[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF67742.1

[Show Plain Result]


## Summary of Sequence Search
    1::643
    1::646       0.0  85%  647 aa  CCMF_ECOLI RecName: Full=Cytochrome c-type biogenesis protein ccmF;
    1::641       0.0  57%  648 aa  CCMF_HAEIN RecName: Full=Cytochrome c-type biogenesis protein ccmF;
    1::619     e-158  53%  657 aa  CCMF_PSEAE RecName: Full=Cytochrome c-type biogenesis protein ccmF;
    7::623     e-148  49%  660 aa  CCMF_PSEFL RecName: Full=Cytochrome c-type biogenesis protein
    1::623     e-130  47%  676 aa  CCMF_RHIME RecName: Full=Cytochrome c-type biogenesis protein cycK;
    1::616     e-109  49%  653 aa  CCMF_RHOCA RecName: Full=Cytochrome c-type biogenesis protein ccl1;
   24::612     e-107  37%  635 aa  NRFE_HAEIN RecName: Full=Cytochrome c-type biogenesis protein nrfE;
    1::649     e-100  40%  660 aa  CCMF_BRAJA RecName: Full=Cytochrome c-type biogenesis protein cycK;
   39::527     5e-52  37%  552 aa  NRFE_ECOLI RecName: Full=Cytochrome c-type biogenesis protein nrfE;
   43::160     5e-40  59%  203 aa  CCF2_ARATH RecName: Full=Putative cytochrome c biogenesis ccmF
   31::296     2e-39  50%  577 aa  CCBS_OENBE RecName: Full=Probable cytochrome c biosynthesis
  320::420     3e-37  62%  509 aa  CCBS_MARPO RecName: Full=Probable cytochrome c biosynthesis
   31::89      9e-30  44%  579 aa  CCBS_DAUCA RecName: Full=Probable cytochrome c biosynthesis
   85::302     2e-11  32%  311 aa  CCSA_SYNR3 RecName: Full=Cytochrome c biogenesis protein ccsA;
   90::273     3e-10  31%  318 aa  CCSA_PROMM RecName: Full=Cytochrome c biogenesis protein ccsA;
   90::273     3e-10  31%  318 aa  CCSA_PROM3 RecName: Full=Cytochrome c biogenesis protein ccsA;
  217::305     2e-09  33%  308 aa  CCSA_CUSRE RecName: Full=Cytochrome c biogenesis protein ccsA;
  222::310     2e-09  37%  313 aa  CCSA_TOBAC RecName: Full=Cytochrome c biogenesis protein ccsA;
  222::310     2e-09  37%  313 aa  CCSA_NICTO RecName: Full=Cytochrome c biogenesis protein ccsA;
  222::310     2e-09  37%  313 aa  CCSA_NICSY RecName: Full=Cytochrome c biogenesis protein ccsA;
  229::306     3e-09  38%  320 aa  CCSA_PANGI RecName: Full=Cytochrome c biogenesis protein ccsA;
  233::310     3e-09  38%  324 aa  CCSA_DAUCA RecName: Full=Cytochrome c biogenesis protein ccsA;
  222::310     4e-09  37%  313 aa  CCSA_SOLTU RecName: Full=Cytochrome c biogenesis protein ccsA;
  222::310     4e-09  37%  313 aa  CCSA_SOLLC RecName: Full=Cytochrome c biogenesis protein ccsA;
  222::310     4e-09  37%  313 aa  CCSA_SOLBU RecName: Full=Cytochrome c biogenesis protein ccsA;
  218::264     4e-09  49%  309 aa  CCSA_PROMS RecName: Full=Cytochrome c biogenesis protein ccsA;
  218::264     4e-09  49%  314 aa  CCSA_PROMP RecName: Full=Cytochrome c biogenesis protein ccsA;
  218::264     4e-09  49%  312 aa  CCSA_PROM5 RecName: Full=Cytochrome c biogenesis protein ccsA;
  231::308     4e-09  37%  322 aa  CCSA_COFAR RecName: Full=Cytochrome c biogenesis protein ccsA;
  231::311     5e-09  32%  320 aa  CCSA_SYNPW RecName: Full=Cytochrome c biogenesis protein ccsA;
  218::264     5e-09  49%  309 aa  CCSA_PROM9 RecName: Full=Cytochrome c biogenesis protein ccsA;
  218::298     5e-09  41%  309 aa  CCSA_PROM2 RecName: Full=Cytochrome c biogenesis protein ccsA;
  218::264     5e-09  49%  309 aa  CCSA_PROM0 RecName: Full=Cytochrome c biogenesis protein ccsA;
  231::316     5e-09  31%  322 aa  CCSA_GUIAB RecName: Full=Cytochrome c biogenesis protein ccsA;
  229::307     5e-09  37%  315 aa  CCSA_CHLVU RecName: Full=Cytochrome c biogenesis protein ccsA;
  231::316     6e-09  31%  322 aa  CCSA_HELAN RecName: Full=Cytochrome c biogenesis protein ccsA;
  221::309     6e-09  37%  312 aa  CCSA_ATRBE RecName: Full=Cytochrome c biogenesis protein ccsA;
  224::306     1e-08  30%  315 aa  CCSA_PROMT RecName: Full=Cytochrome c biogenesis protein ccsA;
  224::306     1e-08  30%  315 aa  CCSA_PROM1 RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::318     1e-08  36%  319 aa  CCSA_CERDE RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::307     2e-08  38%  322 aa  CCSA_VITVI RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::307     2e-08  37%  321 aa  CCSA_PLAOC RecName: Full=Cytochrome c biogenesis protein ccsA;
  234::322     2e-08  37%  323 aa  CCSA_LOTJA RecName: Full=Cytochrome c biogenesis protein ccsA;
  231::316     2e-08  31%  322 aa  CCSA_LACSA RecName: Full=Cytochrome c biogenesis protein ccsA;
  239::316     2e-08  37%  330 aa  CCSA_JASNU RecName: Full=Cytochrome c biogenesis protein ccsA;
  232::309     2e-08  38%  323 aa  CCSA_SPIOL RecName: Full=Cytochrome c biogenesis protein ccsA;
  228::315     2e-08  37%  317 aa  CCSA_PELHO RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::307     2e-08  39%  322 aa  CCSA_MANES RecName: Full=Cytochrome c biogenesis protein ccsA;
  222::314     2e-08  39%  317 aa  CCSA_IPOPU RecName: Full=Cytochrome c biogenesis protein ccsA;
  238::315     2e-08  32%  322 aa  CCSA_CYAPA RecName: Full=Cytochrome c biogenesis protein ccsA;
  225::310     3e-08  30%  316 aa  CCSA_TRACE RecName: Full=Cytochrome c biogenesis protein ccsA;
  235::312     3e-08  33%  319 aa  CCSA_PORYE RecName: Full=Cytochrome c biogenesis protein ccsA;
  232::311     3e-08  40%  321 aa  CCSA_PHAAO RecName: Full=Cytochrome c biogenesis protein ccsA;
  217::294     3e-08  32%  301 aa  CCSA_GUITH RecName: Full=Cytochrome c biogenesis protein ccsA;
  231::308     3e-08  37%  320 aa  CCSA_GOSHI RecName: Full=Cytochrome c biogenesis protein ccsA;
  231::308     3e-08  37%  320 aa  CCSA_GOSBA RecName: Full=Cytochrome c biogenesis protein ccsA;
  239::327     3e-08  38%  328 aa  CCSA_CRUWA RecName: Full=Cytochrome c biogenesis protein ccsA;
  250::327     4e-08  38%  334 aa  CCSA_SYNY3 RecName: Full=Cytochrome c biogenesis protein ccsA;
  231::308     4e-08  37%  321 aa  CCSA_ORYSJ RecName: Full=Cytochrome c biogenesis protein ccsA;
  231::308     4e-08  37%  321 aa  CCSA_ORYSI RecName: Full=Cytochrome c biogenesis protein ccsA;
  231::308     4e-08  37%  321 aa  CCSA_ORYSA RecName: Full=Cytochrome c biogenesis protein ccsA;
  231::308     4e-08  37%  321 aa  CCSA_ORYNI RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::315     4e-08  31%  319 aa  CCSA_OENPA RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::315     4e-08  31%  319 aa  CCSA_OENGL RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::315     4e-08  31%  319 aa  CCSA_OENEH RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::315     4e-08  31%  319 aa  CCSA_OENBI RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::315     4e-08  31%  319 aa  CCSA_OENAR RecName: Full=Cytochrome c biogenesis protein ccsA;
  239::327     4e-08  38%  328 aa  CCSA_ARAHI RecName: Full=Cytochrome c biogenesis protein ccsA;
  239::327     5e-08  38%  328 aa  CCSA_OLIPU RecName: Full=Cytochrome c biogenesis protein ccsA;
  232::320     5e-08  36%  321 aa  CCSA_NANDO RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::307     5e-08  41%  321 aa  CCSA_MORIN RecName: Full=Cytochrome c biogenesis protein ccsA;
  228::315     5e-08  35%  319 aa  CCSA_FAGEA RecName: Full=Cytochrome c biogenesis protein ccsA;
  244::321     5e-08  38%  328 aa  CCSA_CYAP7 RecName: Full=Cytochrome c biogenesis protein ccsA;
  251::328     5e-08  38%  335 aa  CCSA_CYAA5 RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::307     5e-08  38%  317 aa  CCSA_CITSI RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::317     5e-08  34%  321 aa  CCSA_BUXMI RecName: Full=Cytochrome c biogenesis protein ccsA;
  239::327     5e-08  38%  328 aa  CCSA_BARVE RecName: Full=Cytochrome c biogenesis protein ccsA;
  239::324     5e-08  33%  328 aa  CCSA_ARATH RecName: Full=Cytochrome c biogenesis protein ccsA;
  267::344     7e-08  39%  351 aa  CCSA_TRIEI RecName: Full=Cytochrome c biogenesis protein ccsA;
  239::327     7e-08  37%  328 aa  CCSA_NASOF RecName: Full=Cytochrome c biogenesis protein ccsA;
  244::321     7e-08  38%  328 aa  CCSA_MICAN RecName: Full=Cytochrome c biogenesis protein ccsA;
  212::315     7e-08  35%  319 aa  CCSA_LOLPR RecName: Full=Cytochrome c biogenesis protein ccsA;
  238::326     7e-08  37%  327 aa  CCSA_LOBMA RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::307     7e-08  38%  321 aa  CCSA_LIRTU RecName: Full=Cytochrome c biogenesis protein ccsA;
  215::308     7e-08  37%  322 aa  CCSA_HORVU RecName: Full=Cytochrome c biogenesis protein ccsA;
  257::334     7e-08  38%  341 aa  CCSA_CYAP8 RecName: Full=Cytochrome c biogenesis protein ccsA;
  231::308     7e-08  37%  320 aa  CCSA_CARPA RecName: Full=Cytochrome c biogenesis protein ccsA;
  215::308     7e-08  37%  322 aa  CCSA_BRADI RecName: Full=Cytochrome c biogenesis protein ccsA;
  212::305     7e-08  37%  319 aa  CCSA_AGRST RecName: Full=Cytochrome c biogenesis protein ccsA;
  254::331     9e-08  31%  338 aa  CCSA_SYNP2 RecName: Full=Cytochrome c biogenesis protein ccsA;
  214::307     9e-08  37%  321 aa  CCSA_SORBI RecName: Full=Cytochrome c biogenesis protein ccsA;
  214::307     9e-08  37%  321 aa  CCSA_SACOF RecName: Full=Cytochrome c biogenesis protein ccsA;
  214::307     9e-08  37%  321 aa  CCSA_SACHY RecName: Full=Cytochrome c biogenesis protein ccsA;
  227::305     9e-08  36%  312 aa  CCSA_ODOSI RecName: Full=Cytochrome c biogenesis protein ccsA;
  239::316     9e-08  40%  328 aa  CCSA_LEPVR RecName: Full=Cytochrome c biogenesis protein ccsA;
  268::346     9e-08  32%  353 aa  CCSA_CHLRE RecName: Full=Cytochrome c biogenesis protein ccsA;
  239::327     9e-08  38%  328 aa  CCSA_CAPBU RecName: Full=Cytochrome c biogenesis protein ccsA;
   77::297     1e-07  30%  305 aa  CCSA_SYNS3 RecName: Full=Cytochrome c biogenesis protein ccsA;
  241::318     1e-07  32%  325 aa  CCSA_SYNP6 RecName: Full=Cytochrome c biogenesis protein ccsA;
  241::318     1e-07  32%  325 aa  CCSA_SYNE7 RecName: Full=Cytochrome c biogenesis protein ccsA;
  232::320     1e-07  42%  321 aa  CCSA_PIPCE RecName: Full=Cytochrome c biogenesis protein ccsA;
  269::346     1e-07  32%  353 aa  CCSA_NOSP7 RecName: Full=Cytochrome c biogenesis protein ccsA;
  214::307     1e-07  37%  321 aa  CCSA_MAIZE RecName: Full=Cytochrome c biogenesis protein ccsA;
  237::315     1e-07  32%  322 aa  CCSA_HETA4 RecName: Full=Cytochrome c biogenesis protein ccsA;
  237::315     1e-07  32%  322 aa  CCSA_HETA2 RecName: Full=Cytochrome c biogenesis protein ccsA;
  267::344     1e-07  32%  351 aa  CCSA_ANAVT RecName: Full=Cytochrome c biogenesis protein ccsA;
  267::344     1e-07  32%  351 aa  CCSA_ANASP RecName: Full=Cytochrome c biogenesis protein ccsA;
  239::327     1e-07  37%  328 aa  CCSA_AETGR RecName: Full=Cytochrome c biogenesis protein ccsA;
  239::327     1e-07  37%  328 aa  CCSA_AETCO RecName: Full=Cytochrome c biogenesis protein ccsA;
  227::304     2e-07  37%  316 aa  CCSA_RANMC RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::307     2e-07  39%  319 aa  CCSA_EUCGG RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::307     2e-07  37%  321 aa  CCSA_DRIGR RecName: Full=Cytochrome c biogenesis protein ccsA;
  236::280     2e-07  42%  325 aa  CCSA_SOYBN RecName: Full=Cytochrome c biogenesis protein ccsA;
  235::312     2e-07  32%  319 aa  CCSA_PORPU RecName: Full=Cytochrome c biogenesis protein ccsA;
  266::343     3e-07  32%  350 aa  CCSA_SYNJB RecName: Full=Cytochrome c biogenesis protein ccsA;
  260::337     3e-07  32%  344 aa  CCSA_SYNJA RecName: Full=Cytochrome c biogenesis protein ccsA;
  238::326     3e-07  41%  327 aa  CCSA_DRANE RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::307     3e-07  36%  321 aa  CCSA_DIOEL RecName: Full=Cytochrome c biogenesis protein ccsA;
  235::312     4e-07  32%  319 aa  CCSA_THEEB RecName: Full=Cytochrome c biogenesis protein ccsA;
   82::261     4e-07  34%  304 aa  CCSA_SYNSC RecName: Full=Cytochrome c biogenesis protein ccsA;
  239::327     4e-07  33%  328 aa  CCSA_PHAVU RecName: Full=Cytochrome c biogenesis protein ccsA;
  236::313     4e-07  32%  320 aa  CCSA_MARPO RecName: Full=Cytochrome c biogenesis protein ccsA;
  221::264     4e-07  45%  293 aa  CCSA_CYACA RecName: Full=Cytochrome c biogenesis protein ccsA;
  231::308     4e-07  37%  322 aa  CCSA_CHLSC RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::307     5e-07  36%  321 aa  CCSA_POPTR RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::307     5e-07  36%  321 aa  CCSA_POPAL RecName: Full=Cytochrome c biogenesis protein ccsA;
  237::322     5e-07  33%  324 aa  CCSA_LEMMI RecName: Full=Cytochrome c biogenesis protein ccsA;
  232::309     5e-07  39%  323 aa  CCSA_CUCSA RecName: Full=Cytochrome c biogenesis protein ccsA;
  232::309     5e-07  45%  323 aa  CCSA_CALFG RecName: Full=Cytochrome c biogenesis protein ccsA;
  217::261     6e-07  44%  305 aa  CCSA_SYNPX RecName: Full=Cytochrome c biogenesis protein ccsA;
  220::297     6e-07  29%  305 aa  CCSA_MESVI RecName: Full=Cytochrome c biogenesis protein ccsA;
  249::326     6e-07  32%  333 aa  CCSA_ACAM1 RecName: Full=Cytochrome c biogenesis protein ccsA;
  217::261     8e-07  42%  304 aa  CCSA_SYNS9 RecName: Full=Cytochrome c biogenesis protein ccsA;
  221::299     8e-07  29%  306 aa  CCSA_GALSU RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::307     1e-06  36%  317 aa  CCSA_ILLOL RecName: Full=Cytochrome c biogenesis protein ccsA;
  252::293     2e-06  43%  338 aa  CCSA_GLOVI RecName: Full=Cytochrome c biogenesis protein ccsA;
  253::295     4e-06  40%  339 aa  CCSA_ANTFO RecName: Full=Cytochrome c biogenesis protein ccsA;
  232::273     4e-06  43%  316 aa  CCSA_ADICA RecName: Full=Cytochrome c biogenesis protein ccsA;
  218::261     5e-06  41%  305 aa  CCSA_WELMI RecName: Full=Cytochrome c biogenesis protein ccsA;
  239::273     5e-06  49%  316 aa  CCSA_PROMA RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::307     9e-06  36%  321 aa  CCSA_ACOCL RecName: Full=Cytochrome c biogenesis protein ccsA;
  230::307     9e-06  36%  321 aa  CCSA_ACOAM RecName: Full=Cytochrome c biogenesis protein ccsA;
  241::311     1e-05  38%  311 aa  CCSA_PROM4 RecName: Full=Cytochrome c biogenesis protein ccsA;
  235::305     3e-05  35%  308 aa  CCSA_CUSEX RecName: Full=Cytochrome c biogenesis protein ccsA;
  245::297     7e-05  36%  382 aa  CCF1_ARATH RecName: Full=Putative cytochrome c biogenesis ccmF
   96::179     1e-04  37%  304 aa  BCHG_RHOCA RecName: Full=Bacteriochlorophyll synthase 33 kDa
  242::301     2e-04  35%  313 aa  CCSA_AMBTC RecName: Full=Cytochrome c biogenesis protein ccsA;
  249::308     2e-04  36%  322 aa  CCSA_WHEAT RecName: Full=Cytochrome c biogenesis protein ccsA;
  236::276     3e-04  37%  320 aa  CCSA_PINTH RecName: Full=Cytochrome c biogenesis protein ccsA;
  236::295     4e-04  36%  308 aa  CCSA_NYMAL RecName: Full=Cytochrome c biogenesis protein ccsA;
  310::391     8e-04  31%  391 aa  RESC_BACSU RecName: Full=Cytochrome c biogenesis protein resC;
    1::643

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MMPEYGHXXXXXXXXXXXXXSVYPLWGVARGDARMMASAGVFAWLLFICVAGAFFVLVHAFVVNDFTVAY
CCMF_ECOLI      MMPEIGNXXXXXXXXXXXXXSVYPLWGVARGDARMMASSRLFAWLLFMSVAGAFLVLVNAFVVNDFTVTY
