[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF67711.1

[Show Plain Result]


## Summary of Sequence Search
    1::404
    1::404       0.0  95%  406 aa  FABB_ECOLI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::404       0.0  95%  406 aa  FABB_ECOL6 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::403     e-147  69%  406 aa  FABB_HAEIN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::406     e-137  63%  407 aa  FABB_BUCAP RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::405     e-135  59%  407 aa  FABB_BUCBP RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   17::405     e-114  53%  406 aa  FABB_BUCAI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::412     2e-62  38%  414 aa  FABF_COXBU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::413     1e-60  38%  415 aa  FABF_VIBHA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::410     2e-60  41%  413 aa  FABF_BACSU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::417     4e-57  36%  421 aa  FABF_RHIME RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::414     2e-56  36%  414 aa  FABF_VIBCH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::411     8e-56  38%  414 aa  FABF_STAAW RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::411     8e-56  38%  414 aa  FABF_STAAS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::411     8e-56  38%  414 aa  FABF_STAAC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::411     1e-55  38%  414 aa  FABF_STAAN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::411     1e-55  38%  414 aa  FABF_STAAM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    6::411     3e-55  38%  414 aa  FABF_STAAR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::403     3e-54  38%  403 aa  FABF_STAAU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::413     7e-54  34%  413 aa  FABF_SHIFL RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::413     7e-54  34%  413 aa  FABF_ECOLI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::413     7e-54  34%  413 aa  FABF_ECOL6 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::413     7e-54  34%  413 aa  FABF_ECO57 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::423     3e-50  34%  426 aa  OXSM_SCHPO RecName: Full=Putative 3-oxoacyl-[acyl-carrier-protein]
   48::456     3e-48  35%  462 aa  KASC1_HORVU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   61::466     3e-48  35%  473 aa  KASC1_ARATH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::414     2e-45  34%  416 aa  FABF_SYNY3 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   42::459     8e-45  33%  459 aa  OXSM_HUMAN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase,
   37::461     8e-45  34%  461 aa  KASM_ARATH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase,
    3::402     1e-44  35%  402 aa  NODE_RHIME RecName: Full=Nodulation protein E;AltName:
   14::412     9e-44  33%  417 aa  FAB2_MYCTU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   14::412     9e-44  33%  417 aa  FAB2_MYCBO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   42::454     1e-43  34%  459 aa  OXSM_MOUSE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase,
   17::415     4e-43  32%  420 aa  FAB2_MYCLE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   19::401     2e-42  34%  401 aa  NODE_RHILT RecName: Full=Nodulation protein E;AltName:
    3::401     8e-42  32%  401 aa  NOE4_RHIME RecName: Full=Nodulation protein E;AltName:
   43::455     2e-40  31%  460 aa  OXSM_BOVIN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase,
   24::411     3e-40  33%  416 aa  FAB1_MYCTU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   24::411     3e-40  33%  416 aa  FAB1_MYCBO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   24::411     1e-38  32%  416 aa  FAB1_MYCLE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    3::402     1e-34  31%  403 aa  NODE_RHILV RecName: Full=Nodulation protein E;AltName:
    6::408     5e-34  29%  415 aa  PKSF_BACSU RecName: Full=Polyketide biosynthesis malonyl-ACP
   25::414     2e-33  33%  422 aa  KAS1_STRCN RecName: Full=Putative polyketide beta-ketoacyl synthase
    3::438     2e-32  31%  442 aa  CEM1_YEAST RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   46::458     3e-32  31%  467 aa  KASA_STRCO RecName: Full=Actinorhodin polyketide putative
    4::415     1e-31  28%  423 aa  KAS1_STRCO RecName: Full=Putative polyketide beta-ketoacyl synthase
    7::420     4e-30  30%  426 aa  KAS1_STRGA RecName: Full=Tetracenomycin C polyketide putative
   27::402     4e-28  29%  402 aa  NODE_RHIS3 RecName: Full=Nodulation protein E;AltName:
    4::412     7e-28  27%  420 aa  KAS1_STRCM RecName: Full=Putative polyketide beta-ketoacyl synthase
  137::380     1e-26  37%  422 aa  KAS1_STRHA RecName: Full=Putative polyketide beta-ketoacyl synthase
   17::416     8e-26  29%  421 aa  KAS1_STRVN RecName: Full=Granaticin polyketide putative
    8::418     3e-23  31%  425 aa  KAS1_STRRM RecName: Full=Oxytetracycline polyketide putative
  149::431     1e-19  30% 2531 aa  PKS26_DICDI RecName: Full=Probable polyketide synthase 26;       
    1::405     1e-18  29% 2513 aa  FAS_BOVIN RecName: Full=Fatty acid synthase;       
   88::405     3e-18  29% 2512 aa  FAS_CHICK RecName: Full=Fatty acid synthase;       
  106::431     5e-18  26% 2604 aa  PKS17_DICDI RecName: Full=Probable polyketide synthase 17;       
  140::431     5e-18  27% 2603 aa  PKS16_DICDI RecName: Full=Probable polyketide synthase 16;       
  145::426     1e-17  28% 2111 aa  MCAS_MYCBO RecName: Full=Mycocerosic acid synthase;       
  196::463     2e-17  25% 2837 aa  PKS3_DICDI RecName: Full=Probable polyketide synthase 3;       
    1::405     2e-17  27% 2505 aa  FAS_RAT RecName: Full=Fatty acid synthase;       
  609::928     2e-17  28% 3491 aa  ERYA1_SACER RecName: Full=Erythronolide synthase, modules 1 and 2; 
  145::457     4e-17  30% 3147 aa  PKS1_DICDI RecName: Full=Probable polyketide synthase 1;       
  123::447     4e-17  26% 2126 aa  PHAS_MYCTU RecName: Full=Phthioceranic/hydroxyphthioceranic acid
  123::447     4e-17  26% 2126 aa  PHAS_MYCTA RecName: Full=Phthioceranic/hydroxyphthioceranic acid
  123::447     4e-17  26% 2126 aa  PHAS_MYCBP RecName: Full=Phthioceranic/hydroxyphthioceranic acid
  123::447     4e-17  26% 2126 aa  PHAS_MYCBO RecName: Full=Phthioceranic/hydroxyphthioceranic acid
  140::447     4e-17  27% 3038 aa  LNKS_ASPTE RecName: Full=Lovastatin nonaketide synthase;       
    1::405     4e-17  27% 2504 aa  FAS_MOUSE RecName: Full=Fatty acid synthase;       
   88::403     7e-17  28% 2511 aa  FAS_HUMAN RecName: Full=Fatty acid synthase;       
  140::447     9e-17  27% 3038 aa  LNKS_ASPTN RecName: Full=Lovastatin nonaketide synthase;       
  182::457     1e-16  27% 1774 aa  MSAS_PENPA RecName: Full=6-methylsalicylic acid synthase;       
 1588::1912    2e-16  26% 3567 aa  ERYA2_SACER RecName: Full=Erythronolide synthase, modules 3 and 4;   
 1765::2186    3e-16  28% 5043 aa  PKSJ_BACSU RecName: Full=Polyketide synthase pksJ;         Short=PKS;
 2736::2960    1e-15  30% 5488 aa  PKSN_BACSU RecName: Full=Polyketide synthase pksN;       
  264::526     2e-15  28% 1876 aa  PPSA_MYCTU RecName: Full=Phenolpthiocerol synthesis polyketide
 2467::2734    5e-15  28% 4262 aa  PKSM_BACSU RecName: Full=Polyketide synthase pksM;
  175::462     1e-14  28% 2623 aa  PKS31_DICDI RecName: Full=Probable polyketide synthase 31;       
  154::387     2e-14  29% 2551 aa  PKS13_DICDI RecName: Full=Probable polyketide synthase 13;       
  172::472     4e-14  28% 3174 aa  PKS15_DICDI RecName: Full=Probable polyketide synthase 15;       
  153::390     5e-14  26% 2542 aa  PKS41_DICDI RecName: Full=Probable polyketide synthase 41;       
  750::1092    5e-14  25% 3971 aa  MYCA_BACSU RecName: Full=Mycosubtilin synthetase subunit A;       
  151::430     1e-13  29% 3010 aa  PKS2_DICDI RecName: Full=Probable polyketide synthase 2;       
  176::455     1e-13  26% 2380 aa  PKS25_DICDI RecName: Full=Probable polyketide synthase 25;       
  168::447     1e-13  26% 2471 aa  PKS24_DICDI RecName: Full=Probable polyketide synthase 24;       
  155::434     2e-13  25% 2779 aa  PKS21_DICDI RecName: Full=Probable polyketide synthase 21;       
    1::351     2e-13  28%  352 aa  FAS_ANSAN RecName: Full=Fatty acid synthase;       
  196::455     4e-13  26% 1538 aa  PPSB_MYCTU RecName: Full=Phenolpthiocerol synthesis polyketide
  174::456     4e-13  27% 3075 aa  PKS30_DICDI RecName: Full=Probable polyketide synthase 30;       
  143::433     5e-13  27% 3097 aa  PKS45_DICDI RecName: Full=Probable polyketide synthase 45;       
  143::433     6e-13  26% 3078 aa  PKS44_DICDI RecName: Full=Probable polyketide synthase 44;       
  176::459     8e-13  26% 3106 aa  PKS29_DICDI RecName: Full=Probable polyketide synthase 29;       
  456::750     1e-12  27% 2109 aa  PKSL1_ASPPA RecName: Full=Aflatoxin biosynthesis polyketide
  168::454     1e-12  27% 2998 aa  PKS14_DICDI RecName: Full=Probable polyketide synthase 14;       
  158::381     3e-12  28% 2552 aa  PKS40_DICDI RecName: Full=Probable polyketide synthase 40;       
  155::434     3e-12  24% 2778 aa  PKS19_DICDI RecName: Full=Probable polyketide synthase 19;       
  160::397     3e-12  27% 2485 aa  PKS10_DICDI RecName: Full=Probable polyketide synthase 10;       
 2058::2365    4e-12  27% 4538 aa  PKSL_BACSU RecName: Full=Polyketide synthase pksL;         Short=PKS;
  176::460     4e-12  25% 3078 aa  PKS34_DICDI RecName: Full=Probable polyketide synthase 34;       
  465::759     1e-11  27% 2211 aa  STCA_EMENI RecName: Full=Putative sterigmatocystin biosynthesis
  166::453     1e-11  25% 2999 aa  PKS18_DICDI RecName: Full=Probable polyketide synthase 18;       
  172::455     2e-11  25% 3127 aa  PKS33_DICDI RecName: Full=Probable polyketide synthase 33;       
 1804::2111    2e-11  22% 3519 aa  OL56_STRAT RecName: Full=Oleandomycin polyketide synthase, modules 5
  168::438     4e-11  25% 3108 aa  PKS39_DICDI RecName: Full=Probable polyketide synthase 39;       
  168::438     4e-11  25% 3133 aa  PKS38_DICDI RecName: Full=Probable polyketide synthase 38;       
  175::463     4e-11  25% 3101 aa  PKS32_DICDI RecName: Full=Probable polyketide synthase 32;       
  168::450     1e-10  23% 3172 aa  ERYA3_SACER RecName: Full=Erythronolide synthase, modules 5 and 6; 
  174::441     2e-10  24% 2690 aa  PKS28_DICDI RecName: Full=Probable polyketide synthase 28;       
  157::440     5e-10  26% 2924 aa  PKS6_DICDI RecName: Full=Probable polyketide synthase 6;       
  157::439     6e-10  26% 2513 aa  PKS7_DICDI RecName: Full=Probable polyketide synthase 7;       
  159::440     8e-10  25% 2514 aa  PKS8_DICDI RecName: Full=Probable polyketide synthase 8/35;        
