUOB_CAUSK      ------------------------------QLADKGFVTAAADDLITWARTGSLMWMTFGLACCAVEMMH
NQO6_PARDP      ---------------------RDLATAELNRELDKGFLLTTTEDIINWARNGSLHWMTFGLACCAVEMMQ
NUOB_PELUB      ----------------------------LAEDFSKNGFITSLDNLINWSRAGSLHWMTFGLACCAVEMMQ
NUOB1_RHOPT     -------IDPNGADDPFFLNVNRELSD-------KGFFVAATDDLITWARTGSLMWMTFGLACCAVEMMQ
NUOB1_RHOPA     -------IDPNGADDPFFLNVNRELSD-------KGFFVAATDDLITWARTGSLMWMTFGLACCAVEMMQ
NUOB_PARL1      -----------------------------DQLADKGFVLTTVDDLINWSRTGSLMWMTFGLACCAVEMMQ
NUOB_AGRRK      --------------------------DPFFGEINKGFLVTSTDELINWARTGSLMWMTFGLACCAVEMMQ
NUOB2_RHOPS     -------IDPNGADDPFFLGVNRELSD-------KGFFVAATDDLITWARTGSLMWMTFGLACCAVEMMQ
NUOB2_BURPS     -------------------------------------------------QKNSLWYMTFGLACCAVEMMH
NUOB2_BURP6     -------------------------------------------------QKNSLWYMTFGLACCAVEMMH
NUOB2_BURP0     -------------------------------------------------QKNSLWYMTFGLACCAVEMMH
NUOB2_BURMS     -------------------------------------------------QKNSLWYMTFGLACCAVEMMH
NUOB2_BURMA     -------------------------------------------------QKNSLWYMTFGLACCAVEMMH
NUOB2_BURM9     -------------------------------------------------QKNSLWYMTFGLACCAVEMMH
NUOB2_BURM7     -------------------------------------------------QKNSLWYMTFGLACCAVEMMH
NUOB1_RHOSK     -------------------------TQSLNRELDKGFLLTTTEDLINWARTGSLHWMTFGLACCAVEMMH
NUOB1_RHOS4     -------------------------TQSLNRELDKGFLLTTTEDLINWARTGSLHWMTFGLACCAVEMMH
NUOB1_RHOS1     -------------------------TQSLNRELDKGFLLTTTEDLINWARTGSLHWMTFGLACCAVEMMH
NQO6_PARDE      ---------------------RDLATAELNRELDKGFLLTTTEDIINWARNGSLHWMTFGLACCAVEMMQ
NUOB_RHILO      -------IDPNGEDDPFFLEINNELAD-------KGFLVTSTEALITWARSGSLMFMTFGLACCAVEMIH
NUOB_RHIL3      --------------------------DPFFGEINKGFLVTSTDELINWARTGSLMWMTFGLACCAVEMMQ
NUOB_JANSC      ---------------------REVGTQALNRELDKGFLVTSSEDIINWARTGSLHWMTFGLACCAVEMMH
NUOB_METSB      ---------PLAANDPYFLSINDKLAD-------KGFLVTSTDELINWARTGSLMWMTFGLACCAVEMMQ
NUOB_HYPNA      -----------------------------DQLADKGYFTAAADDLISWARTGSLMWMTFGLACCAVEMMH
NUOB_MARMM      ---------------------------------DKGFVVAAADDLVTWARTGSLMWMTFGLACCAVEMMQ
NUOB_DINSH      ---------------------KEHATQLLNNELDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVEMMH
NUOB_RHOCA      ---------------------------------DKGFLLTTAEDIINWARNGSLHWMTFGLACCAVEMMH
NUOB2_RHIEC     -------------NFQFPGQQRQ--GDPTMGTINKGFLVTSTDELITWARTGSLMWMTFGLACCAIEMMQ
NUOB_RHILW      ---------------------------------DKGFLVTSTDELINWARTGSLMWMTFGLACCAVEMMQ
NUOB_MESSB      -------IDPNTGN---PVGANDPFYGAINEELSDKGFLVTSSELITWARTGSLMWMTFGLACCAVEMMH
NUOB1_RHIEC     ---------------------------------DKGFLVTSTDELINWARTGSLMWMTFGLACCAVEMMQ
NUOB1_RHIE6     ---------------------------------DKGFLVTSTDELINWARTGSLMWMTFGLACCAVEMMQ
NUOB_BARBK      -------IDPNGANDQFFQDMNAELSD-------KGFLVTSVDSLITWARTGSLMWMSFGLACCAVEMMQ
NUOB2_SYMTH     ----------------------EVVVSEIDV-VNENVIAGKLPDVIKWGYGNSTWPLGFGXXXXXXXXXX
NUOB_BEII9      -----------------------------DQLADKGFLVTSTDELINWARTGSLMWMTFGLACCAVEMMQ
NUOB1_RHIME     ---------------------------------DKGFLVTSTDELINWARTGSLMWMTFGLACCAVEMMQ
NUOB_METS4      -------------------------TDPTFLSINRGFLLTTADDLITWARTGSLMWMTFGLACCAVEMMQ
NUOB_METNO      -------------------------TDPTFLSINRGFLLTTADDLITWARTGSLMWMTFGLACCAVEMMQ
NUOB_BARHE      -------IDPNGSDDRFFCE--------VNAELSEKGFLVTSADLITWARTGSLMWMSFGLACCAIEMMQ
NUOB_SINMW      ---------------------------------DKGFLVTSTDELITWARTGSLMWMTFGLACCAVEMMQ