CCMF_HAEIN      MIAELGNYXXXXXXXXXXXXXIFPLWGAEKGNAQLMALARPMTYGXXXXXXXXXXXXXXXXXVNDFSVQY
CCMF_PSEAE      MIPEXXXXXXXXXXXXXXVQSSLPLVGAWRGDRQWMSLARPAAWGQFAFLAFAFGCLTWAFLRDDFSVAY
CCMF_PSEFL      -IPELGQLRMILALCFAVVQAVVPLLGAWPGDRLWMSLAQPARWGQFAFLLFAFGCLTYAFMTDDFSVAY
CCMF_RHIME      MIIELGHYALVLALATAIIQGVLPVLGVRRGDPSLMGLAANAALVCFLLVAFSFAVLTFAYVTSDFSVKN
CCMF_RHOCA      MIVETGHFALILALCVALVQAVIPLVGAQKGWSGWMAVATPAALAQFGLIAIAFAALTYAFVTSDFSLKL
NRFE_HAEIN      -----------------------PQFGLFKKNPTLINAAWPLSYIFTLATTLSIGLLAYSFAVDDFTLEY
CCMF_BRAJA      MIAESGHYALVLALGLALIQSIVPLIGARLRDDALMSVARSTALAQLLFVGASFVALVMLHVNSDFSVAN
NRFE_ECOLI      -------------------------------------------------------VLTYCFLISDFSVIY
CCF2_ARATH      ----------------------------------------------------------------------
CCBS_OENBE      ------------------------------------------AALAFWCILLSFLGLLFCHISNN-----
CCBS_MARPO      ----------------------------------------------------------------------
CCBS_DAUCA      ------------------------------------------AALAFWCILLSFLGLSFRHIPNNLSNYN
CCSA_SYNR3      ----------------------------------------------------------------------
CCSA_PROMM      ----------------------------------------------------------------------
CCSA_PROM3      ----------------------------------------------------------------------
CCSA_CUSRE      ----------------------------------------------------------------------
CCSA_TOBAC      ----------------------------------------------------------------------
CCSA_NICTO      ----------------------------------------------------------------------
CCSA_NICSY      ----------------------------------------------------------------------
CCSA_PANGI      ----------------------------------------------------------------------
CCSA_DAUCA      ----------------------------------------------------------------------
CCSA_SOLTU      ----------------------------------------------------------------------
CCSA_SOLLC      ----------------------------------------------------------------------
CCSA_SOLBU      ----------------------------------------------------------------------
CCSA_PROMS      ----------------------------------------------------------------------
CCSA_PROMP      ----------------------------------------------------------------------
CCSA_PROM5      ----------------------------------------------------------------------
CCSA_COFAR      ----------------------------------------------------------------------
CCSA_SYNPW      ----------------------------------------------------------------------
CCSA_PROM9      ----------------------------------------------------------------------
CCSA_PROM2      ----------------------------------------------------------------------
CCSA_PROM0      ----------------------------------------------------------------------
CCSA_GUIAB      ----------------------------------------------------------------------
CCSA_CHLVU      ----------------------------------------------------------------------
CCSA_HELAN      ----------------------------------------------------------------------
CCSA_ATRBE      ----------------------------------------------------------------------
CCSA_PROMT      ----------------------------------------------------------------------
CCSA_PROM1      ----------------------------------------------------------------------
CCSA_CERDE      ----------------------------------------------------------------------
CCSA_VITVI      ----------------------------------------------------------------------
CCSA_PLAOC      ----------------------------------------------------------------------
CCSA_LOTJA      ----------------------------------------------------------------------
CCSA_LACSA      ----------------------------------------------------------------------
CCSA_JASNU      ----------------------------------------------------------------------
CCSA_SPIOL      ----------------------------------------------------------------------
CCSA_PELHO      ----------------------------------------------------------------------
CCSA_MANES      ----------------------------------------------------------------------
CCSA_IPOPU      ----------------------------------------------------------------------
CCSA_CYAPA      ----------------------------------------------------------------------
CCSA_TRACE      ----------------------------------------------------------------------
CCSA_PORYE      ----------------------------------------------------------------------
CCSA_PHAAO      ----------------------------------------------------------------------
CCSA_GUITH      ----------------------------------------------------------------------
CCSA_GOSHI      ----------------------------------------------------------------------
CCSA_GOSBA      ----------------------------------------------------------------------
CCSA_CRUWA      ----------------------------------------------------------------------
CCSA_SYNY3      ----------------------------------------------------------------------
CCSA_ORYSJ      ----------------------------------------------------------------------
CCSA_ORYSI      ----------------------------------------------------------------------
CCSA_ORYSA      ----------------------------------------------------------------------
CCSA_ORYNI      ----------------------------------------------------------------------
CCSA_OENPA      ----------------------------------------------------------------------
CCSA_OENGL      ----------------------------------------------------------------------
CCSA_OENEH      ----------------------------------------------------------------------
CCSA_OENBI      ----------------------------------------------------------------------
CCSA_OENAR      ----------------------------------------------------------------------
CCSA_ARAHI      ----------------------------------------------------------------------
CCSA_OLIPU      ----------------------------------------------------------------------
CCSA_NANDO      ----------------------------------------------------------------------
CCSA_MORIN      ----------------------------------------------------------------------
CCSA_FAGEA      ----------------------------------------------------------------------
CCSA_CYAP7      ----------------------------------------------------------------------
CCSA_CYAA5      ----------------------------------------------------------------------
CCSA_CITSI      ----------------------------------------------------------------------
CCSA_BUXMI      ----------------------------------------------------------------------
CCSA_BARVE      ----------------------------------------------------------------------
CCSA_ARATH      ----------------------------------------------------------------------
CCSA_TRIEI      ----------------------------------------------------------------------
CCSA_NASOF      ----------------------------------------------------------------------
CCSA_MICAN      ----------------------------------------------------------------------
CCSA_LOLPR      ----------------------------------------------------------------------
CCSA_LOBMA      ----------------------------------------------------------------------
CCSA_LIRTU      ----------------------------------------------------------------------
CCSA_HORVU      ----------------------------------------------------------------------
CCSA_CYAP8      ----------------------------------------------------------------------
CCSA_CARPA      ----------------------------------------------------------------------
CCSA_BRADI      ----------------------------------------------------------------------
CCSA_AGRST      ----------------------------------------------------------------------
CCSA_SYNP2      ----------------------------------------------------------------------
CCSA_SORBI      ----------------------------------------------------------------------
CCSA_SACOF      ----------------------------------------------------------------------
CCSA_SACHY      ----------------------------------------------------------------------
CCSA_ODOSI      ----------------------------------------------------------------------
CCSA_LEPVR      ----------------------------------------------------------------------
CCSA_CHLRE      ----------------------------------------------------------------------
CCSA_CAPBU      ----------------------------------------------------------------------
CCSA_SYNS3      ----------------------------------------------------------------------
CCSA_SYNP6      ----------------------------------------------------------------------
CCSA_SYNE7      ----------------------------------------------------------------------
CCSA_PIPCE      ----------------------------------------------------------------------
CCSA_NOSP7      ----------------------------------------------------------------------
CCSA_MAIZE      ----------------------------------------------------------------------
CCSA_HETA4      ----------------------------------------------------------------------
CCSA_HETA2      ----------------------------------------------------------------------
CCSA_ANAVT      ----------------------------------------------------------------------
CCSA_ANASP      ----------------------------------------------------------------------
CCSA_AETGR      ----------------------------------------------------------------------
CCSA_AETCO      ----------------------------------------------------------------------
CCSA_RANMC      ----------------------------------------------------------------------
CCSA_EUCGG      ----------------------------------------------------------------------
CCSA_DRIGR      ----------------------------------------------------------------------
CCSA_SOYBN      ----------------------------------------------------------------------
CCSA_PORPU      ----------------------------------------------------------------------
CCSA_SYNJB      ----------------------------------------------------------------------
CCSA_SYNJA      ----------------------------------------------------------------------
CCSA_DRANE      ----------------------------------------------------------------------
CCSA_DIOEL      ----------------------------------------------------------------------
CCSA_THEEB      ----------------------------------------------------------------------
CCSA_SYNSC      ----------------------------------------------------------------------
CCSA_PHAVU      ----------------------------------------------------------------------
CCSA_MARPO      ----------------------------------------------------------------------
CCSA_CYACA      ----------------------------------------------------------------------
CCSA_CHLSC      ----------------------------------------------------------------------
CCSA_POPTR      ----------------------------------------------------------------------
CCSA_POPAL      ----------------------------------------------------------------------
CCSA_LEMMI      ----------------------------------------------------------------------
CCSA_CUCSA      ----------------------------------------------------------------------
CCSA_CALFG      ----------------------------------------------------------------------
CCSA_SYNPX      ----------------------------------------------------------------------
CCSA_MESVI      ----------------------------------------------------------------------
CCSA_ACAM1      ----------------------------------------------------------------------
CCSA_SYNS9      ----------------------------------------------------------------------
CCSA_GALSU      ----------------------------------------------------------------------
CCSA_ILLOL      ----------------------------------------------------------------------
CCSA_GLOVI      ----------------------------------------------------------------------
CCSA_ANTFO      ----------------------------------------------------------------------
CCSA_ADICA      ----------------------------------------------------------------------
CCSA_WELMI      ----------------------------------------------------------------------
CCSA_PROMA      ----------------------------------------------------------------------
CCSA_ACOCL      ----------------------------------------------------------------------
CCSA_ACOAM      ----------------------------------------------------------------------
CCSA_PROM4      ----------------------------------------------------------------------
CCSA_CUSEX      ----------------------------------------------------------------------
CCF1_ARATH      ----------------------------------------------------------------------
BCHG_RHOCA      ----------------------------------------------------------------------
CCSA_AMBTC      ----------------------------------------------------------------------
CCSA_WHEAT      ----------------------------------------------------------------------
CCSA_PINTH      ----------------------------------------------------------------------
CCSA_NYMAL      ----------------------------------------------------------------------
RESC_BACSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VAGNSNTQLPVWYRVAATWGAHEGSLLLWVLLMSGWTLAVAVFSRQVPADIVARVLAVMGMVCAGFLAFI
CCMF_ECOLI      VASNSNTQLPVWYRVAATWGAHEGSLLLWVLLMSGWTFAVAIFSQRIPLDIVARVLAIMGMVSVGFLLFI
CCMF_HAEIN      IVNNSNTTLPIYYRLSAVWGSHEGSLLLWIWLLAVWSFAVALLSKHLPQEAVARVLGIMGIISVGFVLFV
CCMF_PSEAE      VAGNSNSALPWYYKFSAVWGAHEGSLLLWALILGGWTFAVSIFSRQLPEVMLARVLAVMGMISTGFLLFL
CCMF_PSEFL      VANNSNSALPWYYLFSAVWGAHEGSLLLWALILGGWTFAVSVFSRQLPQVMLARVLAVMGMISIGFLLFL
CCMF_RHIME      VWENSHSLKPLIYKITGVWGNHEGSMLLWLLILVFFSAMVALFGRNLPETLKANVLAVQAWIATAFAFFV
CCMF_RHOCA      VYENSHTDKPMLYKVTGVWGNHEGSMLLWVLILXXXXXXXXXXXXXLPERLRARVLAVQGTIGVAFLVFV
NRFE_HAEIN      VAAHSNSQLPTFFKVAATWGGHEGSMXXXXXXXXXXXXXXXXXNRKNDRTFSAQSLSLLGLICFGFAVFI
CCMF_BRAJA      VYENSHSMKPLLYKITGVWGNHEGSMLLWVSILALFGGLVAAFGNNLPLSLRAHVLAVQAWIASAFYLFI
NRFE_ECOLI      VAQHSYSLLSWELKLAAVWGGHEGXXXXXXXXXXXXXXXXXXHYRQQTDPLFPXXXXXXXXXXXXXXXXX
CCF2_ARATH      ----------------------------------------------------------------------
CCBS_OENBE      ---NSNYNVPFFYQISGTWSNHEGSILLWCWILS------------------------------------
CCBS_MARPO      ----------------------------------------------------------------------
CCBS_DAUCA      VL---TANAPFFYQISGTWSNHEGSISLWCRILS------------------------------------
CCSA_SYNR3      ----------------------------------GCTFTQLFVERSWPSPLVPAATTPMALVCVAFASF-
CCSA_PROMM      ------------------------------------TLAQLLVERSLSSPIVSAAATPMALLCVAFASF-
CCSA_PROM3      ------------------------------------TLAQLLVERSLSSPIVSAAATPMALLCVAFASF-
CCSA_CUSRE      ----------------------------------------------------------------------
CCSA_TOBAC      ----------------------------------------------------------------------
CCSA_NICTO      ----------------------------------------------------------------------
CCSA_NICSY      ----------------------------------------------------------------------
CCSA_PANGI      ----------------------------------------------------------------------
CCSA_DAUCA      ----------------------------------------------------------------------