  166::445     1e-09  24% 2512 aa  PKS5_DICDI RecName: Full=Probable polyketide synthase 5;       
  170::440     1e-09  24% 2684 aa  PKS27_DICDI RecName: Full=Probable polyketide synthase 27;       
 1057::1324    2e-09  29% 1559 aa  STCJ_EMENI RecName: Full=Putative sterigmatocystin biosynthesis fatty
  157::440     2e-09  25% 2931 aa  PKS9_DICDI RecName: Full=Probable polyketide synthase 9/36;        
  468::754     9e-09  26% 2157 aa  WA_EMENI RecName: Full=Conidial yellow pigment biosynthesis
  173::443     2e-08  23% 2655 aa  PKS42_DICDI RecName: Full=Probable polyketide synthase 42;       
  155::428     2e-07  25% 2499 aa  PKS23_DICDI RecName: Full=Probable polyketide synthase 23;       
  155::428     2e-07  25% 2499 aa  PKS22_DICDI RecName: Full=Probable polyketide synthase 22;       
 1261::1381    6e-07  35% 1842 aa  FAS2_SCHPO RecName: Full=Fatty acid synthase subunit alpha;       
  143::396     1e-06  24% 2968 aa  PKS37_DICDI RecName: Full=Probable polyketide synthase 37;       
  774::959     9e-06  29% 2543 aa  PKSR_BACSU RecName: Full=Polyketide synthase pksR;       
    4::372     2e-05  21%  407 aa  KASB_STRCO RecName: Full=Actinorhodin polyketide putative
   82::127     4e-05  41%  436 aa  FADI_YERPY RecName: Full=3-ketoacyl-CoA thiolase;       
   82::127     4e-05  41%  436 aa  FADI_YERPS RecName: Full=3-ketoacyl-CoA thiolase;       
   82::127     4e-05  41%  436 aa  FADI_YERPP RecName: Full=3-ketoacyl-CoA thiolase;       
   82::127     4e-05  41%  436 aa  FADI_YERPN RecName: Full=3-ketoacyl-CoA thiolase;       
   82::127     4e-05  41%  436 aa  FADI_YERPG RecName: Full=3-ketoacyl-CoA thiolase;       
   82::127     4e-05  41%  436 aa  FADI_YERPE RecName: Full=3-ketoacyl-CoA thiolase;       
   82::127     4e-05  41%  436 aa  FADI_YERPB RecName: Full=3-ketoacyl-CoA thiolase;       
   82::127     4e-05  41%  436 aa  FADI_YERPA RecName: Full=3-ketoacyl-CoA thiolase;       
   82::127     4e-05  41%  436 aa  FADI_YERP3 RecName: Full=3-ketoacyl-CoA thiolase;       
 1303::1659    6e-05  29% 1885 aa  FAS2_CANAL RecName: Full=Fatty acid synthase subunit alpha;       
   82::127     6e-05  41%  436 aa  FADI_AERS4 RecName: Full=3-ketoacyl-CoA thiolase;       
   82::127     6e-05  41%  436 aa  FADI_AERHH RecName: Full=3-ketoacyl-CoA thiolase;       
  252::364     1e-04  34%  402 aa  KAS2_STRCM RecName: Full=Putative polyketide beta-ketoacyl synthase
 1304::1616    2e-04  35% 1887 aa  FAS2_YEAST RecName: Full=Fatty acid synthase subunit alpha;       
   82::127     2e-04  37%  437 aa  FADI_PECCP RecName: Full=3-ketoacyl-CoA thiolase;       
   82::127     2e-04  37%  437 aa  FADI_ERWCT RecName: Full=3-ketoacyl-CoA thiolase;       
  267::416     3e-04  24%  424 aa  KAS2_STRCO RecName: Full=Putative polyketide beta-ketoacyl synthase
   82::127     3e-04  37%  436 aa  FADI_YERE8 RecName: Full=3-ketoacyl-CoA thiolase;       
   78::163     5e-04  39%  297 aa  MURQ_ENTS8 RecName: Full=N-acetylmuramic acid 6-phosphate etherase;
   93::127     5e-04  49%  436 aa  FADI_PHOLL RecName: Full=3-ketoacyl-CoA thiolase;       
   93::127     9e-04  46%  436 aa  FADI_PSEHT RecName: Full=3-ketoacyl-CoA thiolase;       
    1::404

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLIDRKVVRFMSD
FABB_ECOLI      MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
FABB_ECOL6      MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
FABB_HAEIN      MRRTVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPEFVEMNMRSHVAGTIKLNPSEHIDRKVFRFMGD
FABB_BUCAP      MKRVVITGFGIISSIGNNKKEVLNSLYNGISGITFSEEMKESGMRSQVWGNIKLEXXXXXXXXXIRFMNN
FABB_BUCBP      MKRVVITGLGIISSIGNNKIEVLTSLLETKSGISFSKEMERSGMRSHVWGNIKLDNQENIDRKIFRFMND
FABB_BUCAI      ----------------NNKKEVLASLYKGVSGIVSSEEMKKLGMRSAVWGNIKLESINIITQKLSRFMNN
FABF_COXBU      -RRVVITGLGVVSPLGNKVSDMWQALLAGKSGVKPITRFDASSFPTQIAAEVRFDPALVLDLKSIRKTDV
FABF_VIBHA      -RRVVVTGMGMLSPVGNTVESSWKALLEGQSGIVNIEHFDATNFSTRFAGLVKFDCTEYMSKKDARKMDL
FABF_BACSU      -KRVVVTGLGALSPLGNDVDTSWNNAINGVSGIGPITRVDAEEYPAKVAAELKFNVEDYMDKKEARKMDR
FABF_RHIME      MRRVVITGTGMVSPLGCGTEVSWARLLTGDNAARKVTEFEVEDLPAKIACRIPFNADDWMEPKEQRKVDP
FABF_VIBCH      -RRVVVTGMGMLSPVGNTVESSWKALLAGQSGIVNIEHFDTTNFSTRFAGLVKFDCEQYMSKKDARKMDL
FABF_STAAW      -KRVVITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKFNIEDHIDKKEARRMDR
FABF_STAAS      -KRVVITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKFNIEDHIDKKEARRMDR
FABF_STAAC      -KRVVITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKFNIEDHIDKKEARRMDR
FABF_STAAN      -KRVVITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKFNIEDHIDKKEARRMDR
FABF_STAAM      -KRVVITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKFNIEDHIDKKEARRMDR
FABF_STAAR      --RVVITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKFNIEDHIDKKEARRMDR
FABF_STAAU      ----VITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKFNIEDHIDKKEARRMDR
FABF_SHIFL      -RRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKFNCEDIISRKEQRKMDA
FABF_ECOLI      -RRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKFNCEDIISRKEQRKMDA
FABF_ECOL6      -RRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKFNCEDIISRKEQRKMDA
FABF_ECO57      -RRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKFNCEDIISRKEQRKMDA
OXSM_SCHPO      MKRVVITGLGAVTPLGNGVKTNWRNLIQGKSGIVSLKGFKVAGVIPRGKEKEEWNVLDYVDQGKLREVAT
KASC1_HORVU     -KRVVITGMGLASVFGSDVDTFYDRLLAGESGVGPIDRFDASSFPTRFAGQIRFSSEGYIDGKNDRRLDD
KASC1_ARATH     -KRVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRFSSEGYIDGKNERRLDD
FABF_SYNY3      -KRVVVTGLGAITPIGNTLQDYWQGLMEGRNGIGPITRFDASDQACRFGGEVKFDATQFLDRKEAKRMDR
OXSM_HUMAN      -RRVVITGIGLVTPLGVGTHLVWDRLIGGESGIVVGEEYKSIPCSVAAYDEGQFNEQNFVSKSDIKSMSS
KASM_ARATH      -------GLGMVTPLGRGVETTWRRLIDGECGIR-GLTLDDLKMKS-FDEETKLYTFDQLSSKVAAFVPY
NODE_RHIME      -RRVVITGMGGLCGLGTDTTSIWKWMREGRSAIGPLLNTELHGLKGIVGAEVKALPDHNIDRKQLVSMDR
FAB2_MYCTU      ----VVTGIAMTTALATDAETTWKLLLDRQSGIRTLDDVEEFDLPVRIGGHLLEEFDHQLTRIELRRMGY
FAB2_MYCBO      ----VVTGIAMTTALATDAETTWKLLLDRQSGIRTLDDVEEFDLPVRIGGHLLEEFDHQLTRIELRRMGY
OXSM_MOUSE      -RRVVITGIGLVTPLGVGTQLVWDRLLRGESGIVVGDEYKNIPCSVAAYHEGQFNEENFVXXXXXXXXXX
FAB2_MYCLE      ----VVTGIAMTTALATDAETTWKLLLDNQSGIRMLDDIEEFNLPVRIGGHLLEEFDHQLTRVELRRMGY
NODE_RHILT      -----------------NAASIWKEMREGPSAISITTDLYD--LEGTVGLEIKAIPEHDIPRKQLVSMDR
NOE4_RHIME      -RRVVITGMGGLCGLGTDTTSIWKWSARRRSAIGPVLNTELHGLKGIVGAEIKALPDHNIDRKQLVSMDR
OXSM_BOVIN      -RRVVITGIGLVTPLGVGTQLVWDRLVRGESGIVSLVGDEYQSIPCSVAAYVQFNEQNFVPKSDTKSMSP
FAB1_MYCTU      -------------SISPDIESTWKGLLAGESGIHALEDVTKWDLAVKIGGHLKDPVDSHMGRLDMRRMSY
FAB1_MYCBO      -------------SISPDIESTWKGLLAGESGIHALEDVTKWDLAVKIGGHLKDPVDSHMGRLDMRRMSY
FAB1_MYCLE      -------------SISPDIESTWKGLLAGESGIHVLEDITKWDLPVKIGGHLKEPVDSHMSRLDLRRMSY
NODE_RHILV      -RRVVITXXXXXXXXXTDASSIWTEMREGRSAIGPISNSEIHELKGMIGTEIKVLPQHDIDRKQLISMDR
PKSF_BACSU      LPEVVVTGVGVTASIGQGKEDFASSLLSGRHA--FDVMKRSGRQKDSRFIGAEIASLSYPDRLSKKMLRK
KAS1_STRCN      --------------------DLLSSGRTATRGITL---FDPEGLRSRIAAECDFDPLAHLDPELVERADR
CEM1_YEAST      -RRVVITGLGCVTPLGRSLSESWGNLLSSKNGLTEDYKLREKSIPSTITGKIKLLFTSQDERRTSSFIKL
KASA_STRCO      -RRVVITGVGVRAPGGNGTRQFWELLTSGRTATRRISFFDPSPYRSQVAAEADFDPVGFGPRELDR-MDR
KAS1_STRCO      -RRVAVTGIGVVAPGGIGTPQFWRLLSEGRTATRRISLFDPSGLRSQIAAECDFEPSGLATQRCDRYVQ-
KAS1_STRGA      -KRVVITGIGVRAPGGAGTAAFWDLLTAGRTATRTISLFDAAPYRSRIAGEIDFDPIGLSPRQASTY-DR
NODE_RHIS3      -------------------------MREGRSAIGPIVTSELHGLTGTIGAEIKTLPEHDIDRKQLVTMDR
KAS1_STRCM      -RRVAITGIEVLAPGGLGRKEFWQLLSEGRTGITF---FDPAPFRSKV--AAEADFCGLLSPQEVRRMDR
KAS1_STRHA      ----------------------------------------------------------------------
KAS1_STRVN      ---------------GSGTKEFWDLLTAGRTATRPISFFDASPFRSRIAGEIDFDAVGFSPREVRR-MDR
KAS1_STRRM      -RRVVITGIGVVAPGDVGTKPFWEMLTAGRTATRPISSFDASPFRSQVAAECDFDPAGLSQRQV-RAWDR
PKS26_DICDI     ----------------------------------------------------------------------
FAS_BOVIN       MEEVVITGMSGKLPESENLEEFWANLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRFDASFFAHNMD
FAS_CHICK       ----------------------------------------------------------------------
PKS17_DICDI     ----------------------------------------------------------------------
PKS16_DICDI     ----------------------------------------------------------------------
MCAS_MYCBO      ----------------------------------------------------------------------
PKS3_DICDI      ----------------------------------------------------------------------
FAS_RAT         MEEVVIAGMSGKLPESENLQEFWANLIGGVDMVTDDDRRWKAGLYGLPKRSGKLKDLSKFDASFFAHTMD
ERYA1_SACER     ----------------------------------------------------------------------
PKS1_DICDI      ----------------------------------------------------------------------
PHAS_MYCTU      ----------------------------------------------------------------------
PHAS_MYCTA      ----------------------------------------------------------------------
PHAS_MYCBP      ----------------------------------------------------------------------
PHAS_MYCBO      ----------------------------------------------------------------------
LNKS_ASPTE      ----------------------------------------------------------------------
FAS_MOUSE       MEEVVIAGMSGKLPESENLQEFWANLIGGVDMVTDDDRRWKAGLYGLPKRSGKLKDLSKFDASFFAHTMD
FAS_HUMAN       ----------------------------------------------------------------------
LNKS_ASPTN      ----------------------------------------------------------------------
MSAS_PENPA      ----------------------------------------------------------------------
ERYA2_SACER     ----------------------------------------------------------------------
PKSJ_BACSU      -----IIGISCEFPGAKNHDEFWENLRDGKESIAFKEELQRFGISKEIAENAKASIDGKISPKDAEFMDP
PKSN_BACSU      ----------------------------------------------------------------------
PPSA_MYCTU      ----------------------------------------------------------------------
PKSM_BACSU      ----------------------------------------------------------------------
PKS31_DICDI     ----------------------------------------------------------------------
PKS13_DICDI     ----------------------------------------------------------------------
PKS15_DICDI     ----------------------------------------------------------------------
PKS41_DICDI     ----------------------------------------------------------------------
MYCA_BACSU      --------------------------------------------------------------KTAKFMDP
PKS2_DICDI      ----------------------------------------------------------------------
PKS25_DICDI     ----------------------------------------------------------------------
PKS24_DICDI     ----------------------------------------------------------------------
PKS21_DICDI     ----------------------------------------------------------------------
FAS_ANSAN       MEDVVIAGIAGKLPESENLQEFWEKLLNGVDMVTEDDRRWKPGMYGLPKRNGKLKDISKFDASFFAHTMD
PPSB_MYCTU      ----------------------------------------------------------------------
