[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF67703.1

[Show Plain Result]


## Summary of Sequence Search
    1::295
    1::295     e-141  96%  295 aa  RHTA_SALTY RecName: Full=Inner membrane transporter rhtA;
    1::294     e-131  83%  295 aa  RHTA_ECOLI RecName: Full=Inner membrane transporter rhtA;
    1::294     e-131  83%  295 aa  RHTA_ECOL6 RecName: Full=Inner membrane transporter rhtA;
    1::294     e-131  83%  295 aa  RHTA_ECO57 RecName: Full=Inner membrane transporter rhtA;
   38::282     2e-09  33%  296 aa  YWFM_BACSU RecName: Full=Uncharacterized transporter ywfM;
   95::307     2e-06  24%  329 aa  Y1319_SYNY3 RecName: Full=Uncharacterized transporter sll1319;
   69::150     3e-05  31%  305 aa  YVBV_BACSU RecName: Full=Uncharacterized transporter yvbV;
  152::262     4e-05  28%  270 aa  Y1552_ARCFU RecName: Full=Uncharacterized transporter AF_1552;
   79::161     4e-04  30%  170 aa  Y976A_HAEIN RecName: Full=Uncharacterized transporter HI0976.1;
  218::280     5e-04  33%  299 aa  EAMA_SALTY RecName: Full=Probable amino-acid metabolite efflux
   80::151     8e-04  35%  319 aa  YDED_BACSU RecName: Full=Uncharacterized transporter ydeD;
    1::295

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPGSTRKXXXXXXXXXXXXAMSSIQSGASLAKSLFPLVGAPGVTALRLALGTLILIAFFKPWRLRFAKEQ
RHTA_SALTY      MPGSTRKXXXXXXXXXXXXAMSSIQSGASLAKSLFPLVGAPGVTALRLALGTLILIAFFKPWRLRFAKEQ
RHTA_ECOLI      MPGSLRKMPVWLPIVILLVAMASIQGGASLAKSLFPLVGAPGVTALRLALGTLILIAFFKPWRLRFAKEQ
RHTA_ECOL6      MPGSLRKMPVWLPIVILLVAMASIQGGASLAKSLFPLVGAPGVTALRLALGTLILIAFFKPWRLRFAKEQ
RHTA_ECO57      MPGSLRKMPVWLPIVILLVAMASIQGGASLAKSLFPLVGAPGVTALRLALGTLILIAFFKPWRLRFAKEQ
YWFM_BACSU      --------------------------------------------AFRLLIGGSAMLLAVWISRELHVKNW
Y1319_SYNY3     ----------------------------------------------------------------------
YVBV_BACSU      ----------------------------------------------------------------------
Y1552_ARCFU     ----------------------------------------------------------------------
Y976A_HAEIN     ----------------------------------------------------------------------
EAMA_SALTY      ----------------------------------------------------------------------
YDED_BACSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RLPLLFYGLSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPVDFIWVVLAVLGLWFLLPLGQ
RHTA_SALTY      RLPLLFYGLSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPVDFIWVVLAVLGLWFLLPLGQ
RHTA_ECOLI      RLPLLFYGVSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPVDFVWVVLAVLGLWFLLPLGQ
RHTA_ECOL6      RLPLLFYGVSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPVDFVWVVLAVLGLWFLLPLGQ
RHTA_ECO57      RLPLLFYGVSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPVDFVWVVLAVLGLWFLLPLGQ
YWFM_BACSU      AWPLVFLAVCMACYQPLFFTAVKETGIAVGTVIAIAGTLEWAVLK-KRPRNSWWIVLALAGCWLLFSDSS
Y1319_SYNY3     --PVIWEAMGCGFLMFLYYISISFIPTGIAITLFFTYPIFTALLAWRLPSLLRWLVLTLIGTFLTIPYGE
YVBV_BACSU      ----------------------------------------------------------------------
Y1552_ARCFU     ----------------------------------------------------------------------
Y976A_HAEIN     ----------------------------------------------------------------------
EAMA_SALTY      ----------------------------------------------------------------------
YDED_BACSU      ---LIFGLLGMLAVQYTYMASIQHGNAAVATLLQYLSPVIVIIYTLLRKQDIITVVLALVGCFFLLTNG-