NUOB_BART1      -------IDPNGSDDRFFRDINAELSD-------KGFLVTSADALITWARTGSLMWMSFGLACCAIEMMQ
NUOB_METRJ      -------------------------------------------ELINWARTGSLMWMTFGLACCAVEMMQ
NUOB_BARQU      -------IDPNGSDDRFFHDINAELSD-------KGFLVTSADALITWARTGSLMWMSFGLACCAIEMMQ
NUOB_OCHA4      -----------------PVGSDDAFFNDLNSELSDKGFIVTSADLITWARTGSLMWMTFGLACCAVEMMH
NUOB_METPB      -------------------------------------------ELINWARTGSLMWMTFGLACCAVEMMQ
NUOB_METEP      -------------------------------------------ELINWARTGSLMWMTFGLACCAVEMMQ
NUOB_METC4      -------------------------------------------ELINWARTGSLMWMTFGLACCAVEMMQ
NUOB_BRUSU      -----------------PVGSDDAFFNDLNGELSDKGFIVTSADLITWARTGSLMWMTFGLACCAVEMMH
NUOB_BRUSI      -----------------PVGSDDAFFNDLNGELSDKGFIVTSADLITWARTGSLMWMTFGLACCAVEMMH
NUOB_BRUO2      -----------------PVGSDDAFFNDLNGELSDKGFIVTSADLITWARTGSLMWMTFGLACCAVEMMH
NUOB_BRUME      -----------------PVGSDDAFFNDLNGELSDKGFIVTSADLITWARTGSLMWMTFGLACCAVEMMH
NUOB_BRUMB      -----------------PVGSDDAFFNDLNGELSDKGFIVTSADLITWARTGSLMWMTFGLACCAVEMMH
NUOB_BRUC2      -----------------PVGSDDAFFNDLNGELSDKGFIVTSADLITWARTGSLMWMTFGLACCAVEMMH
NUOB2_RHOS5     ---------------------------------DKGFLLTTTEDLINWARTGSLHWMTFGLACCAVEMMH
NUOB_BRUAB      --------------------------------------------LITWARTGSLMWMTFGLACCAVEMMH
NUOB_BRUA2      --------------------------------------------LITWARTGSLMWMTFGLACCAVEMMH
NUOB_BRUA1      --------------------------------------------LITWARTGSLMWMTFGLACCAVEMMH
NUOB_AGRVS      ---------------------------------NDSTFFGEINDLITWARTGSLMWMQFGLACCAVELMQ
HYCG_ECOLI      -----------------------------------------------------------GCNGCEIEIFA
Y516_METJA      -----------------------------------------------------------GCNGCDIEIVA
HYFI_ECOLI      -----------------------------------------------------------GCNACEIEIFA
Y1363_METJA     --------------------------------------------------------YTGGCNACDIEVVN
FRHG_METJA      ----------------------------------------------------------------------
FRHG_METBF      ----------------------------------------------------------------------
FRHG_METTH      ----------------------------------------------------------------------
FRHG_METVO      ----------------------------------------------------------------------
MVHG_METTH      ----------------------------------------------------------------------
VHUG_METJA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SALTY      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SALTI      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SALSV      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SALPK      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SALPC      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SALPB      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SALPA      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SALNS      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SALHS      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SALG2      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SALEP      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SALDC      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SALCH      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SALAR      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SALA4      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SHISS      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SHIFL      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SHIF8      