PKS30_DICDI     ----------------------------------------------------------------------
PKS45_DICDI     ----------------------------------------------------------------------
PKS44_DICDI     ----------------------------------------------------------------------
PKS29_DICDI     ----------------------------------------------------------------------
PKSL1_ASPPA     -------------------------------------------------------------------MDP
PKS14_DICDI     ----------------------------------------------------------------------
PKS40_DICDI     ----------------------------------------------------------------------
PKS19_DICDI     ----------------------------------------------------------------------
PKS10_DICDI     ----------------------------------------------------------------------
PKSL_BACSU      ----------------------------------------------------------------------
PKS34_DICDI     ----------------------------------------------------------------------
STCA_EMENI      -------------------------------------------------------------------MDP
PKS18_DICDI     ----------------------------------------------------------------------
PKS33_DICDI     ----------------------------------------------------------------------
OL56_STRAT      ----------------------------------------------------------------------
PKS39_DICDI     ----------------------------------------------------------------------
PKS38_DICDI     ----------------------------------------------------------------------
PKS32_DICDI     ----------------------------------------------------------------------
ERYA3_SACER     ----------------------------------------------------------------------
PKS28_DICDI     ----------------------------------------------------------------------
PKS6_DICDI      ----------------------------------------------------------------------
PKS7_DICDI      ----------------------------------------------------------------------
PKS8_DICDI      ----------------------------------------------------------------------
PKS5_DICDI      ----------------------------------------------------------------------
PKS27_DICDI     ----------------------------------------------------------------------
STCJ_EMENI      ----------------------------------------------------------------------
PKS9_DICDI      ----------------------------------------------------------------------
WA_EMENI        ----------------------------------------------------------------------
PKS42_DICDI     ----------------------------------------------------------------------
PKS23_DICDI     ----------------------------------------------------------------------
PKS22_DICDI     ----------------------------------------------------------------------
FAS2_SCHPO      ----------------------------------------------------------------------
PKS37_DICDI     ----------------------------------------------------------------------
PKSR_BACSU      ----------------------------------------------------------------------
KASB_STRCO      ----LITGVGVVAPNGLGLAPYWSAVLDGRHGLGPVTRFDVSRYPATLAGQIDFHAPDHIPGRLLPQTDP
FADI_YERPY      ----------------------------------------------------------------------
FADI_YERPS      ----------------------------------------------------------------------
FADI_YERPP      ----------------------------------------------------------------------
FADI_YERPN      ----------------------------------------------------------------------
FADI_YERPG      ----------------------------------------------------------------------
FADI_YERPE      ----------------------------------------------------------------------
FADI_YERPB      ----------------------------------------------------------------------
FADI_YERPA      ----------------------------------------------------------------------
FADI_YERP3      ----------------------------------------------------------------------
FAS2_CANAL      ----------------------------------------------------------------------
FADI_AERS4      ----------------------------------------------------------------------
FADI_AERHH      ----------------------------------------------------------------------
KAS2_STRCM      ----------------------------------------------------------------------
FAS2_YEAST      ----------------------------------------------------------------------
FADI_PECCP      ----------------------------------------------------------------------
FADI_ERWCT      ----------------------------------------------------------------------
KAS2_STRCO      ----------------------------------------------------------------------
FADI_YERE8      ----------------------------------------------------------------------
MURQ_ENTS8      ----------------------------------------------------------------------
FADI_PHOLL      ----------------------------------------------------------------------
FADI_PSEHT      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAMRSPRGLKAVGPYVVTKAMAS
FABB_ECOLI      ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
FABB_ECOL6      ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
FABB_HAEIN      AAAYAYLSMREAIEDAGLTEDQVSND-RTGLVIGAGTGSAHNQLVACDAVRGPRGVKAIGPYAVTKTMAS
FABB_BUCAP      GSIYAFLSMEQAIKDANLQTKQYQKNPRIGIIAGSGGGFPKYHIQGIDAIRSNRGLNSVSPYIAIKAMNS
FABB_BUCBP      ASIYSYLSMKQAIEDAKLTSKMYQNNPRXXXXXXXXXXXPRCQINGVSIIKKTKRLKSVSPYTVIKSMTS
FABB_BUCAI      ASRYSFVAMMEAIKDAKIDREYYQKNPRVGLISGSGCSFSKNTLTSIHLMKNKHISKGISPYLAVKTMPS
FABF_COXBU      FVQFAMESARQAWEDSGL--EINETNPRVGVAIGSGIGGMPWIEKNYDALLTS-GPRKISPFFIPGAIIN
FABF_VIBHA      FIQYGIAAGIQALDDSGL--EITEENARVGVAIGSGIGGLDLIEAGHSALVE-KGPRKVSPFFVPSTIVN
FABF_BACSU      FTQYAVVAAKMAVEDADLTDEIA---PRVGVWVGSGIGGSQFEIF------LTKGPRRVSPFFVPMMIPD
FABF_RHIME      FIVYXXXXXXXXXXXXGWKPESDEDQXXXXXXXXXXXXXXXXXXDAGYTLRD-KGPRRISPFFIPGRLIN
FABF_VIBCH      FIQYGIAAGIQALEDSGL--EVNEENARIGVAXXXXXXXXXXXXXXHQALIE-KGPRKVSPFFVPSTIVN
FABF_STAAW      FTQYAIVAAREAVKDAQL--DINENTARIGVWIGSGGGMETFEIAHKQLM--DKGPRRVSPFFVPMLIPD
FABF_STAAS      FTQYAIVAAREAVKDAQL--DINENTARIGVWIGSGGGMETFEIAHKQLM--DKGPRRVSPFFVPMLIPD
FABF_STAAC      FTQYAIVAAREAVKDAQL--DINENTARIGVWIGSGGGMETFEIAHKQLM--DKGPRRVSPFFVPMLIPD
FABF_STAAN      FTQYAIVAAREAVKDAQL--DINDNTARIGVWIGSGGGMETFEIAHKQLM--DKGPRRVSPFFVPMLIPD
FABF_STAAM      FTQYAIVAAREAVKDAQL--DINDNTARIGVWIGSGGGMETFEIAHKQLM--DKGPRRVSPFFVPMLIPD
FABF_STAAR      FTQYAIVAAREAVKDAQL--DINENTARIGVWIGSGGGMETFEIAHKQLM--DKGPRRVSPFFVPMLIPD
FABF_STAAU      FTQYAIVAAREAVKDAQL--DINENTARIGVWIGSGGGMETFEIAHKQLM--DKGPRRVSPFFVPMLIPD
FABF_SHIFL      FIQYGIVAGVQAMQDSGL--EITEENATRXXXXXXXXXXXXXXXEENHTSLMNGGPRKISPFFVPSTIVN
FABF_ECOLI      FIQYGIVAGVQAMQDSGL--EITEENATRXXXXXXXXXXXXXXXEENHTSLMNGGPRKISPFFVPSTIVN
FABF_ECOL6      FIQYGIVAGVQAMQDSGL--EITEENATRXXXXXXXXXXXXXXXEENHTSLMNGGPRKISPFFVPSTIVN
FABF_ECO57      FIQYGIVAGVQAMQDSGL--EITEENATRXXXXXXXXXXXXXXXEENHTSLMNGGPRKISPFFVPSTIVN
OXSM_SCHPO      FTQLALTSAAEALKDARWIDIDEQEKLATGVCFGTGIGNLD-DALNENGVLNKAGIRKVSPRVISKILIN
KASC1_HORVU     CIRYCILSGKKALESAGLGAHVKLDVGRAGVLVGTGMGG--LSVF-SDGVQNEKGYRKISPFFIPYAITN
KASC1_ARATH     CLKYCIVAGKKALESANLGGDKLNTIDKRKAXXXXXXXXXXXXXFSEGVQNLEKGHRRISPFFIPYAITN
FABF_SYNY3      FCHFAVCASQQAINDAKLV--INELNADEXXXXXXXXXXXXXXXEDQQTILLDKGPSRCSPFMIPMMIAN
OXSM_HUMAN      PTIMAIGAAELAMKDSGWHPQSEADQVATGVAIGMG--MIPLEVVSETALNQTKGYNKVSPFFVPKILVN
KASM_ARATH      GSNYAVCAADEALRDAEWLPTEEEEKERTXXXXXXXXXXXCDIVEAAQLICEKR-LRRLSPFFIPKILVN
NODE_RHIME      ISVLAVIAAHEAMRQAGLSCNE-GNALRFGATVGVGLG-------GWDATKAYRTLLVDGGFTGVKAMPS
FAB2_MYCTU      LQRMSTVLSRRLWENAG-SPEVDTNRLMVSI--GTGLGSAEELVFSYDDMRA-RGMKAVSPLTVQKYMPN
FAB2_MYCBO      LQRMSTVLSRRLWENAG-SPEVDTNRLMVSI--GTGLGSAEELVFSYDDMRA-RGMKAVSPLTVQKYMPN
OXSM_MOUSE      XTIMAVGAAELALKDSGWHPKREADQVATGVAIGMG--MVPLEVISETALLQTKGYNKVSPFFVPKILIN
FAB2_MYCLE      LQRMSTVLSRRLWENAG-SPEVDTNRLMVSI--GTGLGSAEELVFSYDDMRA-RGMKAVSPLAVQKYMPN
NODE_RHILT      FSLLAVIAATEAMKQAGLSCDE-QNAHRFGAAMGLGG--PGWDTI-EETYRSILGVTRARIFTAPKGMPS
NOE4_RHIME      ISVLAVIAAHEAMRQAGLSCNE-GNALRFGATVGVGLGGWDATEKAYRPSLSTGGRTEI--FTGVKAMPS
OXSM_BOVIN      PTVMXXXXXXXXXXXXGWHPQSEADQAATGVAIGMG--MVPLEVISETALTQTKGYSKVSPFFVPKILVN
FAB1_MYCTU      VQRMGKLLGGQLWESAG-SPEV--DPDRFAVVVGTGLGGAERIVESYDLMNAG-GPRKVSPLAVQMIMPN
FAB1_MYCBO      VQRMGKLLGGQLWESAG-SPEV--DPDRFAVVVGTGLGGAERIVESYDLMNAG-GPRKVSPLAVQMIMPN
FAB1_MYCLE      VQRMSKLLSGRLWESTG-SPEV--DPDRFTVVVGTGLGGAERIVESYDLMNAG-GPRKVSPLAVQMIMPN
NODE_RHILV      FSLLAVLAAKQAMLQAGLSCNE-GNAHRFGATVGVGFG-------GWDATEKAYRTLLLGGATRTKAMPS
PKSF_BACSU      ASFSSRXXXXXXXXXXXXXXXXXXXSSRIGLVVGGSNFQQRFEVYERYQDRSG----FISPAYGLSFMDS
KAS1_STRCN      YIQFALVAADEAVTDSGI--DFGTENPRVAVSLGSAGGTTRLELVSERGQRWDVDHRAAEPELHRAFSPS
CEM1_YEAST      ALRTTY----EALHNAGLLPNDITINTSLGCLIGSGIGS--IQDIYQTSLQFHNDNKRINPYFVPKILTN
KASA_STRCO      ASQFXXXXXXXXXXXSGLDPDTLDXXEREYLLLSDSGRD-----WEVDAAWLSRHMF---DYLVPSVMPA
KAS1_STRCO      ---FALVAASEAVRDANL--DMNREDPWRXXXXXXXXXXXXXRLEHDYVLVSERGSRRSEPHLERAFTPA
KAS1_STRGA      ATQLAVVCAREALKDSGLDPAAV-NPERIGVSIGTAVGCTT----GLDREYA-RVSEGGSRWLVDHTLAT
NODE_RHIS3      FSLLAVLAAREAMRQAGLSCDE-RNAYRFGAIVGVGGS-------GWEAIEASNGARRAGVMDVPKAMPS
KAS1_STRCM      AAQFAVVTA-RAVEDSGA--ELAAHPPRIGVVVGSAVGATEYRVVSDGGRLDLVDHRYAVPHLYNYLVPS
KAS1_STRHA      ------------------------------------------------------------PHLHRAFAPS
KAS1_STRVN      ATQFAVACTRDALADSGLDTGALDPS-RIGVALGSAVASAEYLVMSDSAHLSPMMFDYLSPGVMPAEVAW
KAS1_STRRM      TMQFAYVAAREALADSGVTGEA--DPLRTGVMAGTACGMTREYAVVSDEGRLWQVDDAHGPYLYDYFVPS
PKS26_DICDI     ---------------------------------------------------------------VNHSLSN
FAS_BOVIN       PQLRLLLEVTEAIVDAGINPASIRGT-NTGVWVGVSGSE------ASEALRDPETLVGYSMVGCQRAMLA
FAS_CHICK       ----------EAILDGGINPTALRGTD-TGVWVGASG-SEALEALSQD----PEELLG---YSMTGCQRA
PKS17_DICDI     ----------EAFEDANIKPSTFRGSDTAVFIG----------MMNTDYQRCQRDISYVNPYITPGTAGS
PKS16_DICDI     -----------------------------------------------------RDISYINPYTVTGSAGS
MCAS_MYCBO      ------------------------------------------------------------PYVVTGLNNS
PKS3_DICDI      ----------------------------------------------------------------------
FAS_RAT         PQLRLLLEVSEAIVDGGINPASLRGT-NTGVWVGVSGSE------ASEALRDPETLLGYSMVGCQRAMMA
ERYA1_SACER     ---------------AGIPPTSLQASPTVGLIP---------QEYGP---RLAEGGEGVEGYLMTGTTTS
PKS1_DICDI      ---------------------------------------------------------SISPYTMTGSNSS
PHAS_MYCTU      ----------EAMEHAGLTQQTLAGSA-TGVFAGVTHGD--YTMVAADAKQLEE------PYGYLGNSFS
PHAS_MYCTA      ----------EAMEHAGLTQQTLAGSA-TGVFAGVTHGD--YTMVAADAKQLEE------PYGYLGNSFS
PHAS_MYCBP      ----------EAMEHAGLTQQTLAGSA-TGVFAGVTHGD--YTMVAADAKQLEE------PYGYLGNSFS
PHAS_MYCBO      ----------EAMEHAGLTQQTLAGSA-TGVFAGVTHGD--YTMVAADAKQLEE------PYGYLGNSFS
LNKS_ASPTE      ---------------------------------------------------STRDLESIPTYSATGVAVS
FAS_MOUSE       PQLRLLLEVSEAIVDGGINPASLRGT-NTGVWVGVSGSE------ASEALRDPETLLGYSMVGCQRAMMA
FAS_HUMAN       ----------EAIVDGGINPDSLRGT-HTGVWVGVSGSETSEAL-----SRDPETLVGYSMVGCQRAMMA