                         +         .         .         .         .         *         .:210
query           DMSHVDXXXXXXXXXXXXCWAVYILTGQRAGAEHGPATVAVGSLIAAIIFVPIGAVQAGDALWHWSILPL
RHTA_SALTY      DMSHVDXXXXXXXXXXXXCWAVYILTGQRAGAEHGPATVAVGSLIAAIIFVPIGAVQAGDALWHWSILPL
RHTA_ECOLI      DVSHVDLTXXXXXXXXXXXWAIYILSGQRAGAEHGPATVAIGSLIAALIFVPIGALQAGEALWHWSVIPL
RHTA_ECOL6      DVSHVDLTXXXXXXXXXXXWAIYILSGQRAGAEHGPATVAIGSLIAALIFVPIGALQAGEALWHWSVIPL
RHTA_ECO57      DVSHVDLTXXXXXXXXXXXWAIYILSGQRAGAEHGPATVAIGSLIAALIFVPIGALQAGEALWHWSVIPL
YWFM_BACSU      NV-RIDXXXXXXXXXXXXSFAGYTLISKAMMKTQPPATSAVVFMISAILLTPL--------LWQWILTPR
Y1319_SYNY3     QQTLV--LGVSTGIASGIVYAGYTVFAQRSFQRLHPVPFTWISFATTXXXXXXXXXQPHEGNLPWLAITI
YVBV_BACSU      --------------------------------------------------------------------PI
Y1552_ARCFU     -------------------YAIVFVLSKEARKKHSPWRITLGSAALLPYFLMFGRVGS----WLWAI---
Y976A_HAEIN     --------------------------------------------------------------WQISLNST
EAMA_SALTY      ----------------------------------------------------------------------
YDED_BACSU      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GLAVAVLSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTGIQIMALCAIIAASMGST
RHTA_SALTY      GLAVAVLSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTGXXXXXXXXXXXXSMGST
RHTA_ECOLI      GLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPXXXXXXXXXXXXSMGST
RHTA_ECOL6      GLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPXXXXXXXXXXXXSMGST
RHTA_ECO57      GLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPXXXXXXXXXXXXSMGST
YWFM_BACSU      GLGIGLIATCAAYFLFAKGLTGVPASAAVTLSLAEPLTASLLGVFFIGEMLSGIALMMLGLLVISA----
Y1319_SYNY3     GSLLSALFTLAGHVLNNWGIHLIGASRAAIIGATNPALTVVLAGLAIQESLTNIQIFGVCLV--------
YVBV_BACSU      YLVSALLNITLFYGLQTIGLNYLPAGLFSAIVFFQPVLMGVFSWLWLGESMFVMKVIGLAVISAAGFGGH
Y1552_ARCFU     --GLGVVPTAVPFVLFSYGMKYVKVQRAPILALIEPLCAGLVGYFYFGETLTLTQLIGGAMILA------
Y976A_HAEIN     GIALAIGCSWLAYWLWNKGLNSVDANISGVLVALEPLFGILFAVSLLGETLSFSAALGITIIMLATLGST
EAMA_SALTY      -LYLAFVATILGYGIWGALLGRYETWRVAPLSLLVPVVGLASAAVLLGETLTGMQLAGAVLIMA------
YDED_BACSU      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LTIRREPQIKQVDVK
RHTA_SALTY      LTIRREPQIKQVDVK
RHTA_ECOLI      LTVRKESKIKELDI-
RHTA_ECOL6      LTVRKESKIKELDI-
RHTA_ECO57      LTVRKESKIKELDI-
YWFM_BACSU      ---------------
Y1319_SYNY3     ---------------
YVBV_BACSU      ISV------------
Y1552_ARCFU     ---------------
Y976A_HAEIN     L--------------
EAMA_SALTY      ---------------
YDED_BACSU      ---------------