CCSA_SOLTU      ----------------------------------------------------------------------
CCSA_SOLLC      ----------------------------------------------------------------------
CCSA_SOLBU      ----------------------------------------------------------------------
CCSA_PROMS      ----------------------------------------------------------------------
CCSA_PROMP      ----------------------------------------------------------------------
CCSA_PROM5      ----------------------------------------------------------------------
CCSA_COFAR      ----------------------------------------------------------------------
CCSA_SYNPW      ----------------------------------------------------------------------
CCSA_PROM9      ----------------------------------------------------------------------
CCSA_PROM2      ----------------------------------------------------------------------
CCSA_PROM0      ----------------------------------------------------------------------
CCSA_GUIAB      ----------------------------------------------------------------------
CCSA_CHLVU      ----------------------------------------------------------------------
CCSA_HELAN      ----------------------------------------------------------------------
CCSA_ATRBE      ----------------------------------------------------------------------
CCSA_PROMT      ----------------------------------------------------------------------
CCSA_PROM1      ----------------------------------------------------------------------
CCSA_CERDE      ----------------------------------------------------------------------
CCSA_VITVI      ----------------------------------------------------------------------
CCSA_PLAOC      ----------------------------------------------------------------------
CCSA_LOTJA      ----------------------------------------------------------------------
CCSA_LACSA      ----------------------------------------------------------------------
CCSA_JASNU      ----------------------------------------------------------------------
CCSA_SPIOL      ----------------------------------------------------------------------
CCSA_PELHO      ----------------------------------------------------------------------
CCSA_MANES      ----------------------------------------------------------------------
CCSA_IPOPU      ----------------------------------------------------------------------
CCSA_CYAPA      ----------------------------------------------------------------------
CCSA_TRACE      ----------------------------------------------------------------------
CCSA_PORYE      ----------------------------------------------------------------------
CCSA_PHAAO      ----------------------------------------------------------------------
CCSA_GUITH      ----------------------------------------------------------------------
CCSA_GOSHI      ----------------------------------------------------------------------
CCSA_GOSBA      ----------------------------------------------------------------------
CCSA_CRUWA      ----------------------------------------------------------------------
CCSA_SYNY3      ----------------------------------------------------------------------
CCSA_ORYSJ      ----------------------------------------------------------------------
CCSA_ORYSI      ----------------------------------------------------------------------
CCSA_ORYSA      ----------------------------------------------------------------------
CCSA_ORYNI      ----------------------------------------------------------------------
CCSA_OENPA      ----------------------------------------------------------------------
CCSA_OENGL      ----------------------------------------------------------------------
CCSA_OENEH      ----------------------------------------------------------------------
CCSA_OENBI      ----------------------------------------------------------------------
CCSA_OENAR      ----------------------------------------------------------------------
CCSA_ARAHI      ----------------------------------------------------------------------
CCSA_OLIPU      ----------------------------------------------------------------------
CCSA_NANDO      ----------------------------------------------------------------------
CCSA_MORIN      ----------------------------------------------------------------------
CCSA_FAGEA      ----------------------------------------------------------------------
CCSA_CYAP7      ----------------------------------------------------------------------
CCSA_CYAA5      ----------------------------------------------------------------------
CCSA_CITSI      ----------------------------------------------------------------------
CCSA_BUXMI      ----------------------------------------------------------------------
CCSA_BARVE      ----------------------------------------------------------------------
CCSA_ARATH      ----------------------------------------------------------------------
CCSA_TRIEI      ----------------------------------------------------------------------
CCSA_NASOF      ----------------------------------------------------------------------
CCSA_MICAN      ----------------------------------------------------------------------
CCSA_LOLPR      ----------------------------------------------------------------------
CCSA_LOBMA      ----------------------------------------------------------------------
CCSA_LIRTU      ----------------------------------------------------------------------
CCSA_HORVU      ----------------------------------------------------------------------
CCSA_CYAP8      ----------------------------------------------------------------------
CCSA_CARPA      ----------------------------------------------------------------------
CCSA_BRADI      ----------------------------------------------------------------------
CCSA_AGRST      ----------------------------------------------------------------------
CCSA_SYNP2      ----------------------------------------------------------------------
CCSA_SORBI      ----------------------------------------------------------------------
CCSA_SACOF      ----------------------------------------------------------------------
CCSA_SACHY      ----------------------------------------------------------------------
CCSA_ODOSI      ----------------------------------------------------------------------
CCSA_LEPVR      ----------------------------------------------------------------------
CCSA_CHLRE      ----------------------------------------------------------------------
CCSA_CAPBU      ----------------------------------------------------------------------
CCSA_SYNS3      ------------------------------------TLTQLLVERSWPTPIVAAAATPMGLGCIAFASF-
CCSA_SYNP6      ----------------------------------------------------------------------
CCSA_SYNE7      ----------------------------------------------------------------------
CCSA_PIPCE      ----------------------------------------------------------------------
CCSA_NOSP7      ----------------------------------------------------------------------
CCSA_MAIZE      ----------------------------------------------------------------------
CCSA_HETA4      ----------------------------------------------------------------------
CCSA_HETA2      ----------------------------------------------------------------------
CCSA_ANAVT      ----------------------------------------------------------------------
CCSA_ANASP      ----------------------------------------------------------------------
CCSA_AETGR      ----------------------------------------------------------------------
CCSA_AETCO      ----------------------------------------------------------------------
CCSA_RANMC      ----------------------------------------------------------------------
CCSA_EUCGG      ----------------------------------------------------------------------
CCSA_DRIGR      ----------------------------------------------------------------------
CCSA_SOYBN      ----------------------------------------------------------------------
CCSA_PORPU      ----------------------------------------------------------------------
CCSA_SYNJB      ----------------------------------------------------------------------
CCSA_SYNJA      ----------------------------------------------------------------------
CCSA_DRANE      ----------------------------------------------------------------------
CCSA_DIOEL      ----------------------------------------------------------------------
CCSA_THEEB      ----------------------------------------------------------------------
CCSA_SYNSC      ------------------------------------TLTQLLVERAWPSPIVAAAATPMGLGCIAFASF-
CCSA_PHAVU      ----------------------------------------------------------------------
CCSA_MARPO      ----------------------------------------------------------------------
CCSA_CYACA      ----------------------------------------------------------------------
CCSA_CHLSC      ----------------------------------------------------------------------
CCSA_POPTR      ----------------------------------------------------------------------
CCSA_POPAL      ----------------------------------------------------------------------
CCSA_LEMMI      ----------------------------------------------------------------------
CCSA_CUCSA      ----------------------------------------------------------------------
CCSA_CALFG      ----------------------------------------------------------------------
CCSA_SYNPX      ----------------------------------------------------------------------
CCSA_MESVI      ----------------------------------------------------------------------
CCSA_ACAM1      ----------------------------------------------------------------------
CCSA_SYNS9      ----------------------------------------------------------------------
CCSA_GALSU      ----------------------------------------------------------------------
CCSA_ILLOL      ----------------------------------------------------------------------
CCSA_GLOVI      ----------------------------------------------------------------------
CCSA_ANTFO      ----------------------------------------------------------------------
CCSA_ADICA      ----------------------------------------------------------------------
CCSA_WELMI      ----------------------------------------------------------------------
CCSA_PROMA      ----------------------------------------------------------------------
CCSA_ACOCL      ----------------------------------------------------------------------
CCSA_ACOAM      ----------------------------------------------------------------------
CCSA_PROM4      ----------------------------------------------------------------------
CCSA_CUSEX      ----------------------------------------------------------------------
CCF1_ARATH      ----------------------------------------------------------------------
BCHG_RHOCA      ----------------------------------------------------------------------
CCSA_AMBTC      ----------------------------------------------------------------------
CCSA_WHEAT      ----------------------------------------------------------------------
CCSA_PINTH      ----------------------------------------------------------------------
CCSA_NYMAL      ----------------------------------------------------------------------
RESC_BACSU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LFTSGPFARTLPAFPVEGRDLNPLLQDPGLIFHPPLLYMGYVGFSVAFAFAIAALLSGRLDSAFTRFARP
CCMF_ECOLI      LFTSNPFSRTLPNFPIEGRDLNPLLQDPGLIFHPPLLYMGYVGFSVAFAFAIASLLSGRLDSTYARFTRP
CCMF_HAEIN      LFTSNPFTRTFPDFPVDGKELNPMLQDVGLIFHPPLLYMGYVGFSVAFAFAIASLMTGKLDSAWARWSRP
CCMF_PSEAE      IITSNPFSRLLPQTPMDGNDLNPLLQDVGLIVHPPMLYMGYVXXXXXXXXXXXXXXXXXXDAAWARWSRP
CCMF_PSEFL      IMTSNPFSRMLPQIPADGHDLNPLLQDIGLIVHPPMLYMGYVXXXXXXXXXXXXXXXXXXDAAWARWSRP
CCMF_RHIME      LLTSNPFARLVPA-PGEGRDLNPVLQDIGLAIHPPLLYLGYVGFSVCFSFAVAALIEGRIDAAWARWVRP
CCMF_RHOCA      LFTSNPFLR-LEEAPFNGRDMNPLLQDPGLAFHPPFLYLGYVGLSMAFSFAVAALIEGRVDAAWARWVRP
NRFE_HAEIN      LFYSNPFGRIFPA-PAEGRDLNPMLQDVGLIFHPPLLYVGYVGFAVNFAMSLSALIYNQSARQIARSMRG
CCMF_BRAJA      LVTSNPFLRIANP-PIEGRDLNPVLQDIGLAVHPPMLYLGYVGFSISFSFAIAALMEGRIDAAWARWVRP
NRFE_ECOLI      XXWSDPFVRIFPP-AIEGRDLNPMLQHPGLIFHPPXXXXXXXXXXXXXXXXXXXXXRGEFDGACARICWR
CCF2_ARATH      --------------------------------------------------------------------RI
CCBS_OENBE      -------------------ELNPVLQDPILAIHPPCIYAGDVASAMGFCLCRSKMMNG----------RI
CCBS_MARPO      ----------------------------------------------------------------------
CCBS_DAUCA      --------------------------------------------------------------------RI
CCSA_SYNR3      ---------ALPDTLQNAAPLVPALRSSWLVMHVSVIMMSYXGTVVLEAAPIA--LSERLDNLSYRTIT-
CCSA_PROMM      ---------ALPETLQEASPLVPALRSSWLVMHVSVIMCSYAALLVGSFLSMAVLFTDRQQTLELRSSSI
CCSA_PROM3      ---------ALPETLQEASPLVPALRSSWLVMHVSVIMCSYAALLVGSFLSMAVLFTDRQQTLELRSSSI
CCSA_CUSRE      ----------------------------------------------------------------------
CCSA_TOBAC      ----------------------------------------------------------------------
CCSA_NICTO      ----------------------------------------------------------------------
CCSA_NICSY      ----------------------------------------------------------------------
CCSA_PANGI      ----------------------------------------------------------------------
CCSA_DAUCA      ----------------------------------------------------------------------
CCSA_SOLTU      ----------------------------------------------------------------------
CCSA_SOLLC      ----------------------------------------------------------------------
CCSA_SOLBU      ----------------------------------------------------------------------
CCSA_PROMS      ----------------------------------------------------------------------
CCSA_PROMP      ----------------------------------------------------------------------
CCSA_PROM5      ----------------------------------------------------------------------
CCSA_COFAR      ----------------------------------------------------------------------
CCSA_SYNPW      ----------------------------------------------------------------------
CCSA_PROM9      ----------------------------------------------------------------------
CCSA_PROM2      ----------------------------------------------------------------------
CCSA_PROM0      ----------------------------------------------------------------------
CCSA_GUIAB      ----------------------------------------------------------------------
CCSA_CHLVU      ----------------------------------------------------------------------
CCSA_HELAN      ----------------------------------------------------------------------
CCSA_ATRBE      ----------------------------------------------------------------------
CCSA_PROMT      ----------------------------------------------------------------------
CCSA_PROM1      ----------------------------------------------------------------------
CCSA_CERDE      ----------------------------------------------------------------------
CCSA_VITVI      ----------------------------------------------------------------------
CCSA_PLAOC      ----------------------------------------------------------------------
CCSA_LOTJA      ----------------------------------------------------------------------
CCSA_LACSA      ----------------------------------------------------------------------