LNKS_ASPTN      ---------------------------------------------------STRDLENIPTYSATGVAVS
MSAS_PENPA      ----------------------------------------------------------------------
ERYA2_SACER     ----------EAVERAGIDPDALRGTD-TGVFVGMNGQS-YMQLLAGEAER-------VDGYQGLGNSAS
PKSJ_BACSU      QLRMLLTHSWKAIEDAGYAA---RQIPQTSVFMSASNNSYR-ALLPSDTTES---LETPDGYVSWVLAQS
PKSN_BACSU      ----------------------------------------------------------------------
PPSA_MYCTU      ----------------------------------------------------------------------
PKSM_BACSU      ----------------------------------------------------------------------
PKS31_DICDI     ----------------------------------------------------------------THSIAN
PKS13_DICDI     ------------------------------------------------------------------ATSN
PKS15_DICDI     ------------------------------------------------------------------SISN
PKS41_DICDI     ----------------------------------------------------------------THSISN
MYCA_BACSU      NQRLFLQSAWHAIEDAGYAGDTISGS-QLGVYVG-------YSKVGYDYERSANYPEELHHYIVGN-LPS
PKS2_DICDI      ---------------------------------------------------------------------S
PKS25_DICDI     ------------------------------------------------------------------SIAN
PKS24_DICDI     ------------------------------------------------------------------AISN
PKS21_DICDI     ----------------------------------------------------------------------
FAS_ANSAN       PQLRLLLEVSEAILDGGINPATLRGTD-TGVWVGASG-SEAGEAFSQD----PEQLLGYSMIGCQRAMFA
PPSB_MYCTU      ----------------------------------------------------------------------
PKS30_DICDI     ----------------------------------------------------------------THSVAN
PKS45_DICDI     ------------------------------------------------------------PMNIFNSNMS
PKS44_DICDI     ------------------------------------------------------------PMNIFNSNMS
PKS29_DICDI     ----------------------------------------------------------------THSVAN
PKSL1_ASPPA     AQRMALMSTYEAMERAGLVPDTTPSTQRIGVFHG---------VTSNDWMETNTA-QNIDTYFITGGNRG
PKS14_DICDI     -------------------------------------------------------------------IAN
PKS40_DICDI     ----------------------------------------------------------------------
PKS19_DICDI     ----------------------------------------------------------------------
PKS10_DICDI     --------------------------------------------------------------------AH
PKSL_BACSU      ----------------------------------------EYQLYGAQEQVRGRSLALTGN-------PS
PKS34_DICDI     ----------------------------------------------------------------THSIAN
STCA_EMENI      AQRMALMSTYEAMERGGIVPDTTPSTQRIGVFHG---------VTSNDWMETNTA-QNIDTYFITGGNRG
PKS18_DICDI     -------------------------------------------------------------------IAN
PKS33_DICDI     ----------------------------------------------------------------TNSVAN
OL56_STRAT      -----------------------------GIFIGAG-----HQGYGPDPKRAP---ESVAGYLLTGTASA
PKS39_DICDI     ----------------------------------------------------------------------
PKS38_DICDI     ----------------------------------------------------------------------
PKS32_DICDI     ----------------------------------------------------------------THSIAN
ERYA3_SACER     -------------------------------------------------------------YVGTGTASS
PKS28_DICDI     ----------------------------------------------------------------------
PKS6_DICDI      ----------------------------------------------------------------TCAISN
PKS7_DICDI      ----------------------------------------------------------------TCAISN
PKS8_DICDI      ------------------------------------------------------------------AVSN
PKS5_DICDI      -------------------------------------------------------------------LSN
PKS27_DICDI     ----------------------------------------------------------------------
STCJ_EMENI      ----------------------------------------------------------------------
PKS9_DICDI      ----------------------------------------------------------------TSAISN
WA_EMENI        ----ALLTAYEALEGAGFVPDSTPSTQRVGIFYG----------MTSDDYREVNSGQDIDTYFIPGGNRA
PKS42_DICDI     ----------------------------------------------------------------------
PKS23_DICDI     ------------------------------------------------------------------AFAN
PKS22_DICDI     ------------------------------------------------------------------AFAN
FAS2_SCHPO      ----------------------------------------------------------------------
PKS37_DICDI     ---------------------------KVGVFIGSSSGD---YLRGFDSSE-------INQFTTPGTNSS
PKSR_BACSU      ----------------------------------------------------------------------
KASB_STRCO      STRLALTAADWALQDAKADPESLTDYD-MGVVTANACGGFDFREFRKLWSEGPKSVSVYESFAWFYAVNT
FADI_YERPY      ----------------------------------------------------------------------
FADI_YERPS      ----------------------------------------------------------------------
FADI_YERPP      ----------------------------------------------------------------------
FADI_YERPN      ----------------------------------------------------------------------
FADI_YERPG      ----------------------------------------------------------------------
FADI_YERPE      ----------------------------------------------------------------------
FADI_YERPB      ----------------------------------------------------------------------
FADI_YERPA      ----------------------------------------------------------------------
FADI_YERP3      ----------------------------------------------------------------------
FAS2_CANAL      ----------------------------------------------------------------------
FADI_AERS4      ----------------------------------------------------------------------
FADI_AERHH      ----------------------------------------------------------------------
KAS2_STRCM      ----------------------------------------------------------------------
FAS2_YEAST      ----------------------------------------------------------------------
FADI_PECCP      ----------------------------------------------------------------------
FADI_ERWCT      ----------------------------------------------------------------------
KAS2_STRCO      ----------------------------------------------------------------------
FADI_YERE8      ----------------------------------------------------------------------
MURQ_ENTS8      ------------VLDASECPPTFPHGVVVGLIAGGPGALLK-AVEGAEAQLGEDDLKAIG--LNARDMVV
FADI_PHOLL      ----------------------------------------------------------------------
FADI_PSEHT      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
FABB_ECOLI      GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
FABB_ECOL6      GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
FABB_HAEIN      SVSACLATPYKIRGVNYSMSSACATSAHCIGHAVELIQLGKQDVVFAGGAEELSWECATEFDAMGAVSTK
FABB_BUCAP      GISACLSTLFKIYGVNYSISSACATSGHCIGNAFELIKFGKQDLIFAGGGEEVSWELAYEFDAMKALSSN
FABB_BUCBP      SISACLSTLFKIQGVNYSISSACATSAHCIGNAMELIQLGKQDLIFAGGGEELSWELACAFDSMGALSTM
FABB_BUCAI      GISACLSTLFKIYGVTYSISSACATSAHCIGNAFELIQFGRQDLIFAGGGEEISLELAMQFDAMRALSTC
FABF_COXBU      MASGMVSIKYDLKGPNISIVTACTTGLHNIGHAARMIAHNDADAMIAGGTEMASTPLGIGFAAVRALSTR
FABF_VIBHA      MVAGNLSIMRGLRGPNIAISTACTTGLHNIGHAARMIAYGDAEAMVAGGAEKASTPLGMAFGAAKALSTR
FABF_BACSU      MATGQISIALGAKGVNSCTVTACATGTNSIGDAFKVIQRGDADVMVTGGTEAPLTRMSAGFSANKALST-
FABF_RHIME      LAAGQVSIRHKLRGPNHSVVTACSTGAHAIGDASRLIALGDADVMVAGGTESICRISLAGFAACKALSTQ
FABF_VIBCH      MIAGNLSIMRGLRGPNIAISTACTTGLHNIGHAARMIAYGDADAMVAGGAEKASTPLGMAFGAAKALSTR
FABF_STAAW      MATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQRGDADAMITGGTEAPITHMAIAFSASRALST-
FABF_STAAS      MATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQRGDADAMITGGTEAPITHMAIAFSASRALST-
FABF_STAAC      MATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQRGDADAMITGGTEAPITHMAIAFSASRALST-
FABF_STAAN      MATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQRGDADAMITGGTEAPITHMAIAFSASRALST-
FABF_STAAM      MATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQRGDADAMITGGTEAPITHMAIAFSASRALST-
FABF_STAAR      MATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQRGDADAMITGGTEAPITHMAIAFSASRALST-
FABF_STAAU      MATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQRGDADAMITGGTEAPITHMAIAFSASRALST-
FABF_SHIFL      MVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGFGAARALSTR
FABF_ECOLI      MVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGFGAARALSTR
FABF_ECOL6      MVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGFGAARALSTR
FABF_ECO57      MVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGFGAARALSTR
OXSM_SCHPO      MPAGYISQRYGFTALNXXXXXXXXXXXXXIGDAFNFIKLGHADVIIAGGSESCINPLTVAFSKARSLSTK
KASC1_HORVU     MGSALLAIDVGFMGPNYSISTACATSNYCFYAAANHIRRGEADIIVAGGTEAAIIPIGLGFVACRALSQR
KASC1_ARATH     MGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADMMIAGGTEAAIIPIGLGFVACRALSQR
FABF_SYNY3      MASGLTAINLGAKGPNNCTVTACAAGSNAIGDAFRLVQNGYAKAMICGGTEAAITPLSAGFASARALSFR
OXSM_HUMAN      MAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSAGFSRARALST-
KASM_ARATH      MASGHVSMKYGFQGPNHAAVTACATGAHSIGDATRMIQFGDADVMVAGGTESSIDALSVAFSRSRALSTK
NODE_RHIME      AAACQVSMSLGLRGPVFGVTSACSSANHAIASAVDQIKCGRADVMLAGGSDPLVWIVLKAWEAMRALAP-
FAB2_MYCTU      GAAAAVGLERHAKAGVMTPVSACASGAEAIARAWQQIVLGEADAAICGGVETRIEAVPIAFAQMRIVMST
FAB2_MYCBO      GAAAAVGLERHAKAGVMTPVSACASGAEAIARAWQQIVLGEADAAICGGVETRIEAVPIAFAQMRIVMST
OXSM_MOUSE      MAAGQVSIRYKLKGPNHSVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAFSRARALSS-
FAB2_MYCLE      GAAAAVGLEHHAKAGVMTPVSACASGSEAIAHAWQQIVLGEADSAICGGVETKIEAVPIAFSQMRIVMST
NODE_RHILT      AAAGHVSIFLGLRGPVFGVTSACAAGNHAIASAVDQIRLGRADVMLAGGSDPLTWGVLKSWEALRVLAP-
NOE4_RHIME      AAACQVSMSLGLRGPVFGVTSACSSANHAIASAVDQIKCGRADVMLAGGSDPLVWIVLKAWEAMRALAP-
OXSM_BOVIN      MASGQVSIRHKLKGPNHAVSTACTTGAHAVGDSFRFVAHGDADVMVAGGTDSCISPLSLAFARARALST-
FAB1_MYCTU      GAAAVIGLQLGARAGVMTPVSACSSGSEAIAHAWRQIVMGDADVAVCGGVEGPIEALPAAFSMMRAMSTR
FAB1_MYCBO      GAAAVIGLQLGARAGVMTPVSACSSGSEAIAHAWRQIVMGDADVAVCGGVEGPIEALPAAFSMMRAMSTR
FAB1_MYCLE      GAAATVGLQLGACAGVMTPVSACSSGSEAIAHAWRQIIMGDADVAVCGGVEGPIEALPAAFSMMRAMSTR
NODE_RHILV      AAACQVSMNLGLRGPVFGXXXXXXXXXXXXXXXVDQIKLGRADVMLAGGSDALVWIVLKAWEAMRVLAP-
PKSF_BACSU      DLCGICTDQFGITGLAYTVGGASASGQLAVIHAIQQVLSGEVDTCIALGALMDLSYMECELRALGAMGTK
KAS1_STRCN      TLAADVAERFGAQGPVQTVSTGCTSGLDAVGYAFHTIEEGRADVCIAGASDSPISPMAC-FDAIKATSPN
CEM1_YEAST      MAAGNVSIKFNLRGLSHSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLS----LAGFIRAK
KASA_STRCO      EVAWAVGAE----GPVTMVSTGCTSGLDSVGNAVRAIEEGSADVMFAGAADTPITPIAC-FDAIRA-TTA
KAS1_STRCO      TLSSAVAEEFGVRGPVQTVSTGCTSGLDAVGYAYHAVAEGRVDVCLAGAADSPISPMAC-FDAIKATSPN
KAS1_STRGA      SICREVAWEAGAEGPVTVVSTGCTSGLDAVGYGTELIRDGRADVVVCGATDAPISPIAC-FDAIKATSAN
NODE_RHIS3      AAAGQVSMSLGLRGPVFGVTXXXXXXXXXXXXXVDQIRCGRADVMLAGGSDAPF--VFCVVKAWEAMRVI
KAS1_STRCM      SFXXXXXXXXXXXXPSTVVSTGCTSGIDAVGIAVELVREGSVDVMVAGAVDAPISPIPCVLDAIKA-TTP
KAS1_STRHA      TLASTVAETFGAQGPVQTVSTGCTSGLDAVGYAYHAIAEGRADVCLAGASDSPISPMAC-FDAIKATSPS