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SHIBS      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SHIB3      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ESCF3      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECOUT      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECOSM      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECOSE      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECOLU      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECOLI      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECOLC      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECOL6      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECOL5      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECOK1      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECOHS      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECODH      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECOBW      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECO8A      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECO81      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECO7I      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECO5E      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECO57      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECO55      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECO45      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECO27      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ECO24      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SHIDS      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_KLEP7      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_KLEP3      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_CITK8      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_ENT38      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_SERP5      SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_ENTS8      SFTAVHDVARFGAEVLRASPRQADFMVVAGTPFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_PHOLL      SFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_EDWI9      SFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_PROMH      SFTAVHDVARFGSEVLRASPRQADFMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_YERPY      SFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_YERPS      SFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_YERPP      SFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_YERPN      SFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_YERPG      SFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_YERPE      SFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_YERPB      SFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_YERPA      SFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_YERE8      SFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_ERWT9      SFTAVHDVARFGSEVIRASPRQADFMVVAGTCFTKMAPVVQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_PECCP      SFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_PECCC      SFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_ERWCT      SFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_YERP3      SFTAVHDVARFGAEVLRASPRQADFMVVAGTCFTKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_SODGM      SFTAVHDVARFGSEVIRASPRQADFMVVAGTPFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_PSEFS      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFIKMAPIIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_PSEPF      