CCSA_JASNU      ----------------------------------------------------------------------
CCSA_SPIOL      ----------------------------------------------------------------------
CCSA_PELHO      ----------------------------------------------------------------------
CCSA_MANES      ----------------------------------------------------------------------
CCSA_IPOPU      ----------------------------------------------------------------------
CCSA_CYAPA      ----------------------------------------------------------------------
CCSA_TRACE      ----------------------------------------------------------------------
CCSA_PORYE      ----------------------------------------------------------------------
CCSA_PHAAO      ----------------------------------------------------------------------
CCSA_GUITH      ----------------------------------------------------------------------
CCSA_GOSHI      ----------------------------------------------------------------------
CCSA_GOSBA      ----------------------------------------------------------------------
CCSA_CRUWA      ----------------------------------------------------------------------
CCSA_SYNY3      ----------------------------------------------------------------------
CCSA_ORYSJ      ----------------------------------------------------------------------
CCSA_ORYSI      ----------------------------------------------------------------------
CCSA_ORYSA      ----------------------------------------------------------------------
CCSA_ORYNI      ----------------------------------------------------------------------
CCSA_OENPA      ----------------------------------------------------------------------
CCSA_OENGL      ----------------------------------------------------------------------
CCSA_OENEH      ----------------------------------------------------------------------
CCSA_OENBI      ----------------------------------------------------------------------
CCSA_OENAR      ----------------------------------------------------------------------
CCSA_ARAHI      ----------------------------------------------------------------------
CCSA_OLIPU      ----------------------------------------------------------------------
CCSA_NANDO      ----------------------------------------------------------------------
CCSA_MORIN      ----------------------------------------------------------------------
CCSA_FAGEA      ----------------------------------------------------------------------
CCSA_CYAP7      ----------------------------------------------------------------------
CCSA_CYAA5      ----------------------------------------------------------------------
CCSA_CITSI      ----------------------------------------------------------------------
CCSA_BUXMI      ----------------------------------------------------------------------
CCSA_BARVE      ----------------------------------------------------------------------
CCSA_ARATH      ----------------------------------------------------------------------
CCSA_TRIEI      ----------------------------------------------------------------------
CCSA_NASOF      ----------------------------------------------------------------------
CCSA_MICAN      ----------------------------------------------------------------------
CCSA_LOLPR      -------------------------------------------------------LTERLDSWSYRVIS-
CCSA_LOBMA      ----------------------------------------------------------------------
CCSA_LIRTU      ----------------------------------------------------------------------
CCSA_HORVU      -------------------------------------------------------LTERLDSWSYRIIS-
CCSA_CYAP8      ----------------------------------------------------------------------
CCSA_CARPA      ----------------------------------------------------------------------
CCSA_BRADI      -------------------------------------------------------LTERLDSWSYRVIS-
CCSA_AGRST      -------------------------------------------------------LTERLDSWSYRVIS-
CCSA_SYNP2      ----------------------------------------------------------------------
CCSA_SORBI      -------------------------------------------------------LTERLDSWSYRVIS-
CCSA_SACOF      -------------------------------------------------------LTERLDSWSYRVIS-
CCSA_SACHY      -------------------------------------------------------LTERLDSWSYRVIS-
CCSA_ODOSI      ----------------------------------------------------------------------
CCSA_LEPVR      ----------------------------------------------------------------------
CCSA_CHLRE      ----------------------------------------------------------------------
CCSA_CAPBU      ----------------------------------------------------------------------
CCSA_SYNS3      ---------ALPDQLQEASPLVPALRSSWLVMHVSVIMLGNVGDSEVQLSSVKFTRNELLDSLSYRTIT-
CCSA_SYNP6      ----------------------------------------------------------------------
CCSA_SYNE7      ----------------------------------------------------------------------
CCSA_PIPCE      ----------------------------------------------------------------------
CCSA_NOSP7      ----------------------------------------------------------------------
CCSA_MAIZE      -------------------------------------------------------LTERLDSWSYRVIS-
CCSA_HETA4      ----------------------------------------------------------------------
CCSA_HETA2      ----------------------------------------------------------------------
CCSA_ANAVT      ----------------------------------------------------------------------
CCSA_ANASP      ----------------------------------------------------------------------
CCSA_AETGR      ----------------------------------------------------------------------
CCSA_AETCO      ----------------------------------------------------------------------
CCSA_RANMC      ----------------------------------------------------------------------
CCSA_EUCGG      ----------------------------------------------------------------------
CCSA_DRIGR      ----------------------------------------------------------------------
CCSA_SOYBN      ----------------------------------------------------------------------
CCSA_PORPU      ----------------------------------------------------------------------
CCSA_SYNJB      ----------------------------------------------------------------------
CCSA_SYNJA      ----------------------------------------------------------------------
CCSA_DRANE      ----------------------------------------------------------------------
CCSA_DIOEL      ----------------------------------------------------------------------
CCSA_THEEB      ----------------------------------------------------------------------
CCSA_SYNSC      ---------ALPDQLQSAAPLVPALRSSWLVMHVSVIMIGSGGFRQAASIAVQLSTNEQLDSLSYRTIT-
CCSA_PHAVU      ----------------------------------------------------------------------
CCSA_MARPO      ----------------------------------------------------------------------
CCSA_CYACA      ----------------------------------------------------------------------
CCSA_CHLSC      ----------------------------------------------------------------------
CCSA_POPTR      ----------------------------------------------------------------------
CCSA_POPAL      ----------------------------------------------------------------------
CCSA_LEMMI      ----------------------------------------------------------------------
CCSA_CUCSA      ----------------------------------------------------------------------
CCSA_CALFG      ----------------------------------------------------------------------
CCSA_SYNPX      ----------------------------------------------------------------------
CCSA_MESVI      ----------------------------------------------------------------------
CCSA_ACAM1      ----------------------------------------------------------------------
CCSA_SYNS9      ----------------------------------------------------------------------
CCSA_GALSU      ----------------------------------------------------------------------
CCSA_ILLOL      ----------------------------------------------------------------------
CCSA_GLOVI      ----------------------------------------------------------------------
CCSA_ANTFO      ----------------------------------------------------------------------
CCSA_ADICA      ----------------------------------------------------------------------
CCSA_WELMI      ----------------------------------------------------------------------
CCSA_PROMA      ----------------------------------------------------------------------
CCSA_ACOCL      ----------------------------------------------------------------------
CCSA_ACOAM      ----------------------------------------------------------------------
CCSA_PROM4      ----------------------------------------------------------------------
CCSA_CUSEX      ----------------------------------------------------------------------
CCF1_ARATH      -----PFVRNFFVCTEPLAELNPVLQDPILAIHPPCIYAGDVASAEGFGLCRSKMMNG------------
BCHG_RHOCA      ---------------------------------------GLWGLYIAIAMSLLSLVVG------------
CCSA_AMBTC      ----------------------------------------------------------------------
CCSA_WHEAT      ----------------------------------------------------------------------
CCSA_PINTH      ----------------------------------------------------------------------
CCSA_NYMAL      ----------------------------------------------------------------------
RESC_BACSU      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           WTLAAWVFLTLGIVLGSAWAYYELGWGGWWFWDPVENASFMPWLAGTALLHSLAVTEQRAGFKAWTLLLS
CCMF_ECOLI      WTLAAWIFLTLGIVLGSAWAYYELGWGGWWFWDPVENASFMPWLVGTALMHSLAVTEQRASFKAWTLLLA
CCMF_HAEIN      WTLAAWVFLTLGIVLGSWWAYYELGWGGWWFWDPVENSSFMPWLAGTALIHSLSVTEKRGSFKAWTVXXX
CCMF_PSEAE      WTLVAWAFLGIGIVLGSWWAYYELGWGGWWFWDPVENASFMPWLVGTALIHSLAVTEKRGVFKSWTVXXX
CCMF_PSEFL      WTIVAWAFLGIGITLGSWWAYYELGWGGWWFWDPVENASFMPWLVGTALIHSLAVTEKRGVFKSWTVXXX
CCMF_RHIME      WTLAAWTFLTAGIAMGSYWAYYELGWGGWWFWDPVENASFMPWLAGTALLHSALVMEKREALKIWTVLLA
CCMF_RHOCA      WTLAAWIFLTIGIALGSWWAYYELGWGGFWFWDPVENASLMPWLLAAALLHSAIVVEKREALKSWTILLA
NRFE_HAEIN      WVLVSWLFLTIGIVLGAWWAYYELGWGGWWFWDPVENASLMPWXXXXXXXXXXMATEKQGVFSYWXXXXX
CCMF_BRAJA      WTLVAWIFLTLGIAMGSYWAYYELGWGGWWFWDPVENASLMPWLAGTALLHSALVMEKRNALKVWXXXXX
NRFE_ECOLI      WALPGWSALTAGIILGSWWAYCELGWGGWWFWDPVENASLLPWXXXXXXXXXXXXXRQRGIFCHWSLLLA
CCF2_ARATH      WILTCWWFLTVGILLGSWWAYHELGWGGWWFWDPVENASFMPWVLATACIHSVIL----PFLHSWTLFLN
CCBS_OENBE      WILTCWCFLNVGILLGSWWAYHELGWGGWWFWDPVENASFMPWVLATACIHSVILPL----LHSCTLLIN
CCBS_MARPO      WILTCWCFLTVGILLGSWWAYHELGWGGWWFWDPVENASFMPWVLATACIHSVILPK----LNDWTLFLN
CCBS_DAUCA      WILTCRWFLNVGILLGSWWAHHELGRGGWWFRDPVENASFMPRVLATARIHSVILPL----LHSWTSFLN
CCSA_SYNR3      ---VGFLLLTVGIISGAVWA--NEAWGSWWSWDPKETWALICWLVYAAYLHTRLSRGWQGRRPAWVAVSG
CCSA_PROMM      GTTVGFLLLTLGLISGAVWA--NEAWGSWWSWDPKETWALICWMVYAAYLHT------------------
CCSA_PROM3      GTTVGFLLLTLGLISGAVWA--NEAWGSWWSWDPKETWALICWMVYAAYLHT------------------
CCSA_CUSRE      -----FIFLTIGILSGAVWA--NEAWGSYWSWDPKETWAFITWIVFAIYLHTRININLQSTNSAIVASLG
CCSA_TOBAC      -----FTFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWIVFAIYLHTRTNRNLRGANSAIVLIIW
CCSA_NICTO      -----FTFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWIVFAIYLHTRTNRNLRGANSAIVLIIW
CCSA_NICSY      -----FTFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWIVFAIYLHTRTNRNLRGANSAIVLIIW
CCSA_PANGI      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWIVFAIYLHTRTNIKLRGANSAIVLIIW
CCSA_DAUCA      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWIVFAVYLHTRTNTNLQVENSAIVLIIW
CCSA_SOLTU      -----FTFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWIVFAIYLHTRTNRNLRGPNSAIVLIIW
CCSA_SOLLC      -----FTFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWIVFAIYLHTRTNRNLRGPNSAIVLIIW
CCSA_SOLBU      -----FTFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWIVFAIYLHTRTNRNLRGPNSAIVLIIW
CCSA_PROMS      --LVGFVLLTLGLISGAVWA--NEAWGTWWSWDPKETWAFISWLFYAAYLH-------------------
CCSA_PROMP      --LVGFVLLTLGLITGAIWA--NEAWGTWWSWDPKETWAFISWLFYAAYLH-------------------
CCSA_PROM5      --LVGFVLLTLGLITGAIWA--NEAWGTWWSWDPKETWAFISWLFYAAYLH-------------------
CCSA_COFAR      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWIIFAIYLHTRTTRNPKCANSAIVLIIW
CCSA_SYNPW      -----FLLLTVGIISGAVWA--NEAWGSWWSWDPKETWALICWLVYAAYLHTRLSRGWQGRRPAMVASLG
CCSA_PROM9      --LIGFVLLTLGLISGAVWA--NEAWGTWWSWDPKETWAFITWLFYAAYLH-------------------
CCSA_PROM2      --LIGFVLLTLGLISGAVWA--NEAWGTWWSWDPKETWAFISWMFYAAYLHSKGWQGRRPALLATTLVVL
CCSA_PROM0      --LIGFVLLTLGLISGAVWA--NEAWGTWWSWDPKETWAFISWLFYAAYLH-------------------
CCSA_GUIAB      -----FIFLTIGILSGAVWA--NEAWGSYWSWDPKETWAFITWIVFAIYLHTRTKKNLQGANSAIVATLG
CCSA_CHLVU      -------FLTLGILSGAIWANET--WGNYWSWDPKETWAFITWLTFACYLHSRLVGGWTGSKPALVASFG
CCSA_HELAN      -----FIFLTIGILSGAVWA--NEAWGSYWSWDPKETWAFITWIVFAIYLHTRTNKNLQGANSAIVATLG
CCSA_ATRBE      -----FTFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWIVFAIYLHTRTNINLRGANSAGFLIIW
CCSA_PROMT      ---AGFLLLTVGLISGAVWA--NEAWGSWWSWDPKETWALICWLVYAAYLHTRITRGWQGKKPAILAIAG
CCSA_PROM1      ---AGFLLLTVGLISGAVWA--NEAWGSWWSWDPKETWALICWLVYAAYLHTRLTRGWQGKKPAILAIAG
CCSA_CERDE      -----FTFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTVFAIYLHTRTNQNFQSANSAIVLIIW
CCSA_VITVI      -----FLFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHNLQVANSAIVASMGFLIIW
CCSA_PLAOC      -----FIFLTIGILSGAVWA--NEAWGAYWNWDPKETWAFITWTIFAIYLHTRTNKDLQGANSAIVLIIW
CCSA_LOTJA      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHSLEGLNSSIVASIGFLIIW
CCSA_LACSA      -----FIFLTIGILSGAVWA--NEAWGSYWSWDPKETWAFITWIVFAIYLHIRTNKNFQGANSAIVATLG
CCSA_JASNU      -----FLFLTIGILSGAVWA--NEAWGSYWSWDPKETWAFITWIVFAIFLHIRTNVKWKGTNSAIVLIIW
CCSA_SPIOL      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHIRTNKNLRGANSAIVLIIW
CCSA_PELHO      -----FLFLTIGILSGAVWA--NEAWGSYWSWDPKETWAFITWTIFAIYLH-IREKKNAEGVKSGFLIIW
CCSA_MANES      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYFH-IRTNKKLEGFHSGFLLIW
CCSA_IPOPU      -----FLFLTIGILSGAVWA--NEAWGSYWSWDPKETWAFITWIVFAIFLHTVASIVASIGF----LIIW
CCSA_CYAPA      --------LTIGIIAGAVWA--NEAWGSYWSWDPKETWALITWLIFAIYLHTRIIKGWQGKKAAMVASLG
CCSA_TRACE      -----FIFLTMGILSGAVWA--NEAWGSYWSWDPKETWAFITWIIFAIYLHTRTNKNFWGANSAIVAVIG
CCSA_PORYE      --------LTIGIIAGAVWA--NEAWGSYWSWDPKETWALITWLIFAAYLHSRITKSWQGKKPAILASLG
CCSA_PHAAO      -----FTFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHTRQVTNSAFVASIGFLLIW
CCSA_GUITH      --------LTIGIIAGAVWA--NEAWGTYWSWDPKETWALITWLVFAAYLHARITKSWTGERPAYLAALG
CCSA_GOSHI      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTVFAIYFHTRTNTNLEGVNSALVLIIW
CCSA_GOSBA      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTVFAIYFHTRTNTNLEGVNSALVLIIW
CCSA_CRUWA      -----FIFLTVGILSGAVWANET--WGSYWNWDPKETWAFITWTIFAIYLHIKTNRNVRGINSAIVLLIW
CCSA_SYNY3      --------LTIGIIAGAVWA--NEAWGSYWSWDPKETWALITWLVFAAYLHA-RITKGWQGRKPAILAAS
CCSA_ORYSJ      -----FTLLTIGILCGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHSRTNPNWKGTKSAFVLIIW
CCSA_ORYSI      -----FTLLTIGILCGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHSRTNPNWKGTKSAFVLIIW
CCSA_ORYSA      -----FTLLTIGILCGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHSRTNPNWKGTKSAFVLIIW
CCSA_ORYNI      -----FTLLTIGILCGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHSRTNPNWKGTKSAFVLIIW
CCSA_OENPA      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTMFAIYLHTRTNPNFQSVNSAIVAFLG
CCSA_OENGL      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTMFAIYLHTRTNPNFQSVNSAIVAFLG
CCSA_OENEH      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTMFAIYLHTRTNPNFQSVNSAIVAFLG
CCSA_OENBI      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTMFAIYLHTRTNPNFQSVNSAIVAFLG
CCSA_OENAR      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTMFAIYLHTRTNPNFQSVNSAIVAFLG
CCSA_ARAHI      -----FIFLTVGILSGAVWANET--WGSYWNWDPKETWAFITWTIFAIFLHIKTNRNVRGINSAIVLLIW
CCSA_OLIPU      -----FIFLTVGILSGAVWANET--WGSYWNWDPKETWAFITWTIFAIYLHIKTNRNVRGINSAIVLLIW
CCSA_NANDO      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHNLQGINSAIVASIGFLIIW
CCSA_MORIN      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTLFSIYLH----TRTNKNFESVNLIIW
CCSA_FAGEA      -----FLFLTMGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHNINLKSENSAIVAGFLIIW
CCSA_CYAP7      --------LTIGIIAGAVWA--NEAWGSYWSWDPKETWALITWLVFAAYLHA-RITKGWQGRKPAILAAS
CCSA_CYAA5      --------LTIGIIAGAVWA--NEAWGSYWSWDPKETWALITWLVFAAYLHA-RITKGWQGRKPAILAAS
CCSA_CITSI      -----FIFLTTGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFGIYLHTRTNTKWEGVNSAIVLIIW
CCSA_BUXMI      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHTRTNKNFQGADSAIVIIIW
CCSA_BARVE      -----FIFLTVGILSGAVWANET--WGSYWNWDPKETWAFITWTIFAIYLHIKTNRNVRGINSAIVLLIW
CCSA_ARATH      -----FIFLTVGILSGAVWANET--WGSYWNWDPKETWAFITWTIFAIYLHIKTNRNVRGINSAIVALIG
CCSA_TRIEI      --------LTIGIIAGAVWA--NEAWGSYWSWDPKETWALITWLVFAAYLHA-RITKGWQGRK--PAILA
CCSA_NASOF      -----FIFLTVGILSGAVWANET--WGSYWNWDPKETWAFITWTIFAIYLHIKTNRNVRSINSAIVILIW
CCSA_MICAN      --------LTIGIIAGAVWA--NEAWGSYWSWDPKETWALITWLVFAAYLHA-RITRGWQGRKPAILAAS
CCSA_LOLPR      ---LGFTLLTIGILCGAVWA--NDAWGSYWNWDPKETWAFITWTIFAIYLHSRTNLNWKGTNSALVLIIW
CCSA_LOBMA      -----FIFLTIGILSGAVWANET--WGSYWNWDPKETWAFITWTIFAIYLH-IKTNRNVKGINSGFLLIW
CCSA_LIRTU      -----FTFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHSLQGVNSAIVASMGFLIIW
CCSA_HORVU      ---LGFTLLTIGILCGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHSRTNPNWKGTNSALILIIW
CCSA_CYAP8      --------LTIGIIAGAVWA--NEAWGSYWSWDPKETWALITWLVFAAYLHA-RITRGWQGRKPAILAAS
CCSA_CARPA      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHNLGGINSAIVASMGFLIIW
CCSA_BRADI      ---LGFTLLTIGILCGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHSRTNQNWKGTNSALVLIIW
CCSA_AGRST      ---LGFTLLTIGILCGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHSRTNQNWKGTNSALVLIIW
CCSA_SYNP2      --------LTIGIIAGAVWA--NEAWGSYWSWDPKETWALITWLVFAAYLHARITRGWQGRQPAFLAAAG
CCSA_SORBI      ---LGFTLLTVGILCGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHSRTNPNWKGTNSALVLIIW
CCSA_SACOF      ---LGFTLLTVGILCGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHSRTNPNWKGTNSALVLIIW
CCSA_SACHY      ---LGFTLLTVGILCGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHSRTNPNWKGTNSALVLIIW
CCSA_ODOSI      -------FLTIGIIAGGVWA--NEAWGSYWSWDPKETWALITWIVFATYLHS-RITKGWEGKKTAILGLG
CCSA_LEPVR      -----FIFLTVGILSGAVWANET--WGSYWNWDPKETWAFITWTIFAIYLHIKTNRNVRGINSAIVLLIW
CCSA_CHLRE      -------FLTIGILSGAVWA--NEAWGSYWSWDPKETWALLTWLVFAIYLHTRLTKGWEGEKPAIIAAVG
CCSA_CAPBU      -----FIFLTVGILSGAVWANET--WGSYWNWDPKETWAFITWTIFAIYLHNRNVRDINSAIVAGFLLIW
CCSA_SYNS3      ---VGFLLLTVGIISGAVWA--NEAWGSYWSWDPKETWALICWLVYAAYLHTRLSRGWQGRRPALVASAG
CCSA_SYNP6      --------LTIGIIAGAVWA--NEAWGSYWSWDPKETWALITWLVFAAYLHARITRGWQGRRPAILATVG
CCSA_SYNE7      --------LTIGIIAGAVWA--NEAWGSYWSWDPKETWALITWLVFAAYLHARITRGWQGRRPAILATVG
CCSA_PIPCE      -----FTLLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFATYLHTR--TNQRIGF----LIIW
CCSA_NOSP7      --------LTIGIIAGGVWA--NEAWGSYWSWDPKETWALITWLVFAAYLHARITRGWQGRRPAILAATG
CCSA_MAIZE      ---LGFTLLTVGILCGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHSRKNPNWKGTNSALVLIIW
CCSA_HETA4      -------FLTMGIISGAVWA--NEAWGSYWSWDPKETWALITWLIFASYLHARLTKGWRGKRAAFLGSFG
CCSA_HETA2      -------FLTMGIISGAVWA--NEAWGSYWSWDPKETWALITWLIFASYLHARLTKGWRGKRAAFLGSFG
CCSA_ANAVT      --------LTIGIIAGAVWA--NEAWGSYWSWDPKETWALITWLVFAAYLHARITRGWQGRRPAILAASG
CCSA_ANASP      --------LTIGIIAGAVWA--NEAWGSYWSWDPKETWALITWLVFAAYLHARITRGWQGRRPAILAASG
CCSA_AETGR      -----FLFLTIGILSGAVWANET--WGSYWNWDPKETWAFITWTIFAIYLHIKTKQNGRGINSAIVLVIW
CCSA_AETCO      -----FLFLTMGILSGAVWANET--WGSYWNWDPKETWAFITWTIFAIYLHIKTKKNGRGINSAIVLVIW
CCSA_RANMC      -----FLFLTIGILSGAVWANET--WGSYWNWDPKETWAFITWTIFAIYLHSLQSSNSAIVASIGFFIIW
CCSA_EUCGG      -----FLFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTLFAIYLH----TRTNKNWESFNLIIW
CCSA_DRIGR      -----FIFSTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHSLQGVNSSIVASIGFLIIW
CCSA_SOYBN      -----FIFLTIGIISGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHT------------------
CCSA_PORPU      --------LTIGIVAGAVWA--NEAWGSYWSWDPKETWALITWLIFAAYLHCRITKSWQGKRPAILASVG
CCSA_SYNJB      --------LTIGIIAGAVWA--NEAWGTYWSWDPKETWALITWLVFAAYLHARITKGWQGRRPALLASLG
CCSA_SYNJA      --------LTIGIIAGAVWA--NEAWGTYWSWDPKETWALITWLVFAAYLHARITKGWQGKRPALLASLG
CCSA_DRANE      -----FIFLTVGILSESVWANET--WGSYWNWDPKETWAFITWTIFAIYLHIKTNRNVRGGF----LLIW
CCSA_DIOEL      -----FIFLTMGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYSHNFQGTNPALVASIGFLIIW
CCSA_THEEB      --------LTIGIISGAVWA--NEAWGAPWSWDPKETWALIVWLVYAAYLHARMTRDWQGRKPAILATVG
CCSA_SYNSC      ---VGFLMLTVGIVSGAVWA--NEAWGSYWSWDPKETWALICWLVYAAYLHT------------------
CCSA_PHAVU      -----FIFLTVGNISGAVWA--NEAWGSYWNWDPKETWAFITWIIFAIYLHKLEYLNSSIVASMGFLIIW
CCSA_MARPO      --------LTIGILSGAVWA--NEAWGSYWNWDPKETWALITWLIFAIYLHTRMIKGWQGKKPAIIASLG
CCSA_CYACA      -----FISLTLGIISGSVWA--NEAWGNYWSWDPKETWALITWLVFATYLH-------------------
CCSA_CHLSC      -----FTFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYSHSLQGANSAIVASMGFLIIW
CCSA_POPTR      -----FLFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYFHNLEGLNSAIVASIGFLIIW
CCSA_POPAL      -----FLFLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYFHNLEGLNSAIVASIGFLIIW
CCSA_LEMMI      -------FLTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIYAIYSHTRTTKNGQGANSAIVFIIW
CCSA_CUCSA      -----FIFLSIGILSGAVWANET--WGSYWNWDPKETWAFITWTIFAIYLH----TRTNKNFEGVNLIIW
CCSA_CALFG      -----FTFSTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTIFAIYLHTR--TNQRMGF----LIIW
CCSA_SYNPX      -----FLMLTVGIVSGAVWA--NEAWGSYWSWDPKETWALICWLVYAAYLHT------------------
CCSA_MESVI      --------LTIGIISGAVWA--NDAWGSYWSWDPKETWALITWIIFAIYLHTRITKGWQGRRPAIVAFIG
CCSA_ACAM1      --------LTVGIIAGAVWA--NEAWGAPWSWDPKETWALITWLVFAAYLHARITRGWQGRRPAYLATGG
CCSA_SYNS9      -----FLMLTVGIISGAVWA--NEAWGSYWSWDPKETWALICWLVYAAYLHT------------------
CCSA_GALSU      -------FLTIGIISGAVWA--NEAWGSYWSWDPKETWALITWIIFAIYLHTRINKSWQGKKSAIVAGFG
CCSA_ILLOL      -----FTFSTIGILSGAVWA--NEAWGSYWNWDPKETWAFITWTISAIYSHSLQGMNSAIVASMGFLIIW
CCSA_GLOVI      --------ITVGIIAGAVWA--NEAWGSYWSWDPKETWSLITWFIFAAYLHA------------------
CCSA_ANTFO      ------LFLTIGILSGAVWV--NEAWGSYWSWDPKETWALITWLLSAIHIH-------------------
CCSA_ADICA      --------LTIGILSGAVWA--NEAWGSYWSWDPKETWALVTWLVYAIYLHT------------------
CCSA_WELMI      -----FTFLTIGILSGAVWA--NEAWGSYWSWDPKEIWALITWLIFANYIH-------------------
CCSA_PROMA      ---------------GAVWA--NEAWGSWWSWDPKETWAFISWLIYAAYLHT------------------
CCSA_ACOCL      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKEXXXXXXXXXXXXYLHSLQGANSAIVASIGFLIIW
CCSA_ACOAM      -----FIFLTIGILSGAVWA--NEAWGSYWNWDPKEXXXXXXXXXXXXYLHSLQGANSAIVASIGFLIIW
CCSA_PROM4      -------------------------WGSWWSWDPKETWALISWLVYAAYLHA-RITRGWQGRKPGFLIIV
CCSA_CUSEX      -------------------------WGSYWSWDPKETWAFITWIVFAIYLHSLQGTNSAIVASIGFLIIW
CCF1_ARATH      ----------------------------------------------------------------------
BCHG_RHOCA      WQLGSWGFVATLLGVAAAWAYIRLKRSGWWGPGLVGLAEGLPWITGAAVL--LATADTSPGF--------
CCSA_AMBTC      -------------------------WGSYWNWDPKETWAFITWTISAIYLHTRTNKNLQSANSAIVLIIW
CCSA_WHEAT      -------------------------WGAYWNWDPKETWAFITWTIFAIYLHSRTHPNWKGTNSALILIIW
CCSA_PINTH      ---------TIGTLSGAIWA--NEAWGSYWSWDPKETWALITWTIFAIYLHT------------------
CCSA_NYMAL      -------------------------WGSYWNWDPKETWAFITWTVFAIYLHSLQGANSAIVASMGFLIIW
RESC_BACSU      ---------TLGLIFAMIWA--QLAWTRFWGWDPKEVWALITFLFYAAYLHLRLSRGWHGEKSAW---LA


                         .         *         .         .         .         .         +:350
query           ICAFSLCLLGTFLVRSGVLVSVHAFASDPARGMFILAFMVLVTGGSLLLFAVRGHRVRSRVNNALWSRES
CCMF_ECOLI      ISAFSLCLLGTFLVRSGVLVSVHAFASDPARGMFILAFMVLVIGGSLLLFAARGHKVRSRVNNALWSRES
CCMF_HAEIN      XXXXXXXXXGTFLVRSGILVSVHAFASDPTRGLYILAYLVVVIGGSLALYAYKGSQIRSRDNAERYSRES
CCMF_PSEAE      XXXXXXXXXGTFLVRSGVLTSVHAFASDPERGVFILAFLLLVVGGSLTLFALRAPVVKSQVGFALWSRET
CCMF_PSEFL      XXXXXXXXXXXXXVRSGVLTSVHAFASDPERGVFILIFLLFVVGGSLTLF-VRAPVVKSQVGFNLWSRET
CCMF_RHIME      IMTFSLSLLGTFLVRSGVLTSVHAFATDPTRGVFILAILVVFIGGAFSLFAFRASHLKAGGIFAPVSREG
CCMF_RHOCA      IMAFGFSLIGTFLVRSGVISSVHSFANDPERGVFILFILAFFTGGALTLYAARASEMQAKGLFSMVSRES
NRFE_HAEIN      XXXXXXXVLGTFIVRSGALTSVHAFALDNTRGVLLLIXXXXXXXXXXXXXXXXGSSSESAVKFQFISKSG
CCMF_BRAJA      XXXXXXXXXXXXXVRSGVITSVHAFATDPTRGVXXXXXXXXXXXXXXXXXAGRATSLKQGGLFAPISREG
NRFE_ECOLI      IVTLMLSLLGTLIVRSGILVSVHAFALDNVRAVPXXXXXXXXXXXXXXXYGWRARDGGPAVHFSGLSREM
CCF2_ARATH      IVTFLCCVLGTFSIRSGLLASVHSFATDDTRGIFLWWFFLLMTGIFMILF--------------------
CCBS_OENBE      IVTFLCCVLGTFSIRSGLLASVHSFATDDTRGIFLWRFFLLMTGISMILFS-------------------
CCBS_MARPO      MVTFLCCILGTFFVRSGLLASVHSFATDSTRGIFL-----------------------------------
CCBS_DAUCA      IVTLPCCVSGTSSIRSGLLAPVHSFATDDTRGIFLWRFFLLMTGISMILFS-------------------
CCSA_SYNR3      LFVISVCYIGVNLLGIGL----------------------------------------------------
CCSA_PROMM      ----------------------------------------------------------------------
CCSA_PROM3      ----------------------------------------------------------------------
CCSA_CUSRE      FIIIWICYFGVNLVGLG----LHSYGSFPS----------------------------------------
CCSA_TOBAC      ICYFGVNLLG---------IGLHSYGSFPS----------------------------------------
CCSA_NICTO      ICYFGVNLLG---------IGLHSYGSFPS----------------------------------------
CCSA_NICSY      ICYFGVNLLG---------IGLHSYGSFPS----------------------------------------
CCSA_PANGI      ICYFGVNLLG------------------------------------------------------------
CCSA_DAUCA      ICYFGVNLLG------------------------------------------------------------
CCSA_SOLTU      ICYFGVNLLG---------IGLHSYGSFPS----------------------------------------
CCSA_SOLLC      ICYFGVNLLG---------IGLHSYGSFPS----------------------------------------
CCSA_SOLBU      ICYFGVNLLG---------IGLHSYGSFPS----------------------------------------
CCSA_PROMS      ----------------------------------------------------------------------
CCSA_PROMP      ----------------------------------------------------------------------
CCSA_PROM5      ----------------------------------------------------------------------
CCSA_COFAR      ICYFGVNLLG------------------------------------------------------------
CCSA_SYNPW      LVVIVVCYIGVNLLGIGL----------------------------------------------------
CCSA_PROM9      ----------------------------------------------------------------------
CCSA_PROM2      ICYLGVNFLG------------------------------------------------------------
CCSA_PROM0      ----------------------------------------------------------------------
CCSA_GUIAB      FLIIWICYFGVNLLGIG----LHSYGS-------------------------------------------
CCSA_CHLVU      FLVVWVCYLGVNLLGQGL----------------------------------------------------
CCSA_HELAN      FLIIWICYFGVNLLGIG----LHSYGS-------------------------------------------
CCSA_ATRBE      ICYFGVNLLGIGLHSYGSFTS-------------------------------------------------
CCSA_PROMT      FFVIIVCYIGVNLLGVGL----------------------------------------------------
CCSA_PROM1      FFVIIVCYIGVNLLGVGL----------------------------------------------------
CCSA_CERDE      ICYFGVNLLGIGLHSYGSFIS-------------------------------------------------
CCSA_VITVI      ICYFGVNLLG------------------------------------------------------------
CCSA_PLAOC      ICYFGVNLLG------------------------------------------------------------
CCSA_LOTJA      ICYFGVNLLGIGLHNYGSFTS-------------------------------------------------
CCSA_LACSA      FLIIWICYFGVNLLGIG----LHSYGS-------------------------------------------
CCSA_JASNU      ICYFGVNLLG------------------------------------------------------------
CCSA_SPIOL      ICYFGVNLLG------------------------------------------------------------
CCSA_PELHO      ICYFGINILG---------IGLHSYGSFP-----------------------------------------
CCSA_MANES      ICYFGVNLLG------------------------------------------------------------
CCSA_IPOPU      ICYFGVNLVG---------IGLHSYGSFPS----------------------------------------
CCSA_CYAPA      FFIIWICYLGVNLLGKGI----------------------------------------------------
CCSA_TRACE      FLIIWICYFGVNLLGIG----LHSYGS-------------------------------------------
CCSA_PORYE      FLVVWICYLGVNFLGKGL----------------------------------------------------
CCSA_PHAAO      ICYFGINLLG------------------------------------------------------------
CCSA_GUITH      FVVVWICYLGVNFLGKGL----------------------------------------------------
CCSA_GOSHI      ICYFGVNLLG------------------------------------------------------------
CCSA_GOSBA      ICYFGVNLLG------------------------------------------------------------
CCSA_CRUWA      ICYFGVILLGIGLHSYGSFTS-------------------------------------------------
CCSA_SYNY3      FTVVWICYLGVNLLGKGL----------------------------------------------------
CCSA_ORYSJ      ICYFGINLLG------------------------------------------------------------
CCSA_ORYSI      ICYFGINLLG------------------------------------------------------------
CCSA_ORYSA      ICYFGINLLG------------------------------------------------------------
CCSA_ORYNI      ICYFGINLLG------------------------------------------------------------
CCSA_OENPA      FIIIWICYFGVNLLGIG----LHSYGS-------------------------------------------
CCSA_OENGL      FIIIWICYFGVNLLGIG----LHSYGS-------------------------------------------
CCSA_OENEH      FIIIWICYFGVNLLGIG----LHSYGS-------------------------------------------
CCSA_OENBI      FIIIWICYFGVNLLGIG----LHSYGS-------------------------------------------
CCSA_OENAR      FIIIWICYFGVNLLGIG----LHSYGS-------------------------------------------
CCSA_ARAHI      ICYFGVNLLGIGLHSYGSFTS-------------------------------------------------
CCSA_OLIPU      ICYFGVNLLGIGLHSYGSFTS-------------------------------------------------
CCSA_NANDO      ICYFGVNLLGIGLHSYGSFTS-------------------------------------------------
CCSA_MORIN      ICYFGVNLLG------------------------------------------------------------
CCSA_FAGEA      ICYFGVNLLGIGLHSYGSFI--------------------------------------------------
CCSA_CYAP7      FVVVWVCYLGVNLLGKGL----------------------------------------------------
CCSA_CYAA5      FVVVWVCYLGVNLLGKGL----------------------------------------------------
CCSA_CITSI      ICYFGVNLLG------------------------------------------------------------
CCSA_BUXMI      ICYFGVNLLGIGLHSYGSFI--------------------------------------------------
CCSA_BARVE      ICYFGVNLLGIGLHSYGSFTS-------------------------------------------------
CCSA_ARATH      FILIWICYFGVNLLGIG----LHSYGS-------------------------------------------