KAS1_STRVN      AAGA--------EGPVTMVSDGCTSGLDSVGYAVQGTREGSXXXXXXXXXXTPVSPIAC-FDAIKA-TTP
KAS1_STRRM      SMAAEIAWLAEAEGPAGVVSAGCTSGIDVLTHAADLVRDGAAEVMVAGASDAAISPIAC-FDAIKA-TTP
PKS26_DICDI     RISYC----FDFHGASMTIDSACSSSLNTVLLGCQSINQGKSNLCIAGGVNFILTTIPTAFSFLNILSKN
FAS_BOVIN       NR---LSFFFDFKGPSITLDTACSSSLLALQRAYQAIQRGECAMAIVGGVNRLKPNTSVQFMKLGMLS--
FAS_CHICK       MLANRISYFYDFTGPSLTIDTACSSSLMALENAYKAIRHGQCSAALVGGVNILLKNTSVQFMKLGMLS--
PKS17_DICDI     FISNRLSFSFDLRGPSMTLDTACSSSLNAVYLGCQAIANGDSKMAIVGGVNGICFSMT--FSGLNMLGHK
PKS16_DICDI     FVSNRLSFSFDLRGPSMTLDTACSSSLNAVYLGCQAIATGDSKMAIVGGVNGIFDSISMTFSGLNMLGHK
MCAS_MYCBO      VASGRIAHTLGLHGPAMTFDTACSSGLMAVHLACRSLHDGEADLALAGGCAVLLEPHACAASAQGMLSS-
PKS3_DICDI      ---------FDFHGPSITIDTACSSSSNAVVLGCKSIIEGNSKMSIVGGTSLI-------FDANTPKSFS
FAS_RAT         NR---LSFFFDFKGPSIALDTACSSSLLALQNAYQAIRSGECPAAIVGGINLLLKNTSVQFMKLGMLS--
ERYA1_SACER     VASGRIAYTLGLEGPAISVDTACSSSLVAVHLACQSLRRGESSLAMAGGVTVMPTPMLVDFSRMNSLA--
PKS1_DICDI      LNSNRISYCFDFRGPSITVDTACSSSLVSVNLGVQSIQMGECKIAICGGVNALFPSTSVAFSKLGVLSER
PHAS_MYCTU      MASGRVAYAMRLHGPAITVDTACSSGLTAVHMACRSLHEGESDVALAGGVALMLERKAAAGSALGMLS--
PHAS_MYCTA      MASGRVAYAMRLHGPAITVDTACSSGLTAVHMACRSLHEGESDVALAGGVALMLERKAAAGSALGMLS--
PHAS_MYCBP      MASGRVAYAMRLHGPAITVDTACSSGLTAVHMACRSLHEGESDVALAGGVALMLERKAAAGSALGMLS--
PHAS_MYCBO      MASGRVAYAMRLHGPAITVDTACSSGLTAVHMACRSLHEGESDVALAGGVALMLERKAAAGSALGMLS--
LNKS_ASPTE      VASNRISYFFDWHGPSMTIDTACSSSLVAVHLAVQQLRTGQSSMAIAAGANLILGPMTFVLESKLSML--
FAS_MOUSE       NR---LSFFFDFKGPSIALDTACSSSLLALQNAYQAIRSGECPAALVGGINLLLKNTSVQFMKLGMLS--
FAS_HUMAN       NR---LSFFFDFRGPSIALDTACSSSLMALQNAYQAIHSGQCPAAIVGGINVLLKNTSVQFLRLGMLS--
LNKS_ASPTN      VASNRISYFFDWHGPSMTIDTACSSSLVAVHLAVQQLRTGQSSMAIAAGANLILGPMTFVLESKLSML--
MSAS_PENPA      GVPNRISYHLNLMGPSTAVDAACASSLVAIHHGVQAIRLGESKVAIVGGVNALCGPLTRVLDKAGAISS-
ERYA2_SACER     VLSGRIAYTFGWEGPALTVDTACSSSLVGIHLAMQALRRGECSLALAGG----VTVMSDPYTFVD-FSTQ
PKSJ_BACSU      GIPTMISHKLGLRGPSYFVHANCSSSLIGLHSAYKSLLSGESDYALVGGAT-----LHTESNIGYVHQPG
PKSN_BACSU      -----------LHGPSEPVDTACSSSLVAIHHAISSIEEGTCDMALAGGVNTIILEVYISFDKAGALS--
PPSA_MYCTU      -------------GPSVAVDTACSSSLVAIHLACQSLRTQDCHLAIAAGVNLLLSPAVFRFDQVGALS--
PKSM_BACSU      -------------GPSLAVDTACSSSLTAIHLALESIYSGSSDCAIAGGVNLVVDPVHYQLSVMNMLSA-
PKS31_DICDI     RIGYC----FDFRGENLTIDTACSSSSNAINCGYNSIKTNRSNVSIVGGVNIILDHISKSFTQLDMLS--
PKS13_DICDI     RISYC----FDFRGPSMTLDTACSSSLNCVKLGYQSIRDGTSNLSIAGGVN-----LIIDPYFTASISDL
PKS15_DICDI     RISYC----FDFRNESITIDTACSSSLNAIKMGYQSIKFSKQNSIVGGVNLLLDTNVSKSFTHLNMLSKS
PKS41_DICDI     RVSYC----FDLHGESMTIDTACSSSSNAIRRGYKSIIDGSSNISVVGGINILLDNISKSYSRLNILSK-
MYCA_BACSU      VLASRIAYFLNLKGPAVTVDTACSSSLVAVHMACKALLTGDCEMALAGGIRTSLLPMRIGLDM-------
PKS2_DICDI      GVSNRISYCYDLRGTSLTIDTACSSSLNAVHLGYESIVNGKSDYSIVGGVNFI-------INPQQSRAFK
PKS25_DICDI     RVSYC----YDLHGNSITLDTACSSSLNAIALGYDSIKNKKSKMSIVGGVNILLDPYPYKAFSILNMLSK
PKS24_DICDI     RISYC----YDLHGNSITLDTACSSSLNAIALGYDSIKNKKSKMSIVGGVNILLDSYFFKAYSSLNILSK
PKS21_DICDI     -ISNRLSFSYDIRGPSMTIDTACSSSLNSIAMGFQSIQNGTSNLSIVGGVSLLLDPISKSFSFLNMLSKK
FAS_ANSAN       NRISYF---YDFKGPSLSIDTACSSSLMALENAYKAIRNGRCSAAVVGGVNLLLKNTSVQFMKLGMLS--
PPSB_MYCTU      -------------GPAVAVDTACSSSLVAVHLACQSLRLRETDLALAGGVSTLRPETQIAISAWGLLS--
PKS30_DICDI     RIGYC----FDFRGENLTIDTACSSSSNAINCGYXXXXXXXXXXXXXGGVNFILDHISKSFTQLGLLS--
PKS45_DICDI     GVSNRISYCFDFRGASLTIDTACSSSLNAVHLGYKSIISGESDYSIVGG---------CNFIMSPHTSRS
PKS44_DICDI     GISNRISYCYDFRGTSLTIDTACSSSLNAVHLGYKSIINGESDYSIVGG---------CNFIMSPHTSRS
PKS29_DICDI     RIGYC----FDFRGENLTIDTACSSSSNAINCGYXXXXXXXXXXXXXGGVNFLLDHLSKSFTQLGLLS--
PKSL1_ASPPA     FIPGRINFCFEFAGPSYTNDTACSSSLAAIHLACNSLWRGDCDTAVAGGTN-----MIYTPDGHTGLDKG
PKS14_DICDI     RISHC----FDFSGESITIDTACSSSLNAIRLGYQSIKSGFSNLSIVGGVNSL-------FETNSSKSFS
PKS40_DICDI     -VSNRISYCFDLHGESMTIDTACSSSSNAIRRGYKSIIDGSSNISVVGG-----INILLDPNTSKSYSQL
PKS19_DICDI     -ISNRLSFSYDIRGPSMTIDTACSSSLNSITMGFQSIQNGTSNLSIVGGASLLLDPVSKSFSFLNMLSKK
PKS10_DICDI     GIANRISYCFDLRGESVTLDTACASSGTAISMGAQCIKNGKSKLSIVGGVNLIVDTTNIKFSYLNMLST-
PKSL_BACSU      SIANRVSYYFDFHGPSIALDTMCSSSLTAIHLACQSLQRGECEAAFAGGVN-----VSIHPNKYLMLGQN
PKS34_DICDI     RIGYC----FDFRGENLTIDTACSSSSNAINCGYXXXXXXXXXXXXXGGVNFILDHISKSFTKLDMLS--
STCA_EMENI      FIPGRINFCFEFSGPSYSNDTACSSSLAAIHLACNSLWRGDCDTAVAGGTN-----MIFTPDGHTGLDKG
PKS18_DICDI     RISYC----FDLSGESMTLDTACSSSLNAIILGYQSIKSGTSNLSIVGGVNLILSNLSKSYSYLNMLSKK
PKS33_DICDI     RIGYC----FDFRGENLTIDTACSSSSNAINCGYXXXXXXXXXXXXXGGVNFILDHISKSFTQLDMLS--
OL56_STRAT      VLSGRISYTFGLEGPAVTVDTACSSSLVALHLAVQALRRGECSLAIAGGVAVMSTP-----DAFVEFSRQ
PKS39_DICDI     ---------FDFRGENLTIDTACSSSSNAINCGYXXXXXXXXXXXXXGGVNFILNPISKSFTQLDMLS--
PKS38_DICDI     ---------FDFRGENLTIDTACSSSSNAINCGYXXXXXXXXXXXXXGGVNFILNPISKSFTQLDMLS--
PKS32_DICDI     RIGFC----FDFRGESLTIDTACSSSSNAINCGYXXXXXXXXXXXXXGGVNFILDHISKSFTQLGLLS--
ERYA3_SACER     VASGRVAYCLGLEGPAMTVDTACSSGLTALHLAMESLRRDECGLALAGGVTVMSSPGATEFRSQGGLAAD
PKS28_DICDI     ---------FDFRGENFTIDSACSSSLNAINCGYXXXXXXXXXXXXXXXXXFILDHVSKSFTQLNMLS--
PKS6_DICDI      RISYC----FDFNGPSLSIDTACSSSLNAVSQGYHSILNGTSDISIVGGNLILDVEMTKAYSYLSMLSKT
PKS7_DICDI      RISYC----FDFNGPSLSIDTACSSSLNAISQGYHSILNGTSDISIVGGNLILDVETTKAYSYLSMLSKT
PKS8_DICDI      RISYC----FDFNGPSLSIDTACSSSLNAVSQGYHSILNGTSNMSIVGGVNLILVGMIKAYSYLSMLSKT
PKS5_DICDI      RISYC----FDIHGPSLSIDTACSSSMNAVTQGYHSILNGTSNMSIVGGNFVIDVETIKGFSYLNMLSKT
PKS27_DICDI     ---------FDFRGENFTIDSACSSSLNAINCGYXXXXXXXXXXXXXXXXXFILDNISKSFTQLNILS--
STCJ_EMENI      ---------------------ACATALESVDSAVESIKAGQTKICLVGGYDDLQPEESAGFARMKATVSV
PKS9_DICDI      RISYC----FDFNGPSLSIDTACSSSLNAVSQGYHSILNGTSNMSIVGGVN-----LILDVDIIKAYSSM
WA_EMENI        FTPGRINYYFKFSGPSVSVDTACSSSLAAIHLACNSIWRNDCDTAITGGVNILT-----NPDNHAGLDRG
PKS42_DICDI     ---------FDFRGESLFVDTACSSSLNAVHLGYNSIINLKSKLSIVGGSNLILDPQNSIF-----FSKQ
PKS23_DICDI     RISYC----FDLRGTSLTLDTACSSSLNAVHLGYESIVNGKSNYSVVAG---------CNILLNPYITRS
PKS22_DICDI     RISYC----FDLRGTSLTLDTACSSSLNAVHLGYESIVNGKSNYSVVAG---------CNILLNPYITRS
FAS2_SCHPO      ---------------------ACATAVESVDAAVDLITSGKARICISGGYDDFSEEGSYEFANMGATSTE
PKS37_DICDI     FLSNRLSYFLDVNGPSMTVNTACSASMVAIHLGLQSLWNGESELSMVGGVNIISSPLSLDFGKAGLL---
PKSR_BACSU      ----------------------------------------------------------------------
KASB_STRCO      GQ---ISIRHGMRGPSSALVAEQAGGLDALGHARRTIRRGTPLVVSGGVDSALDWGWVSQI-ASGRISTA
FADI_YERPY      -----LGTGMSVHTDAYSVSRACATSFQAVANVAESIIAGSVDIAIAGGAD-------------------
FADI_YERPS      -----LGTGMSVHTDAYSVSRACATSFQAVANVAESIIAGSVDIAIAGGAD-------------------
FADI_YERPP      -----LGTGMSVHTDAYSVSRACATSFQAVANVAESIIAGSVDIAIAGGAD-------------------
FADI_YERPN      -----LGTGMSVHTDAYSVSRACATSFQAVANVAESIIAGSVDIAIAGGAD-------------------
FADI_YERPG      -----LGTGMSVHTDAYSVSRACATSFQAVANVAESIIAGSVDIAIAGGAD-------------------
FADI_YERPE      -----LGTGMSVHTDAYSVSRACATSFQAVANVAESIIAGSVDIAIAGGAD-------------------
FADI_YERPB      -----LGTGMSVHTDAYSVSRACATSFQAVANVAESIIAGSVDIAIAGGAD-------------------
FADI_YERPA      -----LGTGMSVHTDAYSVSRACATSFQAVANVAESIIAGSVDIAIAGGAD-------------------
FADI_YERP3      -----LGTGMSVHTDAYSVSRACATSFQAVANVAESIIAGSVDIAIAGGAD-------------------
FAS2_CANAL      ---------------------ACATAVESVDIGIETILSGKAKVVLVGGYDDFQEEGSYEFANMNATSNK
FADI_AERS4      -----LGTGMSVTTDAYSVSRACATSFQAVANVTESIMAGTVDIAIAGGAD-------------------
FADI_AERHH      -----LGTGMSVSTDAYSVSRACATSFQAVANVTESIMAGTVDIAIAGGAD-------------------
KAS2_STRCM      ----------------------------------------------------------------------
FAS2_YEAST      ---------------------ACATSVESVDIGVETILSGKARICIVGGYDDFQEEGSFEFGNMKATSNE
FADI_PECCP      -----LGTGMSVHTDAYSVSRACATSFQAVANVAESIMAGTVEVGIAGGAD-------------------
FADI_ERWCT      -----LGTGMSVHTDAYSVSRACATSFQAVANVAESIMAGTVEVGIAGGAD-------------------
KAS2_STRCO      ----------------------------------------------------------------------
FADI_YERE8      -----LGTGMSVHTDAYSVSRACATSFQAVANVAESIIAGSVTVAIAGGAD-------------------
MURQ_ENTS8      GLAASGRTPYVIGGLKYARALGCATAA-------------------------------------------
FADI_PHOLL      ----------------YSVSRACATSFQAIANVAESIMAGTVNIGIAGGAD-------------------
FADI_PSEHT      ----------------YSVSRACATSFQAIANVAESIMAGSVTVGIAGGAD-------------------


                         .         .         .         +         .         .         .:280
query           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
FABB_ECOLI      YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
FABB_ECOL6      YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
FABB_HAEIN      YNETPEKASRAYDANRDGFVIXXXXXXXXXXXXXXXXXRGAKIYAEIVGYGATSDGYDMVAPSGEGAERC
FABB_BUCAP      FNKNPTKSSRVYDVNRDGFXXXXXXXXXXXEELNCALSRSAHIYAEIIGYAATSDGKDMVVPSGDGAVRC
FABB_BUCBP      YNSQPILSSRVFDYYRDGFVISGGAGILVVEELNYALSRSAHIYAEIVGYGTSSDGYNVVVPSGNGAMRC
FABB_BUCAI      FNNDPKKASRVYDVYRDGFVISGGAGMLVIEELNSALSRSXXXXXXXXXXXXTSDGSNIVVPSGDGAIRC
FABF_COXBU      -NDEPEKASRPWDKGRDGFVLGEGAACVVVEELEHAKKRNATIYAEIIGFGMSGDAYHMTRPEAEGFTTC
FABF_VIBHA      -NDEPQKASRPWDKGRDGFVLGDGAGVMVLEEYEHAKARGAKIYAELVGFGMSGDAYHMTSPSGSGGALA
FABF_BACSU      -NPDPKTASRPFDKNRDGFVMGEGAGIIVLEELEHALARGAKIYGEIVGYGSTGDAYHITAPAGEGGARA
FABF_RHIME      HNDNPEKASRPYDADRDGFVMGEGAGIVVLEELEHARARGAKIYAEVIGYGLSGDAFHITAPSGEGAYRC
FABF_VIBCH      -NDEPQKASRPWDKDRDGFVLGDGAGIMVLEEYEHAKARGAKIYAEVVGFGMSGDAYHMTSPSGSGGALA
FABF_STAAW      -NDDIETACRPFQEGRDGFVMGEGAGILVIESLESAQARGANIYAEIVGYGTTGDAYHITAPAGEGGSRA
FABF_STAAS      -NDDIETACRPFQEGRDGFVMGEGAGILVIESLESAQARGANIYAEIVGYGTTGDAYHITAPAGEGGSRA
FABF_STAAC      -NDDIETACRPFQEGRDGFVMGEGAGILVIESLESAQARGANIYAEIVGYGTTGDAYHITAPAGEGGSRA
FABF_STAAN      -NDDIETACRPFQEGRDGFVMGEGAGILVIESLESAQARGANIYAEIVGYGTTGDAYHITAPAGEGGSRA
FABF_STAAM      -NDDIETACRPFQEGRDGFVMGEGAGILVIESLESAQARGANIYAEIVGYGTTGDAYHITAPAGEGGSRA
FABF_STAAR      -NDDIETACRPFQEGRDGFVMGEGAGILVIESLESAQARGANIYAEIVGYGTTGDAYHITAPAGEGGSRA
FABF_STAAU      -NDDIETACRPFQEGRDGFVMGEGAGILVIESLESAQARGANIYAEIVGYGTTGDAYHITAPAGEGGSRA
FABF_SHIFL      -NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPEXXXXXX
FABF_ECOLI      -NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPEXXXXXX
FABF_ECOL6      -NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPEXXXXXX
FABF_ECO57      -NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPEXXXXXX
OXSM_SCHPO      FNDNPKAASRPFDANRDGFVIGEGSAALVLEELEHAKNRNAHIYAEIVGYGLASDSYHITAPNGDAAYYA
KASC1_HORVU     -NDDPITACRPWDKERDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPDGLGVSSC
KASC1_ARATH     -NDDPQTASRPWDKARDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGAVNCDAHHMTDPRADGIERC
FABF_SYNY3      -NDDPLHASRPFDKDRDGFVMGXXXXXXXXXXXXXXXXRGAKIYGEMVGYAMTCDAYHITAPDGRGATRA
OXSM_HUMAN      -NSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPEGEGALRC
KASM_ARATH      FNSSPQEASRPFDCDRDGFVIGEGSGVIVLEEYEHAKRRGAKIYAELCGYGMSGDAHHITQPDGKGAVLA
NODE_RHIME      --DT----CRPFSAGRKGVVLGEGAGMAVLESYEHATARGATILAEVAGVGLSADAFHITAPAVHGPESA
FAB2_MYCTU      NNDDPAGACRPFDRDRDGFVFGEGGALLLIETEEHAKARGANILARIMGASITSDGFHMVAPAGHAITRA