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFIKMAPIIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_PSEU2      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFIKMAPIIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_PSESM      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFIKMAPIIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_PSE14      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFIKMAPIIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_PSEF5      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFIKMAPIIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_PSEMY      AFTAPHDVARFGAEVIRASPRQADFMVIAGTCFIKMAPVIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_PSEA7      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFIKMAPVIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_PSEAE      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFIKMAPVIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_PSEAB      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFIKMAPVIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_PSEA8      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFIKMAPVIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_AZOVD      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFIKMAPIIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_PSEPK      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFVKMAPIIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_PSEP1      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFVKMAPIIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_SHEON      AFTSPHDVARFGAEVIRASPRQADFMVIAGTPFIKMAPVIQRLYEQLLEPKWVISMGACANSGGMYDIYS
NUOB_PSEPG      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFVKMAPIIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_PSEE4      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFVKMAPIIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_PSEPW      AFTAPHDIARFGAEVIRASPRQADFMVIAGTCFIKMAPIIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_AERS4      AFTSPHDVARFGAEVIRASPRQADFMVIAGTPFIKMAPVIQRLYEQLLEPKWVISMGACANSGGMYDIYS
NUOB_AERHH      AFTSPHDVARFGAEVIRASPRQADFMVIAGTPFIKMAPVIQRLYEQLLEPKWVISMGACANSGGMYDIYS
NUOB_TOLAT      AFTAVHDVARFGAEVIRASPRQADFMVIAGTPFIKMAPVIQRLYEQLLEPKWVISMGACANSGGMYDIYS
NUOB_BLOPB      AFTAIHDVARFGSEVLRASPRQADFMVIAGTPFLKMVPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_CHRSD      AFTAPHDVARFGSEVIRASPRQADFMVIAGTCFIKMAPVIQQLYDQMLEPKWVISMGSCANSGGMYDIYS
NUOB_BUCAT      AFTSVHDVARFGSEVLRASPRQADVMVIAGTPFIKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_BUCAI      AFTSVHDVARFGSEVLRASPRQADVMVIAGTPFIKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_BUCA5      AFTSVHDVARFGSEVLRASPRQADVMVIAGTPFIKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_BAUCH      SFTAVHDVARFGSEVIRASPRQADFMVIAGTPFIKMAPVIKRLYDQMLEPKWVISMGSCANSGGMYDIYS
NUOB_ACIBY      TLTGVHDLSRFGAEVIRASPRQADLMIVAGTCFVKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_ACIBT      TLTGVHDLSRFGAEVIRASPRQADLMIVAGTCFVKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_ACIBS      TLTGVHDLSRFGAEVIRASPRQADLMIVAGTCFVKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_ACIBC      TLTGVHDLSRFGAEVIRASPRQADLMIVAGTCFVKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_ACIB5      TLTGVHDLSRFGAEVIRASPRQADLMIVAGTCFVKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_ACIB3      TLTGVHDLSRFGAEVIRASPRQADLMIVAGTCFVKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_PSYWF      TLTAVHDLSRFGAEVIRASPRQADVMIVAGTCFVKMAPVIQRLYEQMLEPKWVISMGSCANSGGMYDIYS