CCSA_TRIEI      ATGFAVCYLGVNLLGKGL----------------------------------------------------
CCSA_NASOF      ICYFGVNLLGIGLHSYGSFTS-------------------------------------------------
CCSA_MICAN      FVVVWVCYLGVNLLGKGL----------------------------------------------------
CCSA_LOLPR      ICYFGINLLGIGLHSYGSFI--------------------------------------------------
CCSA_LOBMA      ICYFGVNLLGIGLHSYGSFTS-------------------------------------------------
CCSA_LIRTU      ICYFGVNLLG------------------------------------------------------------
CCSA_HORVU      ICYFGINLLG------------------------------------------------------------
CCSA_CYAP8      FIVVWVCYLGVNLLGKGL----------------------------------------------------
CCSA_CARPA      ICYFGVNLLG------------------------------------------------------------
CCSA_BRADI      ICYFGINLLG------------------------------------------------------------
CCSA_AGRST      ICYFGINLLG------------------------------------------------------------
CCSA_SYNP2      FFVVWVCYLGVNILGKGL----------------------------------------------------
CCSA_SORBI      ICYFGINLLG------------------------------------------------------------
CCSA_SACOF      ICYFGINLLG------------------------------------------------------------
CCSA_SACHY      ICYFGINLLG------------------------------------------------------------
CCSA_ODOSI      FFVIWICYLGVNFLGKGL----------------------------------------------------
CCSA_LEPVR      ICYFGVNLLG------------------------------------------------------------
CCSA_CHLRE      FLVVWFCYLGVNLIGEGL----------------------------------------------------
CCSA_CAPBU      ICYFGVNLLGIGLHSYGSFTS-------------------------------------------------
CCSA_SYNS3      LVVIGVCYIGVNLLGIGL----------------------------------------------------
CCSA_SYNP6      FGVVWVCYLGVNLLGKGL----------------------------------------------------
CCSA_SYNE7      FGVVWVCYLGVNLLGKGL----------------------------------------------------
CCSA_PIPCE      ICYFGVNLLGIGLHSYGAFTS-------------------------------------------------
CCSA_NOSP7      FVVVWICYLGVNLLGKGL----------------------------------------------------
CCSA_MAIZE      ICYFGINLLG------------------------------------------------------------
CCSA_HETA4      FFIVWVCYLGVNFLGKGL----------------------------------------------------
CCSA_HETA2      FFIVWVCYLGVNFLGKGL----------------------------------------------------
CCSA_ANAVT      FVVVWICYLGVNLLGKGL----------------------------------------------------
CCSA_ANASP      FVVVWICYLGVNLLGKGL----------------------------------------------------
CCSA_AETGR      ICYFGVNLLGIGLHSYGSFTS-------------------------------------------------
CCSA_AETCO      ICYFGVNLLGIGLHSYGSFTS-------------------------------------------------
CCSA_RANMC      ICYFGVNLLG------------------------------------------------------------
CCSA_EUCGG      ICYFGVNLLG------------------------------------------------------------
CCSA_DRIGR      ICYFGVNLLG------------------------------------------------------------
CCSA_SOYBN      ----------------------------------------------------------------------
CCSA_PORPU      FLVVWICYLGVNFLGKGL----------------------------------------------------
CCSA_SYNJB      FGVVWVCYLGVNFLGKGL----------------------------------------------------
CCSA_SYNJA      FGVVWVCYLGVNFLGKGL----------------------------------------------------
CCSA_DRANE      ICYFGVNLLGIGLHSYGSFTS-------------------------------------------------
CCSA_DIOEL      ICYFGINLLG------------------------------------------------------------
CCSA_THEEB      FGVVWVCYLGVNLLGKGL----------------------------------------------------
CCSA_SYNSC      ----------------------------------------------------------------------
CCSA_PHAVU      ICYLGINLLGIGLHSYGSFTS-------------------------------------------------
CCSA_MARPO      FFIVWICYLGVNLLGKGL----------------------------------------------------
CCSA_CYACA      ----------------------------------------------------------------------
CCSA_CHLSC      ICYFGVNLLG------------------------------------------------------------
CCSA_POPTR      ICYFGVNLLG------------------------------------------------------------
CCSA_POPAL      ICYFGVNLLG------------------------------------------------------------
CCSA_LEMMI      ICYFGVNLLGIGLHSYGSFI--------------------------------------------------
CCSA_CUCSA      ICYFGVNLLG------------------------------------------------------------
CCSA_CALFG      ICYFGVNLLG------------------------------------------------------------
CCSA_SYNPX      ----------------------------------------------------------------------
CCSA_MESVI      FVIVWVCYLGVNLLGQGL----------------------------------------------------
CCSA_ACAM1      FFVVWVCYLGVNLLGKGL----------------------------------------------------
CCSA_SYNS9      ----------------------------------------------------------------------
CCSA_GALSU      FVVVWICYLGVNFLGKGL----------------------------------------------------
CCSA_ILLOL      ICYFGVNLLG------------------------------------------------------------
CCSA_GLOVI      ----------------------------------------------------------------------
CCSA_ANTFO      ----------------------------------------------------------------------
CCSA_ADICA      ----------------------------------------------------------------------
CCSA_WELMI      ----------------------------------------------------------------------
CCSA_PROMA      ----------------------------------------------------------------------
CCSA_ACOCL      ICYFGVNLLG------------------------------------------------------------
CCSA_ACOAM      ICYFGVNLLG------------------------------------------------------------
CCSA_PROM4      ICYIGVNLLGVGLHSYGWFLS-------------------------------------------------
CCSA_CUSEX      ICYFGVNLVG---------LGLHSYGSFPS----------------------------------------
CCF1_ARATH      ----------------------------------------------------------------------
BCHG_RHOCA      ----------------------------------------------------------------------
CCSA_AMBTC      ICYFGVNLLG------------------------------------------------------------
CCSA_WHEAT      ICYFGINLLG------------------------------------------------------------
CCSA_PINTH      ----------------------------------------------------------------------
CCSA_NYMAL      ICYFGVNLLG------------------------------------------------------------
RESC_BACSU      VIGFAIIMFNLIFVNL-VLAGLHSYA--------------------------------------------


                         .         .         .         .         *         .         .:420
query           LLLGNNXXXXXXXXXXXXXXXXXXXHKQLGLGSISVGEPFFNTMFTWLMVPFALLLGVGPLVRWGRDRPR
CCMF_ECOLI      XXXXXXXXXXXXXXXXXXXXXXXXXHKQLGLGSISIGEPFFNTMFTWLMVPFALLLGVGPLVRWGRDRPR
CCMF_HAEIN      XXXXXXXXXXTALCVVFLGTLLPLVHKQLGLGSISIGAPFFDQMFLIIMTPFALLLGIGPLVKWRRDQFS
CCMF_PSEAE      XXXXXXXXXXXAASMILLGTLYPLLLDALSGAKLSVGPPYFNXXXXXXXXXXXXXXXXXXXXRWKDTPSR
CCMF_PSEFL      XXXXXXXXXXXAASMILLGTLYPLVLDALSGAKLSVGPPYFNALFIPXXXXXXXXXXXXXXXRW-KDTPV
CCMF_RHIME      ALVVNNXXXXXXXXXXXXXXXYPLVLEALTGDKISVGAPFFNMTFGLLMLPLIAVVPFGPLLAWKRDXXX
CCMF_RHOCA      XXXXXXXXXXXXXXXXFTGTVWPLIAELFWDRKLSVGAPFFEKAFTPFMVGLALLLPLGSMMPWKR----
NRFE_HAEIN      GXXXXXXXXXXATVSTFLGTFYPMLFQAMNWGSISVGSPYFNSIFFPIITAILILMVIVLSIRKGQDRTL
CCMF_BRAJA      XXXXXXXXXXXXXXXXXFGTLYPLAMEMLADFKMSVGAPFYNXXXXXXXXXXXXXXXXXXMLAWKRDLLG
NRFE_ECOLI      XXXXXXXXXXXXXXXXXXGTLYPMIYGLLGWGRLSVGAPYFNR----ATLPFGLLM--------------
CCF2_ARATH      ----------------------------------------------------------------------
CCBS_OENBE      ----------------------------------------------------------------------
CCBS_MARPO      ----------------------------------------------------------------------
CCBS_DAUCA      ----------------------------------------------------------------------
CCSA_SYNR3      ----------------------------------------------------------------------
CCSA_PROMM      ----------------------------------------------------------------------
CCSA_PROM3      ----------------------------------------------------------------------
CCSA_CUSRE      ----------------------------------------------------------------------
CCSA_TOBAC      ----------------------------------------------------------------------
CCSA_NICTO      ----------------------------------------------------------------------
CCSA_NICSY      ----------------------------------------------------------------------
CCSA_PANGI      ----------------------------------------------------------------------
CCSA_DAUCA      ----------------------------------------------------------------------
CCSA_SOLTU      ----------------------------------------------------------------------
CCSA_SOLLC      ----------------------------------------------------------------------
CCSA_SOLBU      ----------------------------------------------------------------------
CCSA_PROMS      ----------------------------------------------------------------------
CCSA_PROMP      ----------------------------------------------------------------------
CCSA_PROM5      ----------------------------------------------------------------------
CCSA_COFAR      ----------------------------------------------------------------------
CCSA_SYNPW      ----------------------------------------------------------------------
CCSA_PROM9      ----------------------------------------------------------------------
CCSA_PROM2      ----------------------------------------------------------------------
CCSA_PROM0      ----------------------------------------------------------------------
CCSA_GUIAB      ----------------------------------------------------------------------
CCSA_CHLVU      ----------------------------------------------------------------------
CCSA_HELAN      ----------------------------------------------------------------------
CCSA_ATRBE      ----------------------------------------------------------------------
CCSA_PROMT      ----------------------------------------------------------------------
CCSA_PROM1      ----------------------------------------------------------------------
CCSA_CERDE      ----------------------------------------------------------------------
CCSA_VITVI      ----------------------------------------------------------------------
CCSA_PLAOC      ----------------------------------------------------------------------
CCSA_LOTJA      ----------------------------------------------------------------------
CCSA_LACSA      ----------------------------------------------------------------------
CCSA_JASNU      ----------------------------------------------------------------------
CCSA_SPIOL      ----------------------------------------------------------------------
CCSA_PELHO      ----------------------------------------------------------------------
CCSA_MANES      ----------------------------------------------------------------------
CCSA_IPOPU      ----------------------------------------------------------------------
CCSA_CYAPA      ----------------------------------------------------------------------
CCSA_TRACE      ----------------------------------------------------------------------
CCSA_PORYE      ----------------------------------------------------------------------
CCSA_PHAAO      ----------------------------------------------------------------------
CCSA_GUITH      ----------------------------------------------------------------------
CCSA_GOSHI      ----------------------------------------------------------------------
CCSA_GOSBA      ----------------------------------------------------------------------
CCSA_CRUWA      ----------------------------------------------------------------------
CCSA_SYNY3      ----------------------------------------------------------------------
CCSA_ORYSJ      ----------------------------------------------------------------------
CCSA_ORYSI      ----------------------------------------------------------------------
CCSA_ORYSA      ----------------------------------------------------------------------
CCSA_ORYNI      ----------------------------------------------------------------------
CCSA_OENPA      ----------------------------------------------------------------------
CCSA_OENGL      ----------------------------------------------------------------------
CCSA_OENEH      ----------------------------------------------------------------------
CCSA_OENBI      ----------------------------------------------------------------------
CCSA_OENAR      ----------------------------------------------------------------------
CCSA_ARAHI      ----------------------------------------------------------------------
CCSA_OLIPU      ----------------------------------------------------------------------
CCSA_NANDO      ----------------------------------------------------------------------
CCSA_MORIN      ----------------------------------------------------------------------
CCSA_FAGEA      ----------------------------------------------------------------------
CCSA_CYAP7      ----------------------------------------------------------------------
CCSA_CYAA5      ----------------------------------------------------------------------
CCSA_CITSI      ----------------------------------------------------------------------
CCSA_BUXMI      ----------------------------------------------------------------------
CCSA_BARVE      ----------------------------------------------------------------------
CCSA_ARATH      ----------------------------------------------------------------------
CCSA_TRIEI      ----------------------------------------------------------------------
CCSA_NASOF      ----------------------------------------------------------------------
CCSA_MICAN      ----------------------------------------------------------------------
CCSA_LOLPR      ----------------------------------------------------------------------
CCSA_LOBMA      ----------------------------------------------------------------------
CCSA_LIRTU      ----------------------------------------------------------------------
CCSA_HORVU      ----------------------------------------------------------------------
CCSA_CYAP8      ----------------------------------------------------------------------
CCSA_CARPA      ----------------------------------------------------------------------
CCSA_BRADI      ----------------------------------------------------------------------
CCSA_AGRST      ----------------------------------------------------------------------
CCSA_SYNP2      ----------------------------------------------------------------------
CCSA_SORBI      ----------------------------------------------------------------------
CCSA_SACOF      ----------------------------------------------------------------------
CCSA_SACHY      ----------------------------------------------------------------------
CCSA_ODOSI      ----------------------------------------------------------------------
CCSA_LEPVR      ----------------------------------------------------------------------
CCSA_CHLRE      ----------------------------------------------------------------------
CCSA_CAPBU      ----------------------------------------------------------------------
CCSA_SYNS3      ----------------------------------------------------------------------