FAB2_MYCBO      NNDDPAGACRPFDRDRDGFVFGEGGALLLIETEEHAKARGANILARIMGASITSDGFHMVAPAGHAITRA
OXSM_MOUSE      -NPDPKLACRPFHPERDGFVMGEGAAVLVLEEHEHAVQRGARIYAEILGYGLSGDAGHITAPEGEGALRC
FAB2_MYCLE      KNDNPAGACRPFDRDRDGFVFGEAGALMLIETEDSAKARSANILARIMGASITSDGFHMVAPNGERAGHA
NODE_RHILT      --DT----CRPFSADRKGVVLGEGAGMAVLESYEHAAARGATMLAEVAGIGLSGDAYDIVMPSIEGPEAA
NOE4_RHIME      --DT----CRPFSAGRKGVVLGEGAGMAVLESYEHATARGATILAEVAGVGLSADAFHITAPAVHGPESA
OXSM_BOVIN      -NTDPKSACRPFHPQRDGFVMGEGAAVLVLEEHRHALRRGARVYAEIVGYGLSGDAGHITAPGGEGAFRC
FAB1_MYCTU      -NDEPERASRPFDKDRDGFVFGEAGALMLIETEEHAKARGAKPLARLLGAGITSDAFHMVAPAADGAGRA
FAB1_MYCBO      -NDEPERASRPFDKDRDGFVFGEAGALMLIETEEHAKARGAKPLARLLGAGITSDAFHMVAPAADGAGRA
FAB1_MYCLE      -NDDPEGASRPFDKNRDGFVFGEAGALMLIETEEHAKARGAKPLARLLGAGITSDAFHMVAPAADGAGRA
NODE_RHILV      --DT----CRPFSADRKGLVLGEGAGMAVLESYEHAAARGATMLAEVAGIGLSADAYHIAAPAVHGPEAA
PKSF_BACSU      YADEPENACRPFDQNRDGFIYGESCGALVIERKETALRRGLKPYAALSGWSIKLDGNRNPDPSLEGEIHV
KAS1_STRCN      -NDDPEHASRPFDAHRDGFVMXXXXXXXXXXXXXHARARGAHVYCEIGGYATFGNAYHMTGLTSEGLARA
CEM1_YEAST      -SITTNGISRPFDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACHITSPDGNGAKRA
KASA_STRCO      RNDDPEHASRPFDGTRDGFVLAEGAAMFVLEDYDSALARGARIHAEISGYATRCNAYHMTGLKADGTIRV
KAS1_STRCO      -NDDPAHASRPFDADRNGFVMGEGAAVLVLEDLEHARARGADVYCEVSGYATFGNAYHMTGLTKEGMARA
KAS1_STRGA      -NDDPAHASRPFDRNRDGFVLGEGSAVFVLEELSAARRRGAHAYAEVRGFATRSNAFHMLKPDGREMAEA
NODE_RHIS3      APDT----CRPFSSDRRGLVLGEGAGMAVLESYEHXXXXXXXXXXXXXXXXLSADAFNLVSPAVEGPEAA
KAS1_STRCM      RHDAPATASRPFDSTRNGFVLGEGAAFFVLEELHSARRRGAHIYAEIAGYATRSNAYHMTGRDGAEMAEA
KAS1_STRHA      -NDDPEHASRPFDARRNGFXXXXXXXXXXXXXXXHARARGADVYCELAGYATFGNAHHMTGLTREGLARA
KAS1_STRVN      RNDDPAHASRPFDGTRNGFVLAEGAAMFVLEEYEAAQRRGAHIYAEVGGYATRSQAYHMTGLKKDGSIRA
KAS1_STRRM      RNDEPETASRPFDRTRNGFVLGEGAAFFVLXXXXXXXXXXXXXXXXXXXXGLRSDGRELA----EAVSRA
PKS26_DICDI     GK------CMTYDEGADGFVRGEGAGLVVLKSLKDAIKDGNNIYCIIKGGNTNVDGANFFQPSKQSQSDN
FAS_BOVIN       ----PEGTCKFFDASGNGYCRAKAVMAILLTK--KSLAR--RVYATILNAGTNTDGCKVTFPSGEAQEQL
FAS_CHICK       ----PDGACKAFDVSGNGYCRSEAVVVVLLTKKSMA----KRVYATIVNAGSNTDGQGVTFPSGE-----
PKS17_DICDI     GQ------CRSFDAGADGYIRSEGGGVCILKKYSDAIKDGDRIYCVIKGGSSNVDGTNIIQPSMKAQGEN
PKS16_DICDI     GQ------CRSFDAGADGYIRSEGGGVCILKKYSDAIKDGDRIYCVIKGGSSNVDGTNITQPSMKAQGEN
MCAS_MYCBO      -----TGRCHSFDADADGFVRSEGCAMVLLKRLPDALRDGNRIFAVVRGTATNQDGETLTMPSEDXXXXX
PKS3_DICDI      YMNMLSKDGRSFDANADGYVKSECIGVLLLKDLNQAIIDGDRVYCVIKGTSSNVDGSNFYSPSAQSQAEN
FAS_RAT         ----PDGTCRSFDDSGNGYCRAEAVVAVLLTK--KSLAR--RVYATILNAGTNTDGCKVTFPSGEAQIRS
ERYA1_SACER     ----PDGRCKAFSAGANGFGMAEGAGMLLLERLSDARRNGHPVLAVLRGTAVNSDGASLSAPNGRAQVRV
PKS1_DICDI      CNSFSDQAS--------GYVRSEGAGVVVLKSLEQAKLDGDRIYGVIKGVSSNEDGASLTTPSCEAQSIN
PHAS_MYCTU      ----PTGRCRAFDVAADGFVSGEGCAVVVLKRLPDALADGDRILAVIRGTSANQDGATPSQPXXXXXXXX
PHAS_MYCTA      ----PTGRCRAFDVAADGFVSGEGCAVVVLKRLPDALADGDRILAVIRGTSANQDGATPSQPXXXXXXXX
PHAS_MYCBP      ----PTGRCRAFDVAADGFVSGEGCAVVVLKRLPDALADGDRILAVIRGTSANQDGATPSQPXXXXXXXX
PHAS_MYCBO      ----PTGRCRAFDVAADGFVSGEGCAVVVLKRLPDALADGDRILAVIRGTSANQDGATPSQPXXXXXXXX
LNKS_ASPTE      ---SPSGRSRMWDAGADGYARGEAVCSVVLKTLSQALRDGDTIECVIRETGVNQDGITMPNHSAQEALIK
FAS_MOUSE       ----PDGTCRSFDDSGSGYCRSEAVVAVLLTK--KSLAR--RVYATILNAGTNTDGSKVTFPSGEVQEQC
FAS_HUMAN       ----PEGTCKAFDTAGNGYCRSEGVVAVLLTK--KSLAR--RVYATILNAGTNTDGQGVTFPSGEQLIRS
LNKS_ASPTN      ---SPSGRSRMWDAGADGYARGEAVCSVVLKTLSQALRDGDTIECVIRETGVNQDGITMPNHSAQEALIK
MSAS_PENPA      -----DGSCKSFDDDAHGYARGEGAGALVLKSLHRALLDHDNVLAVIKGSAVCQDGKTNGIMAPXXXXXX
ERYA2_SACER     RGLASDGRCKAFSARADGFALSEGVAALVLEPLSRARANGHQVLAVLRGSAVNQDGASLAAPNGPSQERV
PKSJ_BACSU      LNFSSDGHIKAFDASADGMIGGEXXXXXXXXXXXXXXXXXXHIYALLRGIGVNNDGADKVAPSVKGQADV
PKSN_BACSU      ----KEGKCKTFSNQADGFAHGEGAGILFLKKLKAAEEAGDHIYGVIKGSAINHGGASLTTPNPKAQADV
PPSA_MYCTU      ----PTGQCRAFDATADGFVRGEGAGVVVLKRLTDAQRDGDRVLAVICGSAVNQDGRSLMAPNPAAQMAV
PKSM_BACSU      -SDT----CKSFGDDADGFVDGEGVGAIVLKPLQQAIADGDHIYGVIKASAINSGGKTYTVPNPHAQAQV
PKS31_DICDI     ----PTGKCHTFSSDADGFVRSEGVGIVVLKKLKDAIKDSNNIYCVIKGSSSNIDGLNFYSPSKSSQCEN
PKS13_DICDI     NILSKTGSCKTFDASADGFARAEGSGIIVMKNLKQAMIDGDKIYCVIKGASSNVDGSNFYAPSSLSQCNN
PKS15_DICDI     TNGTAR--CMTFDESADGYVRGEGVGIVVLKSLKQALSDGNTIYCIINGASSNVDGGGLFSPSSISQCEN
PKS41_DICDI     -----DGKCKSFDAGADGYVRSDAAGIAILKNLNDAIKDDNNIYCVIDGSASNVDGSNFYSPSKSSQVEC
MYCA_BACSU      --ESSDGLTKTFSKDSDGTGSGEGVAAVLLKPLQAAIRDGDHIYGVIKGSAINQDGTTVTAPSPAAQTEV
PKS2_DICDI      YAMVTSKTGKAFDESADGFVRSEGAVVLILKSLSKSIEDGNQIYSIIKGSSSNVDGTNYFAPSKVSQSNN
PKS25_DICDI     SNGR----CKSFDASADGFVRGECIGVVILKNLKDAIKDGNRIYCTINGASANVDGSNFYSPSSISQSEN
PKS24_DICDI     SNGR----CKSFDASADGYVRSECIGVVVLKNLKDAIKDGNRIYCTINGASANVDGSNFYSPSSISQSEN
PKS21_DICDI     GKCKP------FDSEADGYIRAESCGIVILKPLSDAIRDGNNIYCVINSFSSNVDGSNFYSPSKQSQSDN
FAS_ANSAN       ----PDGACKVFDASGDGYCRSEAVVVVLLTKKSMA----KRIYATIVNAGSNTDGQGVTFPSGD-MQRQ
PPSB_MYCTU      ----PQGRCAAFDAAADGFVRGEGAGVVVLKRLTDAVRDGDQVLAVVRGSAVNQDGRSNGVTAPNTAAQC
PKS30_DICDI     ----PTGRCHTFSSDADGYVRSEGVGIVVLKKLKDAIKDSNNIYCVIKGSSSNIDGLNFYSPSKSSQYEN
PKS45_DICDI     FESSKTGKSKAFDQDANGFVRSEGVVSIILKKMSKAIQDGDQIYSVIKGTNSNVDGGNFFAPSKQSQANN
PKS44_DICDI     FESSKTGKSKAFDQDANGFVRSEGVVSIILKKMSKAIQDGDQIYSVIKGTNSNVDGGNFFAPSKQSQANN
PKS29_DICDI     ----PTGRCHTFSSDADGYVRSEGVGIVVLKKLKDAIKDSNNIYCVIKGSSSNIDGLNFYSPSKSSQCEN
PKSL1_ASPPA     FFLSRTGNCKPYDDKADGYCRAEGVGTVFIKRLEDALADNDPILGVILNHSAMSES--MTRPHVGAQIDN
PKS14_DICDI     YLNMLSKSQMTFDESADGFVRGEGVALLVLKSLKQSVADGNNIYCVIKGASSNVDGQNFYSPSSISQADN
PKS40_DICDI     NMLGKDGKCKTFDADADGYVRSESAGIAILKNLNDAIKDGNNIYCVIDGSASNVDGSNFYSPSKSSQVEC
PKS19_DICDI     GKCKP------FDSEADGYIRAESCGIVILKPLSDAIRDGNNIYCVINSFSSNVDGSNFYSPSKQSQSDN
PKS10_DICDI     -----SGVCRPFDIGADGLLRGEGVGTIVLKSLKDSIRDGNKIYCIIKGSNGNSDKQNFYAPSSISQSDN
PKSL_BACSU      KFMSSKGRCESFXXXXXXXXXXXXXXAVLLKPLSKAVEDGDHIYGIIKGHGGKTNGYSVPNPNAQADVIK
PKS34_DICDI     ----PTGRCHTFSSDADGYVRSEGVGIVVLKKLKDAIKDSNNIYCVIKGSNSNIDGLNFYSPSKSSQYEN
STCA_EMENI      FFLSRTGNCKAFDDAADGYCRAEGVGTVFIKRLEDALAENDPILATILNHSAMSDS--MTRPFKPAQIDN
PKS18_DICDI     -----EGKCMSFDSRADGFVRSEGAGVFILKSLKQSIIDGNNIYCVIKGASSNIDGQNFYSPSSSSQAEN
PKS33_DICDI     ----PTGKCHTFSSDADGYVRSEGVGIVVLKRLKDAIKDSNNIYCVIKGSSSNIDGLNFYSPSKSSQCEN
OL56_STRAT      QGMARDGRCKAFAAAADGMGWGEGVSLLLLERLSDARRLGHRVLAVVRGSAVNQDGASLAAPNGQRVIRX
PKS39_DICDI     ----PTGKCHTFSSDADGFVRSEGVGIVVLKKLKDAIKDSNNIYCVIKGSSSNIDGLNFYSPSKLSQCEN
PKS38_DICDI     ----PTGKCHTFSSDADGFVRSEGVGIVVLKKLKDAIKDSNNIYCVIKGSSSNIDGLNFYSPSKLSQFEN
PKS32_DICDI     ----PTGRCHTFSSDADGYVRSEGVGIVVLKKLKDAIKDSNNIYCVIKGSNSNIDGLNFYSPSKSSQCEN
ERYA3_SACER     GRCKP------FSKAADGFGLAEGAGVLVLQRLSAARREGRPVLAVLAGSAVNQDGASLTAPSGPAQQRV
PKS28_DICDI     ----PTGKCHSFSSDADGFVRSEGVGIVILKKLKDAIKDSNNIYCVIKGSSSNVDGLNFYSPSKSSQYEN
PKS6_DICDI      HG-----KCKAFDESGDGFTRGECVGVVVLKNLQDAIKDGNRIYCVIXXXXXXMDKVNFYSPSKQSQFNN
PKS7_DICDI      HG-----KCKAFDESGDGFTRGECAGVVVLKNLQDAVKDGNRIYCVIXXXXXXMDKVNFYSPSKQSQFNN
PKS8_DICDI      HGKC-----KAFDESGDGFTRGECATIVVLKNLQDAVKDGNRIYCVINGSSSNVDGGNLYSPSKQSQFNN
PKS5_DICDI      HG-----KCKAFDESGDGFTRGECAGVVVLKKLDDAIRDGNRIYCXXXXXXXXADKANFYSPSKQSQFNN
PKS27_DICDI     ----PTGKCHSFSSDADGYVRSEGVGIVILKKLKDAIKDSNNIYCVIKGSSSNIDGLNFYSPSKSSQYEN
STCJ_EMENI      RDEEPGEMSRPTAASRSGFVESQGCGVQLLCRGDVALAMGLPIYGIIAGTGMASDGIGRSVPAGQGILTF
PKS9_DICDI      LSKTHGKC-KTFDESGDGFTRGECVGVVVLKNLQDAVKDGNRIYCVIXXXXXXXDKVNFYSPSKQSQFNN
WA_EMENI        HFLSRTGNCNTFDDGADGYCRADGVGTVVLKRLEDALADNDPILGVING-AYTNHSAEAVSITGAQAFIF
PKS42_DICDI     QVNGPSGKCNSFSEEADGFVRSETVGVVVLKNLKDAIKDGDRIYCVIQGSNSNVDGLNYISPSAENITKA
PKS23_DICDI     FHNITGKSGRSFDESADGFVRSEGVVVLILKRLSLAIQDGDQIYCVMKGSSSNVDGTNFFAPSKNAQSTN
PKS22_DICDI     FHNITGKSGRSFDESADGFVRSEGVVVLILKRLSLAIQDGDQIYCVMKGSSSNVDGTNFFAPSKNAQSTN
FAS2_SCHPO      RGRTPQEMSRPATSTRDGFMESQGAGVQIIMQAKLAIEMGVPIHG-IVGYVSTAQGRSVPAP-GQG----
PKS37_DICDI     -NQETDGRCYSFDPRASGYVRSEGGGILLLKPLSAALRDNDEIYXXXXXXXXXXXGK---TPTGITSPRS
PKSR_BACSU      --------------------------------LSKAMEDQDHIYAVIKSSFANHSGGRQMYPKQQAKLIV
KASB_STRCO      TD--PDRAYLPFDERAAGYVPGEGGAILVLEDSAAAEARGRHAYGELAGCASTFDPAP---GSGRGLERA
FADI_YERPY      ----------------------------------------------------------------------
FADI_YERPS      ----------------------------------------------------------------------
FADI_YERPP      ----------------------------------------------------------------------
FADI_YERPN      ----------------------------------------------------------------------
FADI_YERPG      ----------------------------------------------------------------------
FADI_YERPE      ----------------------------------------------------------------------
FADI_YERPB      ----------------------------------------------------------------------
FADI_YERPA      ----------------------------------------------------------------------
FADI_YERP3      ----------------------------------------------------------------------
FAS2_CANAL      HGRTPKEMSRPTTTTRNGFMEAQGSGIQVIMTADLALKMGVPIHAVLAMTATATDGRSVPAP-GKGILTT
FADI_AERS4      ----------------------------------------------------------------------
FADI_AERHH      ----------------------------------------------------------------------
KAS2_STRCM      -------------------------------------------------YGEAGPLARLPAPSGRGSTRA
FAS2_YEAST      HGRTPAEMSRPATTTRNGFMEAQGAGIQIIMQADLALKMGVPIYG-IVAMAATATGRSVPAP-GKG----
FADI_PECCP      ----------------------------------------------------------------------
FADI_ERWCT      ----------------------------------------------------------------------
KAS2_STRCO      ----------------------------------------------VAGHAATFTGAGRWAESREGLARA
FADI_YERE8      ----------------------------------------------------------------------
MURQ_ENTS8      ----------------------------------------------------------------------
FADI_PHOLL      ----------------------------------------------------------------------
FADI_PSEHT      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           MQMAMHGVDTPIDYLNSHGTSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLML
FABB_ECOLI      MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
FABB_ECOL6      MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
FABB_HAEIN      MKQAMATVDTPIDYINVHGTSTPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLML
FABB_BUCAP      MNLAKQNKMLFIDYLNVHGTSTKIGDLIELEAIKKFFHEKKPMISATKSMTGHALGVSGVHEIIYTLLMM
FABB_BUCBP      MNIAMSNIQEPIDYLNVHSTSTKIGDLIELNAIQQVFRKTSPILSSTKSITGHSLGASGVQEMIYSLLML
FABB_BUCAI      MNLARKGKNIPIDYLNVHGTGTKIGDLIELEAIRKVFNEKKPMISATKSMTGHGLGASGVHEMIYTLLML
FABF_COXBU      MKNSLRDAGIAVDYINAHGTSTPAADPLEARAIKKTFGDHALAVSSTKSMTGHMLGAAGALETVISVLAI
FABF_VIBHA      MEAAMRDANTQVGYVNAHGTSTPAGDVAEIKGVKRALGEEGSLVSSTKSMTGHLLGAAGSVEAIITVLSL
FABF_BACSU      MQEAIKDAPEEIDYINAHGTSTYYNDKYETMAIKTVFGEHAHAVSSTKSMTGHLLGAAGGIEAIFSILAI
FABF_RHIME      MQMALKGVTADIDYINAHGTST-MADTIELGAVERLVGDSASRISSTKSAIGHLLGAAGAVEAIFSALAI
FABF_VIBCH      MEAAMRDAGVQIGYVNAHGTSTPAGDVAEVKGIKRALGEKQVLVSSTKSMTGHLLGAAGSVEAIITVMSL