NUOB_PSYCK      TLTAVHDLSRFGAEVIRASPRQADVMIVAGTCFVKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_PSYA2      TLTAVHDLSRFGAEVIRASPRQADVMIVAGTCFVKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_ACIAD      TLTGVHDLSRFGAEVIRASPRQADLMIVAGTCFVKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYS
NUOB_BLOFL      AFTAVHDVARFGSEVLRSSPRQSDFMVIAGTPFLKMVPIIQRLYDQMLEPKWVISMGSCANSGGMYDIYS
NUOB_BUCAP      AFTSVHDVARFGSEVLRASPRQADVMVIAGTPFIKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
NUOB_BUCBP      SFTSVHDISRFGSEVLRASPRQADFMVIAGTPFIKMVPIIQRLYDQMLEPKWVISMGSCANSGGMYDIYS
NUOB_BUCCC      AFTSIHDISRFGSEVLRTSPRQADFMVIAGTPFIKMAPVIQRLYDLMLEPKWVISMGSCANSGGMYDIYS
NUOB1_NITMU     SFTSKYDLARFGSEVIRASPRQADLIVISGTVFIKMAPVLQRLYDQMLEPRWVISMGSCANSGGMYDIYS
NUOB1_NITOC     SFTSKYDIARFGAEVIRATPREADLMVISGTVFIKMAPVIKRLYEQMMEPRWVISMGSCANSGGMYDIYS
NUOB_METCA      AFTSRFDIARFGSEVIRASPRQADLMVISGTVFRKMAPVVKHLYDQLLEPKWIISMGSCANSGGMYDIYS
NUOB2_ACICJ     AFTSKFDIARFGSEVLRATPREADLIVISGTVFVKMAPVIKYLYDQMLEPRWVISMGACANSGGMYDIYA
NUOB1_GLUDA     AFTSKYDIARFGSEVLRATPREADLIVISGTVFVKMAPIVKYLYDQMLEPRWVISMGSCANSGGMYDIYS
NUOB_SHEWM      SFTSRHDIARFGSEVIRATPREADLIVISGTVFLKMAPVIKHLYDQMLEPKWVICMGSCANSGGMYDVYS
NUOB2_RHOSK     ALTPVYDQARFGAEVIRSTPRQADLLIVSGTVFRKMAVPLYRLYSQMREPRWVISMGACANSGGMYDIYS
NUOB2_RHOS4     ALTPVYDQARFGAEVIRSTPRQADLLIVSGTVFRKMAVPLYRLYSQMREPRWVISMGACANSGGMYDIYS
NUOB2_RHOS1     ALTPVYDQARFGAEVIRSTPRQADLLIVSGTVFRKMAVPLYRLYSQMREPRWVISMGACANSGGMYDIYS
NUOB1_RHOP5     ALTPVFDQARFGAEVIRASPRQADLLVVSGTVFHKMAAPLLRLYEQMRAPRWVISMGACANSGGMYDVYS
NUOB_RHOP2      ALTPVYDQARFGAEVIRASPRQADLLVVSGTVFHKMAAPLLRLYEQMRAPRWVIAMGACACSGGMYDIYS
NUBCD_GEOMG     SFTSRYDISRFGAEVLRGTPREADLMVIAGTVFKKMAPSILRLYEQMAEPKWVISMGSCANSGGMYDVYS
NUBCD_GEOBB     SFTSRYDVSRFGAEVLRGTPRESDLMVIAGTVFKKMAPSILRLYDQMAEPKWVISMGSCANSGGMYDVYS
NUOB2_RHOPB     ALTSVYDQARFGAEVIRASPRQADLLVVSGTVFHKMAAPLLRLYEQMRAPRWVISMGACANSGGMYDIYS
NUOB1_RHOS5     ALTPVYDQARFGAEVIRSTPRQADLLIVSGTVFRKMAVPLYRLYQQMREPRWVISMGACANSGGMYDIYS
NUBCD_GEOSL     SFTSRYDVSRFGAEVLRGTPREADLMVIAGTVFKKMAPSILRLYEQMAEPKWVISMGSCANSGGMYDVYS
NUBCD_GEOUR     SFTSRYDISRFGAEVLRGTPREADLMVIAGTVFKKMAPSILRLYEQMAEPRWVISMGSCANSGGMYDVYS
NUOB1_RHOPS     VLTPVYDQARFGAEVIRASPRQADLLVVSGTVFHKMAAPLLRLYEQMRAPRWVISMGACANSGGMYDIYS
NUOB2_RHOPT     VLTPVYDQARFGAEVIRASPRQADLLVVSGTVFHKMAAPLLRLYEQMRAPRWVIAMGACACSGGMYDIYS
NUOB2_RHOPA     VLTPVYDQARFGAEVIRASPRQADLLVVSGTVFHKMAAPLLRLYEQMRAPRWVIAMGACACSGGMYDIYS
NUBCD_PELCD     SMTPRFDLARFGAEVLRGTPREADLMVIAGTPFKKMAASMLRVYEEMANPKWVIAMGSCANSGGMYDVYS
NUBCD_SYNFM     AFTPRYDMARFGAEVLRPSPRQADLLIVSGTVFKKIAPVVLRLYEQMAEPKWVISMGSCSNCGGMYDVYS
NUOB_GEOUR      TGAAKHDLDRFGI-IFRASPRQSDCIIIAGTVTKKMLPVIKTVYEQMPEPKWVIAMGACACSGGVFDTYS
NUOB_GEOSF      TGAAKHDLDRFGI-IFRASPRQADCIIIAGTVTKKMLPVIKTVYEQMPEPKWVIAMGACACSGGVFDTYS
NUOB_CAMFF      AVSSKHDLSRFGAEVMRFSPRQADLMIIAGTISFKQAPILKEIYDQMCEPKWVVSMGACACSGGFYDNYT
NUOB_GEOSM      TGAAKHDLDRFGI-IFRASPRQADCIIIAGTVTKKMLPVIKTVYEQMPEPKWVVAMGACACSGGVFDTYS
NUOB_GEOBB      TGAAKHDLDRFGI-IFRASPRQADCIIIAGTVTKKMLPVIKTVYEQMPEPKWVVAMGACACSGGVFDTYS
NUOB_DEIDV      STNARNDMARFGSEVFRASPRQADVMIVAGRLSKKMAPVMRRVYDQMPDPKWVIAMGACASSGGMFNNYA
NUOB1_ACIBL     MGASRFDIARFGAEVFRPSPRQSDLMIIAGRVSQKMAPVIRHLYLQMPEPKWVISMGACATSGGVFNNYA
NUOB_FRASC      TGAGRYDLSRFGMEVFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMPEPKWVLSMGVCASSGGMFNNYA
NUOB_FRAAA      TGAGRYDLSRFGMEVFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMPEPKWVLSMGVCASSGGMFNNYA
NUOB_PARUW      TAASRYDLARFGMEVFRASPRQSDVMIVAGRVSQKMAPVLQTIYEQMLEPKWVIAMGDCASCGGVYNNYA