CCSA_SYNP6      ----------------------------------------------------------------------
CCSA_SYNE7      ----------------------------------------------------------------------
CCSA_PIPCE      ----------------------------------------------------------------------
CCSA_NOSP7      ----------------------------------------------------------------------
CCSA_MAIZE      ----------------------------------------------------------------------
CCSA_HETA4      ----------------------------------------------------------------------
CCSA_HETA2      ----------------------------------------------------------------------
CCSA_ANAVT      ----------------------------------------------------------------------
CCSA_ANASP      ----------------------------------------------------------------------
CCSA_AETGR      ----------------------------------------------------------------------
CCSA_AETCO      ----------------------------------------------------------------------
CCSA_RANMC      ----------------------------------------------------------------------
CCSA_EUCGG      ----------------------------------------------------------------------
CCSA_DRIGR      ----------------------------------------------------------------------
CCSA_SOYBN      ----------------------------------------------------------------------
CCSA_PORPU      ----------------------------------------------------------------------
CCSA_SYNJB      ----------------------------------------------------------------------
CCSA_SYNJA      ----------------------------------------------------------------------
CCSA_DRANE      ----------------------------------------------------------------------
CCSA_DIOEL      ----------------------------------------------------------------------
CCSA_THEEB      ----------------------------------------------------------------------
CCSA_SYNSC      ----------------------------------------------------------------------
CCSA_PHAVU      ----------------------------------------------------------------------
CCSA_MARPO      ----------------------------------------------------------------------
CCSA_CYACA      ----------------------------------------------------------------------
CCSA_CHLSC      ----------------------------------------------------------------------
CCSA_POPTR      ----------------------------------------------------------------------
CCSA_POPAL      ----------------------------------------------------------------------
CCSA_LEMMI      ----------------------------------------------------------------------
CCSA_CUCSA      ----------------------------------------------------------------------
CCSA_CALFG      ----------------------------------------------------------------------
CCSA_SYNPX      ----------------------------------------------------------------------
CCSA_MESVI      ----------------------------------------------------------------------
CCSA_ACAM1      ----------------------------------------------------------------------
CCSA_SYNS9      ----------------------------------------------------------------------
CCSA_GALSU      ----------------------------------------------------------------------
CCSA_ILLOL      ----------------------------------------------------------------------
CCSA_GLOVI      ----------------------------------------------------------------------
CCSA_ANTFO      ----------------------------------------------------------------------
CCSA_ADICA      ----------------------------------------------------------------------
CCSA_WELMI      ----------------------------------------------------------------------
CCSA_PROMA      ----------------------------------------------------------------------
CCSA_ACOCL      ----------------------------------------------------------------------
CCSA_ACOAM      ----------------------------------------------------------------------
CCSA_PROM4      ----------------------------------------------------------------------
CCSA_CUSEX      ----------------------------------------------------------------------
CCF1_ARATH      ----------------------------------------------------------------------
BCHG_RHOCA      ----------------------------------------------------------------------
CCSA_AMBTC      ----------------------------------------------------------------------
CCSA_WHEAT      ----------------------------------------------------------------------
CCSA_PINTH      ----------------------------------------------------------------------
CCSA_NYMAL      ----------------------------------------------------------------------
RESC_BACSU      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           NIRXXXXXXXXXXXXXXXXXXXXXEDKIIAMTAVGMAMACWIAVLAVAEAVQRVSRGTKTSLSYWGMVAA
CCMF_ECOLI      KIRNLLIIAFISTXXXXXXXXXXFESKVVAMTVLGLAMACWIAVLAIAEAALRISRGTKTTFSYWGMVAA
CCMF_HAEIN      AIRTPVVICVFVMLIAGFALPYFLQDKITVSSVLGSMMTVIIALLALYELQQRATHRRKLSRSHWGMMLA
CCMF_PSEAE      WLLGMLTPXXXXXXXXXXXGSMYFGDFNWAVLAV-FLLSAWVVLAGFRDFLDKVLAGARSTRSYWGMQLA
CCMF_PSEFL      KWLVGMXXXXXXXXXXXXXXXGIAYGDFNWAVLATFLLAAWVLLAGVRDIFDKLLKGLPTTRSYWGMQIA
CCMF_RHIME      XXXXXXXXXXXXXXXXXICYYAVNGGPVLA--PFGLGLGVYLILGALTDLVLRSGLGKVAAGVAWGTXXX
CCMF_RHOCA      ----------------------------------------------------------------WGKAFA
NRFE_HAEIN      LIRCGWLLIPSLILAGLMIWQQLRNNSALAFAFVLLTLAIWLLFVTLWQNWRQI------RLSQFGMILA
CCMF_BRAJA      VTQRXXXXXXXXXXXXXXXXXXTRGGSALAPLAIGLGV--FVIAGAVTDLVERLQRARGLPRSXXXXXXX
NRFE_ECOLI      ----------------------------------------------------------------------
CCF2_ARATH      ----------------------------------------------------------------------
CCBS_OENBE      ----------------------------------------------------------------------
CCBS_MARPO      ----------------------------------------------------------------------
CCBS_DAUCA      ----------------------------------------------------------------------
CCSA_SYNR3      ----------------------------------------------------------------------
CCSA_PROMM      ----------------------------------------------------------------------
CCSA_PROM3      ----------------------------------------------------------------------
CCSA_CUSRE      ----------------------------------------------------------------------
CCSA_TOBAC      ----------------------------------------------------------------------
CCSA_NICTO      ----------------------------------------------------------------------
CCSA_NICSY      ----------------------------------------------------------------------
CCSA_PANGI      ----------------------------------------------------------------------
CCSA_DAUCA      ----------------------------------------------------------------------
CCSA_SOLTU      ----------------------------------------------------------------------
CCSA_SOLLC      ----------------------------------------------------------------------
CCSA_SOLBU      ----------------------------------------------------------------------
CCSA_PROMS      ----------------------------------------------------------------------
CCSA_PROMP      ----------------------------------------------------------------------
CCSA_PROM5      ----------------------------------------------------------------------
CCSA_COFAR      ----------------------------------------------------------------------
CCSA_SYNPW      ----------------------------------------------------------------------
CCSA_PROM9      ----------------------------------------------------------------------
CCSA_PROM2      ----------------------------------------------------------------------
CCSA_PROM0      ----------------------------------------------------------------------
CCSA_GUIAB      ----------------------------------------------------------------------
CCSA_CHLVU      ----------------------------------------------------------------------
CCSA_HELAN      ----------------------------------------------------------------------
CCSA_ATRBE      ----------------------------------------------------------------------
CCSA_PROMT      ----------------------------------------------------------------------
CCSA_PROM1      ----------------------------------------------------------------------
CCSA_CERDE      ----------------------------------------------------------------------
CCSA_VITVI      ----------------------------------------------------------------------
CCSA_PLAOC      ----------------------------------------------------------------------
CCSA_LOTJA      ----------------------------------------------------------------------
CCSA_LACSA      ----------------------------------------------------------------------
CCSA_JASNU      ----------------------------------------------------------------------
CCSA_SPIOL      ----------------------------------------------------------------------
CCSA_PELHO      ----------------------------------------------------------------------
CCSA_MANES      ----------------------------------------------------------------------
CCSA_IPOPU      ----------------------------------------------------------------------
CCSA_CYAPA      ----------------------------------------------------------------------
CCSA_TRACE      ----------------------------------------------------------------------
CCSA_PORYE      ----------------------------------------------------------------------
CCSA_PHAAO      ----------------------------------------------------------------------
CCSA_GUITH      ----------------------------------------------------------------------
CCSA_GOSHI      ----------------------------------------------------------------------
CCSA_GOSBA      ----------------------------------------------------------------------
CCSA_CRUWA      ----------------------------------------------------------------------
CCSA_SYNY3      ----------------------------------------------------------------------
CCSA_ORYSJ      ----------------------------------------------------------------------
CCSA_ORYSI      ----------------------------------------------------------------------
CCSA_ORYSA      ----------------------------------------------------------------------
CCSA_ORYNI      ----------------------------------------------------------------------
CCSA_OENPA      ----------------------------------------------------------------------
CCSA_OENGL      ----------------------------------------------------------------------
CCSA_OENEH      ----------------------------------------------------------------------
CCSA_OENBI      ----------------------------------------------------------------------
CCSA_OENAR      ----------------------------------------------------------------------
CCSA_ARAHI      ----------------------------------------------------------------------
CCSA_OLIPU      ----------------------------------------------------------------------
CCSA_NANDO      ----------------------------------------------------------------------
CCSA_MORIN      ----------------------------------------------------------------------
CCSA_FAGEA      ----------------------------------------------------------------------
CCSA_CYAP7      ----------------------------------------------------------------------
CCSA_CYAA5      ----------------------------------------------------------------------
CCSA_CITSI      ----------------------------------------------------------------------
CCSA_BUXMI      ----------------------------------------------------------------------
CCSA_BARVE      ----------------------------------------------------------------------
CCSA_ARATH      ----------------------------------------------------------------------
CCSA_TRIEI      ----------------------------------------------------------------------
CCSA_NASOF      ----------------------------------------------------------------------
CCSA_MICAN      ----------------------------------------------------------------------
CCSA_LOLPR      ----------------------------------------------------------------------
CCSA_LOBMA      ----------------------------------------------------------------------
CCSA_LIRTU      ----------------------------------------------------------------------
CCSA_HORVU      ----------------------------------------------------------------------
CCSA_CYAP8      ----------------------------------------------------------------------
CCSA_CARPA      ----------------------------------------------------------------------
CCSA_BRADI      ----------------------------------------------------------------------
CCSA_AGRST      ----------------------------------------------------------------------
CCSA_SYNP2      ----------------------------------------------------------------------
CCSA_SORBI      ----------------------------------------------------------------------
CCSA_SACOF      ----------------------------------------------------------------------
CCSA_SACHY      ----------------------------------------------------------------------
CCSA_ODOSI      ----------------------------------------------------------------------
CCSA_LEPVR      ----------------------------------------------------------------------
CCSA_CHLRE      ----------------------------------------------------------------------
CCSA_CAPBU      ----------------------------------------------------------------------
CCSA_SYNS3      ----------------------------------------------------------------------
CCSA_SYNP6      ----------------------------------------------------------------------
CCSA_SYNE7      ----------------------------------------------------------------------
CCSA_PIPCE      ----------------------------------------------------------------------
CCSA_NOSP7      ----------------------------------------------------------------------
CCSA_MAIZE      ----------------------------------------------------------------------
CCSA_HETA4      ----------------------------------------------------------------------
CCSA_HETA2      ----------------------------------------------------------------------
CCSA_ANAVT      ----------------------------------------------------------------------
CCSA_ANASP      ----------------------------------------------------------------------
CCSA_AETGR      ----------------------------------------------------------------------
CCSA_AETCO      ----------------------------------------------------------------------
CCSA_RANMC      ----------------------------------------------------------------------
CCSA_EUCGG      ----------------------------------------------------------------------
CCSA_DRIGR      ----------------------------------------------------------------------
CCSA_SOYBN      ----------------------------------------------------------------------
CCSA_PORPU      ----------------------------------------------------------------------
CCSA_SYNJB      ----------------------------------------------------------------------
CCSA_SYNJA      ----------------------------------------------------------------------
CCSA_DRANE      ----------------------------------------------------------------------
CCSA_DIOEL      ----------------------------------------------------------------------
CCSA_THEEB      ----------------------------------------------------------------------