FABF_STAAW      MQAAMDGIEKDVQYLNAHGTSTPVGDLNEVKAIKNTFGEAAKKVSSTKSMTGHLLGATGGIEAIFSALSI
FABF_STAAS      MQAAMDGIEKDVQYLNAHGTSTPVGDLNEVKAIKNTFGEAAKKVSSTKSMTGHLLGATGGIEAIFSALSI
FABF_STAAC      MQAAMDGIEKDVQYLNAHGTSTPVGDLNEVKAIKNTFGEAAKKVSSTKSMTGHLLGATGGIEAIFSALSI
FABF_STAAN      MQAAMDGIEKDVQYLNAHGTSTPVGDLNEVKAIKNTFGEAAKKVSSTKSMTGHLLGATGGIEAIFSALSI
FABF_STAAM      MQAAMDGIEKDVQYLNAHGTSTPVGDLNEVKAIKNTFGEAAKKVSSTKSMTGHLLGATGGIEAIFSALSI
FABF_STAAR      MQAAMDGIEKDVQYLNAHGTSTPVGDLNEVKAIKNTFGEAAKKVSSTKSMTGHLLGATGGIEAIFSALSI
FABF_STAAU      MQAAMDGIEKDVQYLNAHGTSTPVGDLNEVKAIKNTFGEAAKKVSSTKSMTGHLLGATGGIEAIFSALSI
FABF_SHIFL      XXXXXXXRDAGIEYVNAHGTSTPAGDKAEAQAVKTIFGESRVLVSSTKSMTGHLLGAAGAVESIYSILAL
FABF_ECOLI      XXXXXXXRDAGIEYVNAHGTSTPAGDKAEAQAVKTIFGESRVLVSSTKSMTGHLLGAAGAVESIYSILAL
FABF_ECOL6      XXXXXXXRDAGIEYVNAHGTSTPAGDKAEAQAVKTIFGESRVLVSSTKSMTGHLLGAAGAVESIYSILAL
FABF_ECO57      XXXXXXXRDAGIEYVNAHGTSTPAGDKAEAQAVKTIFGESRVLVSSTKSMTGHLLGAAGAVESIYSILAL
OXSM_SCHPO      MKRSLKQAGSQLDYINAHATSTKLGDVAESIAITRLLCDNPEAVSSSKGSIGHLLGAAGAIESVYTVLTV
KASC1_HORVU     ITMSLRDAGVEVNYINAHATSTLAGDLAEVRAIKQVFKNPSEKINSTKSMIGHCLGAAGGLEAIATIKSI
KASC1_ARATH     LEDA--GVSEEVNYINAHATSTLAGDLAEINAIKKVFKSTSGKINATKSMIGHCLGAAGGLEAIATVKAI
FABF_SYNY3      IAWALKDSGLKVSYINAHGTSTPANDVTETRAIKQALGNHAYAVSSTKSMTGHLLGGSGGIEAVATVMAI
OXSM_HUMAN      MAAALKGVQEEISYINAHATSTPLGDAAENKAIKHLFKDHALAVSSTKXXXXXXXXXXXXVEAAFTTLAC
KASM_ARATH      MTRALRQCPNQIDYVNAHATSTPIGDAVEARAIKTVFSEHATAFSSTKXXXXXXXXXXXXVEAIFSILAI
NODE_RHIME      MRLADAGLNADVDYLNAHGTGTKANDQNETTAIKRVFGDHSMSISSTKSTHAHCIGAASALEMIACVMAI
FAB2_MYCTU      IQLAGLAPGD-IDHVNAHATGTQVGDLAEGRAINNALGGNRPAVYAPKSALGHSVGAVGAVESILTVLAL
FAB2_MYCBO      IQLAGLAPGD-IDHVNAHATGTQVGDLAEGRAINNALGGNRPAVYAPKSALGHSVGAVGAVESILTVLAL
OXSM_MOUSE      MAAAVKGVSEQISYVNAHATSTPLGDAAENRAIKRLFRDHALAISSTKXXXXXXXXXXXXVEATFTALAC
FAB2_MYCLE      IARAVHGLSSDIDHVNAHATGTQVGDLAEAKAINKALCNNRPAVYAPKSALGHSVGAVGAVESILTVLAL
NODE_RHILT      MRSCLADAEDDVDYLNAHGTGTVANDEMETAAIKRVFGDHAMSVSSTKSMHAHCLGAASALEMIACVMAI
NOE4_RHIME      MRLADAGLNADVDYLNAHGTGTKANDQNETTAIKRVFGDHSMSISSTKSTHAHCIGAASALEMIACVMAI
OXSM_BOVIN      MAAAVKDAPEEVSYINAHATSTPLGDAAENKAIKQLFKDHAHAVSSTKXXXXXXXXXXXXXXXXXXXXXC
FAB1_MYCTU      MSLELAGLSADIDHVNAHGTATPIGDAAEANAIR-VAGCDQAAVYAPKSALGHSIGAVGALESVLTVLTL
FAB1_MYCBO      MSLELAGLSADIDHVNAHGTATPIGDAAEANAIR-VAGCDQAAVYAPKSALGHSIGAVGALESVLTVLTL
FAB1_MYCLE      MSLELAGLSADVDHVNAHGTATPIGDSAEANAIR-VAGCEQAAVYAPKSALGHSIGAVGALESVLTVLAL
NODE_RHILV      MRACLVDASLDVDYLNAHGTGTKANDQIETTAIKRVFGDHSMSISSTKSTHAHCLGAASALEMIACVMAI
PKSF_BACSU      IQKALERLPEDIDYINPHGTGSFIGDEIELKALRACRLSHA-YINATKSITGHGLSAAGIVEIISVLLQM
KAS1_STRCN      IDVALDHAPTDIDYVNAHGSGTRQNDRHETAAVKKSLGAHATPMSSIKSMVGHSLGAIGAIEVVACVLAL
CEM1_YEAST      IEMALKMAPTDVDYVNAHATSTLLGDKAECLAVASALSKSKPLISSNKXXXXXXXXXXXXVESIFTICSL
KASA_STRCO      ALDESRTDATDIDYINAHGSGTRQNDRHETAAYKRALGEHATPVSSIKSMVGHSLGAIGSLEIAACVLAL
KAS1_STRCO      IDTALDMAESAIDYVNAHGSGTQQNDRHETAAVKRSLGEHAYAMSSIKSMVGHSLGAIGSIELAACVLAM
KAS1_STRGA      ITAALRRTGDDLHYINAHGSGTRQNDRHETAAFKRSLGQRAVPVSSIKSMIGHSLGAIGSLELAACALAI
NODE_RHIS3      MRLADAGLNVQVDYINAHGTGTKANDRMETEAIKRVFGGNSMSISSTKSMHAHCLGAASALEMIACVMAI
KAS1_STRCM      IRLALDEAPEQVDYINAHGSGTKQNDRHETAAFKKALGEHATPVSSIKSMVGHXXXXXXXXXXXXXXXXM
KAS1_STRHA      IDTALDMAGTDIDYVNAHGSGTQQNDRHETAAVKRSLGEHATPMSSIKSMVGHSLGAIGSIEVVACVLAL
KAS1_STRVN      ALDEARLDRTAVDYVNAHGSGTKQNDRHETAAFKRSLGEHAYAVSSIKSMGGHSLGAIGSIEIAASVLAI
KAS1_STRRM      LDIAR--VDSEVDYVNAHGSATKQNDLHETAAFKRSLGPHSVPISSIKSMIGHSLGAICALEVAASALRI
PKS26_DICDI     IKLALESIDIDIDYVETHGTGTPTGDPIEVEGISKVFKENSPLIGSLKSNIGHMEAASGVTSLIKCCLMF
FAS_BOVIN       ISSLYKGLDPELEYVEAHGTGTKVGDPQELGIVQALCGTRSPLIGSTKSNMGHPEPASGLAALAKVLLSL
FAS_CHICK       MQQQLVGSPGDVEYVEAHGTGTKVGDPQEVNGIVNVFCEREPLIGSTKSNMGHPEPASGLAALAKVILSL
PKS17_DICDI     IEIALKGVNSDIYYIEAHGTGTPVGDPIEIEAISRIFKDNHTPIGSVKSNIGHLESAAGIASLIKVALSL
PKS16_DICDI     IEIALKGVNSDIYYIEAHGTGTPVGDPIEIEAISRIFKDNHTPIGSVKSNIGHLESAAGIASLIKVALSL
MCAS_MYCBO      XXXXXXXXPETVGVVEAHGTGTPIGDPIEYRSLARVYGAGTPALGSAKSNMGHSTASAGTVGLIKAILSL
PKS3_DICDI      IKMALSSGNIDVDYVEAHGTGTPVGDPIEVEGISSIFKDNHSLIGSFKSMIGHCEASSGIASLVKCCLMF
FAS_RAT         LYQPGGVAPESLEYIEAHGTGTKVGDPQELNGITRAFRQSPLLIGSTKSNMGHPEPASGLAALTKVLLSL
ERYA1_SACER     IQQALSGLPADIDAVEAHGTGTRLGDPIEARALFEAYGEQPLHLGSVKSNLGHTQAAAGVAGVIKMVLAM
PKS1_DICDI      ISKAMEKASSDIYYIEAHGTGTPVGDPIEVKALSKIXXXTSPLIGSFKSNIGHLESAAGIASLIKCCLML
PHAS_MYCTU      XXXXXXXXXXXXXXXEAHGPGTPIGDPIEYASVSEVYGVDGPALASVKTNFGHTQSTAGVLGLIKVVLAL
PHAS_MYCTA      XXXXXXXXXXXXXXXEAHGPGTPIGDPIEYASVSEVYGVDGPALASVKTNFGHTQSTAGVLGLIKVVLAL
PHAS_MYCBP      XXXXXXXXXXXXXXXEAHGPGTPIGDPIEYASVSEVYGVDGPALASVKTNFGHTQSTAGVLGLIKVVLAL
PHAS_MYCBO      XXXXXXXXXXXXXXXEAHGPGTPIGDPIEYASVSEVYGVDGPALASVKTNFGHTQSTAGVLGLIKVVLAL
LNKS_ASPTE      ATYAQAGLDITCQFFEAHGTGTPAGDPQEAEAIATAFNERAPLVGSAKTVVGHTEGTAGLAGLMKASFAV
FAS_MOUSE       SLYQPAGLPESLEYIEAHGTGTKVGDPQELNGITRAFRQAPLLIGSTKSNMGHPEPASGLAALTKVLLSL
FAS_HUMAN       LYQSAGVAPESFEYIEAHGTGTKVGDPQELNGITRALRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSL
LNKS_ASPTN      ATYAQAGLDITCQFFEAHGTGTPAGDPQEAEAIATAFNERAPLVGSAKTVVGHTEGTAGLAGLMKASFAV
MSAS_PENPA      XXXXXXXXXXXIDYVEAHATSTPLGDPTEISAIASVYGADRPAIGSIKPNIGHLEAGAGVMGFIKAVLAI
ERYA2_SACER     IRQALAASGVPVDVVEAHGTGTELGDPIEAGALIATYGDRPLRLGSVKTNIGHTQXXXXXXXVIKVVLAM
PKSJ_BACSU      VQQVMNQTKVQICYVEAHGTGTKLGDPIELAALTNVYRQYTNGIGSVKTNIGHLDTAAGLAGCIKVVMSL
PKSN_BACSU      IQSAYQGIDKTVTYIEAHGTGTELGDPVEINGLKSAFGDTSAGLGSVKTNIGHLSLAAGAAGVIKILLQL
PPSA_MYCTU      LRAAYTNAGSEVDYVEAHGTGTLLGDPIEARALGTVLGRGRPEIGSVKTNLGHTEAAAGIAGFIKTVLAV
PKSM_BACSU      IKEAIERADIPISYLEAHGTGTALGDPIEIAGLTKAFEKDTQAIGSSKSNIGHCESAAGIAGLTKILFQF
PKS31_DICDI     IKLAIKSTESDIDYCETHGTGTPTGDPIELEGISRVF--NSAKIPSTKSNIGHLEACSGVASLIKCCLMF
PKS13_DICDI     IKMALNGTVEPISYFECHGTGTPTGDPIETRGISMVFNDESRSIGSIKSNIGHLEAGSGIASLIKCCLMF
PKS15_DICDI     IKMAIQSTNNNIDYIEAHGTGTPTGDPIELEAISNSFKQLNDLIGSIKSSIGHLEAASGVASLIKCCLMF
PKS41_DICDI     IRLALESTNGQVNYFEAHGTGTPTGDPIELESVSIALSDNPLLIGSFKPNIGHTESASGISSLIKCCLIL
MYCA_BACSU      IEMAWKDAGIALSFIEAHGTGTKLGDPVEFNGLCKAFEKVTEAIGSVKANIGHLFEAAGIVGLIKSALML
PKS2_DICDI      MQKAFNGELTPISFFELHGTGTQIGDPIEVEAVSTLFKDESPLIGSIKSNIGHLEPASGVASLAKVCLML
PKS25_DICDI     LKNAIQSTNSDIDYVEAHGTGTPNGDPVETEGISKVFKDTRSTIGSFKSNIGHCEAASGIASLIKCCLMY
PKS24_DICDI     LKNAIQSTNSDIDYVEAHGTGTPTGDPIEVEGISKVFKDTRSTIGSFKSNIGHCEAASGIASLIKCCLMY
PKS21_DICDI     IKLALKSANSDISFVECHGTGTPTGDPIEVEGVSMALNSSKTSIGSLKSNIGHSEAASGVASLIKCCLMF
FAS_ANSAN       LVSSLHGIKPDIEYVETHGTGTKVGDPQEVNGLADLFCEREPLIGSTKSNMGHPEPASGLAALAKVVLSL
PPSB_MYCTU      DVIARSGDVAPVNYVEAHGTGTVLGDPIEFEALAATYGGDACALGAVKTNIGHLEAAAGIAGFIKATLAV
PKS30_DICDI     IKLAIKSTESDIDYCETHGTGTPTGDPIELEGISRVF-NKAPAIGSIKSNIGHTEACSGVASLIKCCLMF
PKS45_DICDI     IKSAMESCNTPIDFFELHGTSTQIGDPIECEGVSSVFKESRELIGSIKANIGHLEPASGVASLAKVALMF
PKS44_DICDI     IKSAMESCNTPIDFFELHGTSTQIGDPIECEGVSSVFKESRELIGSIKANIGHLEPASGVASLAKVALMF
PKS29_DICDI     IKLAIKSTESDIDYCETHGTGTPTGDPIELEGISRVFXXKQVLVGSIKSNIGHTEACSGVASLIKCCLMF
PKSL1_ASPPA     MTAALNTTGNDFSYIEMHGTGTQVGDAVEMESVLSVFAPSETAVGSAKANVGHGEGVSGVTSLIKVLMMM
PKS14_DICDI     VNNAFSSTNGTVKYIEAHGTGTPTGDPVELDGMSRVFKTHSSLIGSIKSSIGHLEAASGSASLVKCCLMF
PKS40_DICDI     IRLALESTENDIVYFEAHGTGTPTGDPIELESVSENRSSNNPLIGSFKPNIGHSECASGISSLIKCCLIL
PKS19_DICDI     IKLALKSANSDISFVECHGTGTPTGDPIEVEGVSMALNSKPLLIGSLKSNIGHCEAASGVASLIKCCLMF
PKS10_DICDI     IKLAIKSTNDDIDYFECHGTGTPTGDPIETKGISMAFNQNPLLIGSLKGSSGHSEAASGVIGVIKCCLIF
PKSL_BACSU      KAFVEAKVDPTVSYIEAHGTGTSLGDPIEITGLSKVFTQETDAIGSAKSNIGHCESAAGIAGVTKVLLQM
PKS34_DICDI     IKLAIKSTESDIDYCETHGTGTPTGDPIELEGISRVFNNKASTVGSIKSNIGHTEACSGVASLIKCCLMF
STCA_EMENI      MSALLSTAGSPLDYIEMHGTGTQVGDAVEMESVLSLFADKPLYVGSAKANIGHGEGVSGVTSLIKVLLMM
PKS18_DICDI     INRALSSTKGSVKYVEAHGTGTPTGDPIELEAISRVFKTXXXLIGSFKSSVGHLESASGSASLVKCCLMF
PKS33_DICDI     IKLAIKSTESDIDYCETHGTGTPTGDPIELEGISRVFXXXQVLVGSVKSNIGHTEACSGVASLIKCCIMF
OL56_STRAT      XXXXXXXXXXXXXXXEAHGTGTRLGDPIEAQALLATYGQGRAGLGSVKSNIGHTQXXXXXXXXMKMVLAL
PKS39_DICDI     IKLAIKSTESDIDYCETHGTGTPTGDPIELEGISRAFNNKASTVGSFKSNIGHTEACSGVASLIKCCLMF
PKS38_DICDI     IKLAIKSTESDIDYCETHGTGTPTGDPIELEGISRAFNNKASTVGSFKSNIGHTEACSGVASLIKCCLMF
PKS32_DICDI     IKLAIKSTESDIDYCETHGTGTPTGDPIELEGISRVFXXXQVLVGSIKSNIGHTEACSGVASLIKCCLMF
ERYA3_SACER     IRRALENAGVDVDYVEAHGTGTRLGDPIEVHALLSTYGDDPLWIGSVKSNIGHTQXXXXXXXXXXXXXXX
PKS28_DICDI     MKLAIKSTESDIDYCEAHGTGTPTGDPIELEGISRLFDQNNVLVGSIKSNIGHTEACSGVASLIKCCIMF
PKS6_DICDI      INSAFKSTNNDIQYIEAHGTGTKTGDPIETEAISMAFKNRDKSIGSIKSNIGHCEAGSGVASLIKCCLMF
PKS7_DICDI      INSAFKSTNNEIQYIEAHGTGTKTGDPIETEAISMAFKNRDKSIGSIKSNIGHCEAGSGVASLIKCCLMF
PKS8_DICDI      INSAFKSTNNDIQYIEAHGTGTKTGDPIETEAISMAFKNRDKSIGSIKSNIGHCEAGSGVASLIKCCLMF
PKS5_DICDI      INLAFKSTNNDIQYIEAHGTGTKTGDPIETEAISMAFKNRDKSIGSIKSNIGHCEAGSGVVSLIKCCLMF
PKS27_DICDI     MKLAIKSTESDIDYCEAHGTGTPTGDPIELEGISRLFSXKQVLVGSIKSNIGHTEACSGVASLIKCCLMF
STCJ_EMENI      AQLARWGLGDDITVASLHATSTPANDTREMTHLGRTSGRPLWAI-CQKFVTGHPKAPAAAWMLNGCLQVL
PKS9_DICDI      INSAFKSTNNDIQYIEAHGTGTKTGDPIETEAISMAFKNRDKSIGSIKSNIGHCEAGSGVASLIKCCLMF
WA_EMENI        KKLLNEANVDPISYIEMHGTGTQAGDAVEMQSVLDVFAPDSLHLGSAKSNIGHGESASGVTSLVKVLLMM
PKS42_DICDI     LKSTNGAVNSDIDYFECHGTGTPTGDPIELEGISIALNSNPLLIGSIKSNIGHGEASSGIASLIKCCVMF
PKS23_DICDI     IKNAFLSSNQDIDFFELHSTGTQVGDPIEVEAVADIFKNEPLLIGSVKSNIGHLEPASGVASLAKVCLMF
PKS22_DICDI     IKNAFLSSNQDIDFFELHSTGTQVGDPIEVEAVADIFKNEPLLIGSVKSNIGHLEPASGVASLAKVCLMF
FAS2_SCHPO      ----------------------------------------------------------------------
PKS37_DICDI     LQLLRESSDQDIGYFECHGTGTQMGDLNEITAIGKSIGDDPLIIGSVKASIGHLEGASGICGVIKSIICL
PKSR_BACSU      KSIQQSGIDPEIGYIESAANGSALGDPIEVIALTNAFQQYTNAIGSVKSNLGHLEAASGISQLTKVLLQM
KASB_STRCO      IRLALNDAGTGPEXXXXXXXXXPELDAAEARAIGRVFGREGXXXXXXXXXXGRLYSGGGPLDVVTALMSL
FADI_YERPY      ----------------------------------------------------------------------
FADI_YERPS      ----------------------------------------------------------------------
FADI_YERPP      ----------------------------------------------------------------------
FADI_YERPN      ----------------------------------------------------------------------
FADI_YERPG      ----------------------------------------------------------------------
FADI_YERPE      ----------------------------------------------------------------------
FADI_YERPB      ----------------------------------------------------------------------
FADI_YERPA      ----------------------------------------------------------------------
FADI_YERP3      ----------------------------------------------------------------------
FAS2_CANAL      AREHHGNLKYPSPLLN-HGTSTVANDKNESATINNMMSEGNPVFGVQKYLTGHPKGAAGAWMLNGAIQIL
FADI_AERS4      ----------------------------------------------------------------------
FADI_AERHH      ----------------------------------------------------------------------
KAS2_STRCM      -----HAIRTALD-----DAGTAPGDIREAEAISEVFGPGRVPVTCPRTMTGRLHSGAAPLDVACALLAM
FAS2_YEAST      -----------------HGTSTKANDKNESATINEMMSEGNPVIGVQKFLTGHPKGAAGAWMMNGALQIL