NUOB_BDEBA      VMGPKYDLARFGAEVARFSPRQADLLVVAGTITEKMAPVIVRIYQQMLEPKYVLSMGACASSGGFYRAYH
NUOB_METI4      SACARFDISRFGAEVMRFSPRQCDVMIVAGTVTYKMAYSVKRIYEQMPDPKWVISMGACASSGGMYRSYS
NUOB1_CHLSY     FGLSRYDVARFGAELFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMAEPRYVISMGACATSGGPFDGYN
NUOB1_CHLAA     FGLSRYDVARFGAELFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMAEPRYVISMGACATSGGPFDGYN
NUOB_FRASN      TGAGRYDLSRFGMEVFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMPEPKWVLSMGVCASSGGMFNNYA
NUOB2_ROSCS     TGLARFDLARFGAEMFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMPEPRYVISMGACATSGGPFDGYN
NUOB2_CHLAD     FGLSRYDVARFGAELFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMAEPRYVISMGACATSGGPFDGYN
NUOB1_ROSS1     TGLARFDLARFGAEMFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMPEPRYVISMGACATSGGPFDGYN
NUOB_GEOLS      TGASHNDLDRFGI-IFRASPRQADCIIIAGTVTKKMLPVIQTVYEQMPEPKWVIAMGACACSGGIFDTYS
NUOB_GEOMG      TGASHNDLDRFGI-IFRASPRQADCIIIAGTVTKKMLPVIQTVYEQMPEPKWVVAMGACACSGGVFDTYS
NUOB1_CHLT3     MAGPRYDIARFGAEVFRFSPRQSDLMIVAGTVTYKMATVVKKIWDQMPEPKWCIAMGACSSSGGMFRSYP
NUOB2_OPITP     AGMARFDISRFGAEVFRPSPRQADVMIVAGTVNKKMAPAVKLLYDQMLEPKWVIAMGQCAISGGPFKYYA
NUOB1_SOLUE     SSTSRFDIARFGAEVFRPSPRQSDLMIVAGTVTLKMAPVLKRIWDQMPDPKWCISMGACSSVGGPFNTYA
NUOB_GEOSL      TGASHNDLDRFGI-IFRASPRQSDCIIIAGTVTKKMLPVIKTVYEQMPEPKWVVAMGACACSGGVFDTYS
NUOB_BEUC1      TGTPRFDISRFGMEVFRASPRQADLMIVSGRVSQKMAPVVRQVYDQMSEPKWVLSMGVCASSGGMFNNYA
NUOB_BACFR      LGAARYDMARFGFEVARASPRQADMIMVCGTITNKMAPVLKRLYDQMADPKYVIAVGGCAVSGGPFKSYH
NUOB_BACFN      LGAARYDMARFGFEVARASPRQADMIMVCGTITNKMAPVLKRLYDQMADPKYVIAVGGCAVSGGPFKSYH
NUOB_ARCB4      VAGAKYDVSRFGAEVVRFSPRQADLLIVAGTISYKQAPILKKIYEQMCEPKWVISMGACACSGGFYDNYT
NUOB_ACIC1      TGAGRYDLARFGMEVFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMPEPKWVLAMGVCASSGGMFNNYA
NUOB_CLOB8      AGGARYDIARFGYEVFRASPRQADLMIVAGTITEKMAPIVKKIYDQMPEPKWVIAMGSCATSGGPFDSYN
NUOB2_SALAI     AGGPHYDMGRWGMEVFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPRWVLSMGVCASSGGMFNNYA
NUOB1_HERA2     GQASNYDMSRFGLELMRASPRQADLMIVAGRVSRKMAPVLRRLYDQMPEPKWVVAMGDCASCGGVYNNYA
NUOB2_SALTO     AGGPHYDMGRWGMEVFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPRWVLSMGVCASSGGMFNNYA
NUOB_RHOSR      TAGGRFDIARFGMEAFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMVEPKWVLAMGVCASSGGMFNNYA
NUOB_RHOOB      TAGGRFDIARFGMEAFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMVEPKWVLAMGVCASSGGMFNNYA
NUOB1_STRCO     TGAGRYDLARFGMEVFRGSPRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFNNYA
NUOB1_OPITP     VGNGRFDIARFGAEVMRFSPRQSDCMIVAGSVTYKMAPQIRRIYDQMMSPKWVIAMGACASSGGMYRSYA
NUOB2_THEYD     AGASHLDLDRFGI-LFRASPRQADVIIIAGTVTYKMAPIVKRVYDQMPEPKYVIAMGSCACTGGIFNTYS
NUOB_HELMI      TGASRFDMARFGYEVFRPSPRQADLIIIAGTLTWKMAPAIQRVYEQMPEPKWIIAMGSCACTGGPFDSYA
NUOB_DESHY      AGGPRVDISRFGYEVFRASPRHADVMIVAGTCTRKMAPLLRMIYDQMPEPKWVIAMGSCASAGGPFDSYS
NUOB_DESHD      AGGPRVDISRFGYEVFRASPRHADVMIVAGTCTRKMAPLLRMIYDQMPEPKWVIAMGSCASAGGPFDSYS
NUOB1_ROSCS     AQGANYDLSRFGMEINRASPRQADLMIVAGRVSRKMAPVVRRLYDQMADPKWVIAMGDCAACGGVFNNYA
NUOB1_STRGG     TGAGRYDLARFGMEVFRGSPRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFNNYA
NUOB_FLAJ1      TMAAHYDLARFGSERVSFSPRQADMLLVMGTISKKMAPILRQVYEQMSEPRWVIAVGACASSGGVFDTYS
NUOB_RUBXD      TGMAHNDLERFGAGFFAGSPRQADVMIVSGTVSTKMAERMTRLYEQMPEPKWVIAMGACAISGGPFDGYS
NUOB3_RHIEC     AGCARYDLDRFGV-VFRPSPRQSDVMIIAGTVTRKFAPVVRRLYDQMPEPRWVIAMGTCAISGGVYNTYA
NUOB2_RHIME     AGCARYDLDRFGV-VFRPSPRQSDVMIIAGTVTRKFAPVVRRLYDQMPEPRWVIAMGTCAISGGVYNTYA