FADI_PECCP      ----------------------------------------------------------------------
FADI_ERWCT      ----------------------------------------------------------------------
KAS2_STRCO      IQGALAEAGCEVDVVFADALGVPXXXXXXXXXXXXXXGPHAARVPVTKTGTGRAYCAAPVLDVATAVLAM
FADI_YERE8      ----------------------------------------------------------------------
MURQ_ENTS8      ----------------------------------------------------------------------
FADI_PHOLL      ----------------------------------------------------------------------
FADI_PSEHT      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EHGFIAPSINIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL
FABB_ECOLI      EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
FABB_ECOL6      EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
FABB_HAEIN      DNDFIAPSINIETLDEAAEGCNIVETKENAGLQTVMSNSFGFGGTNATLIFKR-
FABB_BUCAP      KYNFIAPSINIETIEPSADNMNIVQKTFHKKIKTALSNSFGFGGTNVSLILKK-
FABB_BUCBP      KYNFIVPSINIFKLDPKAKNCNILTTMMRKELSIIMSNSFGFGGTNVSLIIKK-
FABB_BUCAI      KYNFIAPTINIENLEPCAENMNIIQKTTNIEINTAMSNSFGFGGTNVSLIVKK-
FABF_COXBU      RDNTAPPTINLENPDEGCDLDFVPNEAREMKIDTVMSNSFGFGGTNGTLVLSRV
FABF_VIBHA      VDQIVPPTINLDDPEEGLDIDLVPHTARKVDMEYAICNSFGFGGTNGSLVFKKI
FABF_BACSU      KEGVIPPTINIQTPDEECDLDYVPDEARRQELNYVLSNSLGFGGHNATLIFKK-
FABF_RHIME      RDNIAPPTLNLDNPSVETKIDLVPHVARKREINVALSNSFGFGGTNASLILRR-
FABF_VIBCH      VDQMVPPTINLDN-PEEGLGVDLVVARKVESMEYAMCNSFGFGGTNGSLIFKRM
FABF_STAAW      KDSKVAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFKK-
FABF_STAAS      KDSKVAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFKK-
FABF_STAAC      KDSKVAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFKK-
FABF_STAAN      KDSKVAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFKK-
FABF_STAAM      KDSKVAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFKK-
FABF_STAAR      KDSKVAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFKK-
FABF_STAAU      KDSKIAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFK--
FABF_SHIFL      RDQAVPPTINLDNPDE-GCDLDFVEARQVSGMEYTLCNSFGFGGTNGSLIFKKI
FABF_ECOLI      RDQAVPPTINLDNPDE-GCDLDFVEARQVSGMEYTLCNSFGFGGTNGSLIFKKI
FABF_ECOL6      RDQAVPPTINLDNPDE-GCDLDFVEARQVSGMEYTLCNSFGFGGTNGSLIFKKI
FABF_ECO57      RDQAVPPTINLDNPDE-GCDLDFVEARQVSGMEYTLCNSFGFGGTNGSLIFKKI
OXSM_SCHPO      QKGVLPPTLNFEDIPQQFQCDYVPNVAKESRINVALSNSFGFGGTNASLCFKK-
KASC1_HORVU     TTGWVHPTINQFNPEPEVDFDTVANEKKQHEVNVGISNSFGFGGHNSVVV----
KASC1_ARATH     NTGWLHPSIN-QFNPEQAVDFDTVPNEKKQHEVDVISNSFGFGGHNSVV-----
FABF_SYNY3      AEDKVPPTINLENPDPECDLDYVPGQSRALIVDVALSNSFGFGGHNVTLAFKK-
OXSM_HUMAN      YYQKLPPTLNL-DCSEPEFDLNYVPLKAQEWKTEKLTNSFGFGGTNATLCIAGL
KASM_ARATH      HHGVAPMTLNVKNFDKRFMPLT---TSKKMLVRTAMSNSFGFGGTNASLLFASI
NODE_RHIME      QEGVVPPTANYREPDPD-CDLDVTPNVPRERKVRVMSNAFAMGGTNAVLAFKQV
FAB2_MYCTU      RDQVIPPTLNLVNLDPEIDLDVVAGEPRPGNYRYAINNSFGFGGHNVAI-----
FAB2_MYCBO      RDQVIPPTLNLVNLDPEIDLDVVAGEPRPGNYRYAINNSFGFGGHNVAI-----
OXSM_MOUSE      YHQKLPPTLNL-DCTEPEFDLNYVQEWKAEGRCIGLTNSFGFGGTNATL-----
FAB2_MYCLE      RDQVIPPTLNLVNLDPDIDLDVVAGKPRPGDYRYAVNNSFGFGGHNVAI-----
NODE_RHILT      QEGVIPPTANYREPDPQ-CDLDVTPNVPREQRCGSMSNAFAMGGTNAVLAFRQV
NOE4_RHIME      QEGVVPPTANYREPDPD-CDLDVTPNVPRERKVRVMSNAFAMGGTNAVLAFKQV
OXSM_BOVIN      YHRKLPPTLNL-DCTEPHFDLNYVQEWKAENRRIALTNSFGFGGTNATL-----
FAB1_MYCTU      RDGVIPPTLNYETPDPEIDLDVVAGEPRYGDYRYAVNNSFGFGGHNVAL-----
FAB1_MYCBO      RDGVIPPTLNYETPDPEIDLDVVAGEPRYGDYRYAVNNSFGFGGHNVAL-----
FAB1_MYCLE      RDGVIPPTLNYQTPDPEIDLDIVAGEPRYGDYRYAINNSFGFGGHNVAL-----
NODE_RHILV      QEGVVPPTANYREPDPD-CDLDVTPNVPRERKVRVMSNAFAMGGMNAVLAFKQV
PKSF_BACSU      KKSALHPSRNLDHIDDSFHWVN--EKSISYRIKNALSLSMGFGGMNTAVCIQNI
KAS1_STRCN      ARQVVPPTANYETPDPECDLDYVPRTARPRRLDHVLSVGSGFGGFQSAVLL---
CEM1_YEAST      KDDKMPHTLNLDNVNNEADKLHFIKPIVGANPKYALCNSFGFGGVNTSLLFKK-
KASA_STRCO      EHGVVPPTANLRTSDPECDLDYVPLEARERKLRSVLTVGSGFGGFQSAMVLR--
KAS1_STRCO      AHQVVPPTANYTTPDPECDLDYVPREARERTLRHVLSVGSGFGGFQSAVVL---
KAS1_STRGA      EHGVIPPTANYEEPDPECDLDYVPNVAREQRVDTVLSVGSGFGGFQSAAVLAR-
NODE_RHIS3      QEGVVPPTANYREPDPD-CDLDVTPNVARERKVRVLSNAFAMAGMNAVLAFRQV
KAS1_STRCM      EYDVVPPTANLHTPDPECDLDYVPLTARDQRVDSVLTVGSGFGGFQSAMVL---
KAS1_STRHA      AHQVVPPTANYETPDPE-------------------------------------
KAS1_STRVN      EHNVVPPTANLHTPDPECDLDYVPLTAREQRVDTVLTVGSGFGGFQSAMVLHR-
KAS1_STRRM      EHGVIPPTANLREPDPDCDLDYVPLXXXXXXXXXXXXXXXGFGGFQSAIVL---
PKS26_DICDI     KNKSFAPNVNFQKINPKIKNIKVVTEAIPFKKNKITSNSFGVTGSNCCLVL---
FAS_BOVIN       EHGLWAPNLHFHNPNPQDGRLQVVDRPLPVLGGNVGINSFGFGGSNVHVILQ--
FAS_CHICK       EHGLWAPNLHFNDPNPDIGSLKVVCKPTPVKGGLVSINSFGFGGSNAHVILR--
PKS17_DICDI     KNRSLVPNIHFEKIKFEDWNIRVVTDEIQFPINKLINNCFGLSGSNCHMIL---
PKS16_DICDI     KNRSLVPNIHFEKIKFEDWNIRVVTDEIQFPTNKLINNCFGLSGSNCHMIL---
MCAS_MYCBO      RHGVVPPLLHFDELSDVETGLFVPPNGNDHTPKRVAVSSFGMSGTNVHAIV---
PKS3_DICDI      KNRYFIPNLHFKKFNEWNLKVVVEPTPFPKKEITMAVNNFGVTGSNVCIILK--
FAS_RAT         ENGVWAPNLHFHNPNPEIPALQVVDRPLPVRGGIVGINSFGFGGANVHVILQ--
ERYA1_SACER     RAGTLPRTLHAKEIDWSSGAISLLPWPAGARPRRAGVSSFGISGTNAHAIIEE-
PKS1_DICDI      KNRMLVPSINCSNLNPSIPNISVIREIRQFPTDKLVNNSFGFGGSNCHLIIQE-
PHAS_MYCTU      KHGVVPRNLHFTRLPDEIAGITTNLFVPEVTTPWPTNSSYGFSGTNVHAVVEQ-
PHAS_MYCTA      KHGVVPRNLHFTRLPDEIAGITTNLFVPEVTTPWPTNSSYGFSGTNVHAVVEQ-
PHAS_MYCBP      KHGVVPRNLHFTRLPDEIAGITTNLFVPEVTTPWPTNSSYGFSGTNVHAVVEQ-
PHAS_MYCBO      KHGVVPRNLHFTRLPDEIAGITTNLFVPEVTTPWPTNSSYGFSGTNVHAVVEQ-
LNKS_ASPTE      RHGVIPPNLLFDKISPRVANLRIPPALPPGQPRRASVNSFGFGGTNAHAIIEE-
FAS_MOUSE       EHGVWAPNLHFHNPNPEIPALQVVDRPLPVRGGNVGINSFGFGGSNVHVILQ--
FAS_HUMAN       EHGLWAPNLHFHSPNPEIPALQVVDQPLPVRGGNVGINSFGFGGSNVHII----
LNKS_ASPTN      RHGVIPPNLLFDKISPRVANLRIPPALPPGQPRRASVNSFGFGGTNAHAIIEE-
MSAS_PENPA      QKGVLPPQANLTKLDWKTAGVKVVQEATPWPESDPIRRSYGYGGTVSHAVIEE-
ERYA2_SACER     RHGMLPRSLHADELDWESGAVEVVPWPAGERPRRAGVSSFGVSGTNAHVIVEE-
PKSJ_BACSU      YHQELAPSVNYKETDLASSPFYVVTLSREIKTHRAALSSFGLGGTNTHAIFEQ-
PKSN_BACSU      KHKTLVKSLHCENVN---------------------------------------
PPSA_MYCTU      QHGQIPPNQHFETANPHIPFTDLRMKVVDTQTEWPATSSFGFGGTNAHVVIEQ-
PKSM_BACSU      KYGQIAPSLHAQRLNEFSHTPFVVQQQLGEWKRPVIGSSFGAGGSNAHIILEE-
PKS31_DICDI     KNKLFLQNINFKEINFKEWGLKVVIKFNENKSTVMLVNNFGITGSNVCLILSEL
PKS13_DICDI     KNKCFAPNINFK------------------------------------------
PKS15_DICDI     KNGYFVPNINFNKPNPMIKNLKVVIQFNTNKQITMLINSFGITGSNCCLIL---
PKS41_DICDI     KNQCFVPNLNFNK-----------------------------------------
MYCA_BACSU      NHKKIPPLAHFNKPNPLIVNQEVMDFTPEDRPLRGGISSFGFSGTNAHVVLEE-
PKS2_DICDI      KNREFVPNIKFDEWKVKVCTQNTPFPTIRGKPISIAINSFGITGSNACLLL---
PKS25_DICDI     KNKCFAPNIHFKAIKFKEWNLKVVIPFNENKNTSMIINNFGVTGSNCCLVL---
PKS24_DICDI     KNKCFAPNIHFKAIKFKEWNLKVVIPFNKFKNTSMVVNNFGATGSNCCLVL---
PKS21_DICDI     KNKHYAPNVNFDQINFKDWNIKVVFTNNNEKPVSMVINNFGVTGSNCCLIL---
FAS_ANSAN       EHG---------------------------------------------------
PPSB_MYCTU      QRATIPPNLHFSQWNPDAASTRFFVPTQNSPWPTAEGSSFGLGGTNAHVIIEQ-
PKS30_DICDI     KNKLFLQNINFKEINFKEWGLKVVIKFNENKSTVMLINNFGVTGSNVCLIL---
PKS45_DICDI     KHNFDKPNPNIKFDEWKIKVCTENTPFPNNKKVSIAINSFGITGSNVCLIL---
PKS44_DICDI     KHNFDKPNPNIKFDEWKIKVCTENTPFPNNKKVSIAINSFGITGSNACLIL---
PKS29_DICDI     KNKLFLQNINFKEINFKEWGLKVVIKFNENKPTVMLINNFGITGSNVCLIL---
PKSL1_ASPPA     QHDTIPPHCGIK------------------------------------------
PKS14_DICDI     KNKYLTPNINFKKFDEW--NLKVVKDLQKTDNFSMILNNFGITGSNCCLIL---
PKS40_DICDI     KN----------------------------------------------------
PKS19_DICDI     KNKHYAPNVNFDQINFKDWNIKVVFTNINEKPVSMVINNFGVTGSNCCLIL---
PKS10_DICDI     KNKSLVPCVNFSKPNPQ-------------------------------------
PKSL_BACSU      KYRQLAPSLHSQELEEWKRPIISVNGKDIELPRIAGVSSFGAGGVNAHILIEE-
PKS34_DICDI     KNKLFLQNINFKEINFKEWGLKVVIKFNENKSTVMLLNNFGVTGSNVCLIL---
STCA_EMENI      KNDTIPPHCGIK------------------------------------------
PKS18_DICDI     KNQYLTPNVNFKKFDEW--NLKVVKDVKKSNNFSMILNNFGITGSNCCLIL---
PKS33_DICDI     KNKLFLQNINFKEINFKEWGLKVVIKFNENKSTVMLINNFGITGSNVCLIL---
OL56_STRAT      GRGVVPKTLHVDEVDWSAGAVELLWEPEAERLRRAGISAFGVSGTNAHVIV---
PKS39_DICDI     KNKLFLQNINFKEINFKEWGLKVVIKFNENKPTVMLINNFGITGSNVCLIL---
PKS38_DICDI     KNKLFLQNINFKEINFKEWGLKVVIKFNENKPTVMLINNFGITGSNVCLIL---
PKS32_DICDI     KNKLFLQNINFKEINFKEWGLKVVIKFNENKQTVMLINNFGVTGSNVCLIL---
ERYA3_SACER     RHGEMPRTLHFDEIEWDLGAVSVVSWPAGERPRRAGVSSFGISGTNAHVIV---
PKS28_DICDI     KNKLFLQNINFKEINFKEWALKVVITFNENKTTVMLINNFGVTGSNVCLIL---
PKS6_DICDI      KYQCFLPNIHFKNIKFNEWNLKVVNKRNNEKPVSMMINNFGVTGSNCCLLI---
PKS7_DICDI      KYQCFLPNIHFKEWNLKVVTSPIPFNRKNEKPVSMMINNFGVTGSNCCLLI---
PKS8_DICDI      KYQCFLPNIHFKNIKFNEWNLKVVNKRINEKPVSMMINNFGVTGSNCCLLI---
PKS5_DICDI      KYQCFLPNIHFKEWNLKVVTSPIPFNRNNEKSVSMMINNFGVTGSNCCLLI---
PKS27_DICDI     KNKLFLQNINFKEINFKEWALKVVIKFNENKTTVMLINNFGVTGSNVCLIL---
STCJ_EMENI      DTGLVPGNRNADDVDPALRSFSPIRSIQTDGIKAFLLNSCGFGQKEAQLV----
PKS9_DICDI      KYQCFLPNIHFKNIKFNEWNLKVVNKRNNEKPVSMMINNFGVTGSNCCLLI---
WA_EMENI        KENMIPPHCGIK------------------------------------------
PKS42_DICDI     KYRQFLPNINFKTIKFKEWNLKVVVPFNNNKQTIMAINNFGVSGSNCCIIL---
PKS23_DICDI     KHHFNNPNPNI-KFKEWNVKVCTETTAFPDRQVSMAINSFGITGSNACVLL---
PKS22_DICDI     KHHFNNPNPNI-KFKEWNVKVCTETTAFPDRQVSMAINSFGITGSNACVLL---
FAS2_SCHPO      ------------------------------------------------------
PKS37_DICDI     K-----------------------------------------------------
PKSR_BACSU      KKGTLVPTINLQEQTEPWHRLN-DPETGKQLPRRSMINSFGAGGAYANLIIEE-
KASB_STRCO      REGVIAPTAGVTSVPRE-YGIDLV------------------------------
FADI_YERPY      ------------------------------------------------------
FADI_YERPS      ------------------------------------------------------
FADI_YERPP      ------------------------------------------------------
FADI_YERPN      ------------------------------------------------------
FADI_YERPG      ------------------------------------------------------
FADI_YERPE      ------------------------------------------------------
FADI_YERPB      ------------------------------------------------------
FADI_YERPA      ------------------------------------------------------
FADI_YERP3      ------------------------------------------------------
FAS2_CANAL      ESGLVPGNRNADNVDKLLEQYEYVRSIQTDGIKAVSVTSFGFGQKGAQAVV---
FADI_AERS4      ------------------------------------------------------
FADI_AERHH      ------------------------------------------------------
KAS2_STRCM      RAGVIPPTVHIDPCPE--------------------------------------
FAS2_YEAST      NSGIIPGNRNADNVDK--------------------------------------
FADI_PECCP      ------------------------------------------------------
FADI_ERWCT      ------------------------------------------------------
KAS2_STRCO      EHGLIPPTPHVLDVCHDLDLVTGRARPAEPRTALVLAR--GLMGSNSALVLRR-
FADI_YERE8      ------------------------------------------------------
MURQ_ENTS8      ------------------------------------------------------
FADI_PHOLL      ------------------------------------------------------
FADI_PSEHT      ------------------------------------------------------