CCSA_SYNSC      ----------------------------------------------------------------------
CCSA_PHAVU      ----------------------------------------------------------------------
CCSA_MARPO      ----------------------------------------------------------------------
CCSA_CYACA      ----------------------------------------------------------------------
CCSA_CHLSC      ----------------------------------------------------------------------
CCSA_POPTR      ----------------------------------------------------------------------
CCSA_POPAL      ----------------------------------------------------------------------
CCSA_LEMMI      ----------------------------------------------------------------------
CCSA_CUCSA      ----------------------------------------------------------------------
CCSA_CALFG      ----------------------------------------------------------------------
CCSA_SYNPX      ----------------------------------------------------------------------
CCSA_MESVI      ----------------------------------------------------------------------
CCSA_ACAM1      ----------------------------------------------------------------------
CCSA_SYNS9      ----------------------------------------------------------------------
CCSA_GALSU      ----------------------------------------------------------------------
CCSA_ILLOL      ----------------------------------------------------------------------
CCSA_GLOVI      ----------------------------------------------------------------------
CCSA_ANTFO      ----------------------------------------------------------------------
CCSA_ADICA      ----------------------------------------------------------------------
CCSA_WELMI      ----------------------------------------------------------------------
CCSA_PROMA      ----------------------------------------------------------------------
CCSA_ACOCL      ----------------------------------------------------------------------
CCSA_ACOAM      ----------------------------------------------------------------------
CCSA_PROM4      ----------------------------------------------------------------------
CCSA_CUSEX      ----------------------------------------------------------------------
CCF1_ARATH      ----------------------------------------------------------------------
BCHG_RHOCA      ----------------------------------------------------------------------
CCSA_AMBTC      ----------------------------------------------------------------------
CCSA_WHEAT      ----------------------------------------------------------------------
CCSA_PINTH      ----------------------------------------------------------------------
CCSA_NYMAL      ----------------------------------------------------------------------
RESC_BACSU      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           HLGLAVTITGIAFSQNYSVERDVRMRAGDSVTIHDYRFTFPEVRDITGPNYRGGVALIGVTRHGEPEAVL
CCMF_ECOLI      HLGLAVTIVGIAFSQNYSVERDVRMKSGDSVDIHEYRFTFRDVKEVTGPNWRGGVATIGVTRDGKPETVL
CCMF_HAEIN      HLGVAMTVWGIAFSQNFSVERDVRMKVGESAQIGRYDFKFTGVTDENGPNYIGGKAQIDISKDGQPEASL
CCMF_PSEAE      HLGIAVCAIGIVLSSQYSAQRDLRMSPGDTVELGGYHFLFDGAKHHEGPNYTSDKGSIHVSRDGKEIATL
CCMF_PSEFL      HIGIAVCALGVVLSSQNSAERDLRLAPGESMDLAGYHFIFEGAKHFEGPNFTSDKGTVRVVRNGKEIAVL
CCMF_RHIME      XXXXXXXXXXXXXXXXXXXXXXXXMKPGAVVDVGRYSLRFDGMREGRGPNYTEDAGHFTVSRGGVEVTEI
CCMF_RHOCA      HGGLGIVFAGVGLLMAGQVE-DIRVKAGDSFEVAGYTITLVSVEDVPGPNFTAKTATMEVRQGGKLVATL
NRFE_HAEIN      HCGVAIVTIGAVMSGYFGSEIGVRLAPQQSQTLGQYEFHYRQFSNEIGPNFTAEVAFFDVTKNGKPYAEI
CCMF_BRAJA      XXXXXXXXIGIVCETTWNSEYIATMKRSDVAHVAGYDVKLDGLFQRQGPNYREMIAEFNVSRDGETLSVM
NRFE_ECOLI      -------------------EISLNLQPGQQVTLAGYTFRF-ECLDLQAKNYTSEKAIVALFDHQQRIGEL
CCF2_ARATH      ----------------------------------------------------------------------
CCBS_OENBE      ----------------------------------------------------------------------
CCBS_MARPO      ----------------------------------------------------------------------
CCBS_DAUCA      ----------------------------------------------------------------------
CCSA_SYNR3      ----------------------------------------------------------------------
CCSA_PROMM      ----------------------------------------------------------------------
CCSA_PROM3      ----------------------------------------------------------------------
CCSA_CUSRE      ----------------------------------------------------------------------
CCSA_TOBAC      ----------------------------------------------------------------------
CCSA_NICTO      ----------------------------------------------------------------------
CCSA_NICSY      ----------------------------------------------------------------------
CCSA_PANGI      ----------------------------------------------------------------------
CCSA_DAUCA      ----------------------------------------------------------------------
CCSA_SOLTU      ----------------------------------------------------------------------
CCSA_SOLLC      ----------------------------------------------------------------------
CCSA_SOLBU      ----------------------------------------------------------------------
CCSA_PROMS      ----------------------------------------------------------------------
CCSA_PROMP      ----------------------------------------------------------------------
CCSA_PROM5      ----------------------------------------------------------------------
CCSA_COFAR      ----------------------------------------------------------------------
CCSA_SYNPW      ----------------------------------------------------------------------
CCSA_PROM9      ----------------------------------------------------------------------
CCSA_PROM2      ----------------------------------------------------------------------
CCSA_PROM0      ----------------------------------------------------------------------
CCSA_GUIAB      ----------------------------------------------------------------------
CCSA_CHLVU      ----------------------------------------------------------------------
CCSA_HELAN      ----------------------------------------------------------------------
CCSA_ATRBE      ----------------------------------------------------------------------
CCSA_PROMT      ----------------------------------------------------------------------
CCSA_PROM1      ----------------------------------------------------------------------
CCSA_CERDE      ----------------------------------------------------------------------
CCSA_VITVI      ----------------------------------------------------------------------
CCSA_PLAOC      ----------------------------------------------------------------------
CCSA_LOTJA      ----------------------------------------------------------------------
CCSA_LACSA      ----------------------------------------------------------------------
CCSA_JASNU      ----------------------------------------------------------------------
CCSA_SPIOL      ----------------------------------------------------------------------
CCSA_PELHO      ----------------------------------------------------------------------
CCSA_MANES      ----------------------------------------------------------------------
CCSA_IPOPU      ----------------------------------------------------------------------
CCSA_CYAPA      ----------------------------------------------------------------------
CCSA_TRACE      ----------------------------------------------------------------------
CCSA_PORYE      ----------------------------------------------------------------------
CCSA_PHAAO      ----------------------------------------------------------------------
CCSA_GUITH      ----------------------------------------------------------------------
CCSA_GOSHI      ----------------------------------------------------------------------
CCSA_GOSBA      ----------------------------------------------------------------------
CCSA_CRUWA      ----------------------------------------------------------------------
CCSA_SYNY3      ----------------------------------------------------------------------
CCSA_ORYSJ      ----------------------------------------------------------------------
CCSA_ORYSI      ----------------------------------------------------------------------
CCSA_ORYSA      ----------------------------------------------------------------------
CCSA_ORYNI      ----------------------------------------------------------------------
CCSA_OENPA      ----------------------------------------------------------------------
CCSA_OENGL      ----------------------------------------------------------------------
CCSA_OENEH      ----------------------------------------------------------------------
CCSA_OENBI      ----------------------------------------------------------------------
CCSA_OENAR      ----------------------------------------------------------------------
CCSA_ARAHI      ----------------------------------------------------------------------
CCSA_OLIPU      ----------------------------------------------------------------------
CCSA_NANDO      ----------------------------------------------------------------------
CCSA_MORIN      ----------------------------------------------------------------------
CCSA_FAGEA      ----------------------------------------------------------------------
CCSA_CYAP7      ----------------------------------------------------------------------
CCSA_CYAA5      ----------------------------------------------------------------------
CCSA_CITSI      ----------------------------------------------------------------------
CCSA_BUXMI      ----------------------------------------------------------------------
CCSA_BARVE      ----------------------------------------------------------------------
CCSA_ARATH      ----------------------------------------------------------------------
CCSA_TRIEI      ----------------------------------------------------------------------
CCSA_NASOF      ----------------------------------------------------------------------
CCSA_MICAN      ----------------------------------------------------------------------
CCSA_LOLPR      ----------------------------------------------------------------------
CCSA_LOBMA      ----------------------------------------------------------------------
CCSA_LIRTU      ----------------------------------------------------------------------
CCSA_HORVU      ----------------------------------------------------------------------
CCSA_CYAP8      ----------------------------------------------------------------------
CCSA_CARPA      ----------------------------------------------------------------------
CCSA_BRADI      ----------------------------------------------------------------------
CCSA_AGRST      ----------------------------------------------------------------------
CCSA_SYNP2      ----------------------------------------------------------------------
CCSA_SORBI      ----------------------------------------------------------------------
CCSA_SACOF      ----------------------------------------------------------------------
CCSA_SACHY      ----------------------------------------------------------------------
CCSA_ODOSI      ----------------------------------------------------------------------
CCSA_LEPVR      ----------------------------------------------------------------------
CCSA_CHLRE      ----------------------------------------------------------------------
CCSA_CAPBU      ----------------------------------------------------------------------
CCSA_SYNS3      ----------------------------------------------------------------------
CCSA_SYNP6      ----------------------------------------------------------------------
CCSA_SYNE7      ----------------------------------------------------------------------
CCSA_PIPCE      ----------------------------------------------------------------------
CCSA_NOSP7      ----------------------------------------------------------------------
CCSA_MAIZE      ----------------------------------------------------------------------
CCSA_HETA4      ----------------------------------------------------------------------
CCSA_HETA2      ----------------------------------------------------------------------
CCSA_ANAVT      ----------------------------------------------------------------------
CCSA_ANASP      ----------------------------------------------------------------------
CCSA_AETGR      ----------------------------------------------------------------------
CCSA_AETCO      ----------------------------------------------------------------------
CCSA_RANMC      ----------------------------------------------------------------------
CCSA_EUCGG      ----------------------------------------------------------------------
CCSA_DRIGR      ----------------------------------------------------------------------
CCSA_SOYBN      ----------------------------------------------------------------------
CCSA_PORPU      ----------------------------------------------------------------------
CCSA_SYNJB      ----------------------------------------------------------------------
CCSA_SYNJA      ----------------------------------------------------------------------
CCSA_DRANE      ----------------------------------------------------------------------
CCSA_DIOEL      ----------------------------------------------------------------------
CCSA_THEEB      ----------------------------------------------------------------------
CCSA_SYNSC      ----------------------------------------------------------------------
CCSA_PHAVU      ----------------------------------------------------------------------
CCSA_MARPO      ----------------------------------------------------------------------
CCSA_CYACA      ----------------------------------------------------------------------
CCSA_CHLSC      ----------------------------------------------------------------------
CCSA_POPTR      ----------------------------------------------------------------------
CCSA_POPAL      ----------------------------------------------------------------------
CCSA_LEMMI      ----------------------------------------------------------------------
CCSA_CUCSA      ----------------------------------------------------------------------
CCSA_CALFG      ----------------------------------------------------------------------
CCSA_SYNPX      ----------------------------------------------------------------------
CCSA_MESVI      ----------------------------------------------------------------------
CCSA_ACAM1      ----------------------------------------------------------------------
CCSA_SYNS9      ----------------------------------------------------------------------
CCSA_GALSU      ----------------------------------------------------------------------
CCSA_ILLOL      ----------------------------------------------------------------------
CCSA_GLOVI      ----------------------------------------------------------------------
CCSA_ANTFO      ----------------------------------------------------------------------
CCSA_ADICA      ----------------------------------------------------------------------
CCSA_WELMI      ----------------------------------------------------------------------
CCSA_PROMA      ----------------------------------------------------------------------
CCSA_ACOCL      ----------------------------------------------------------------------
CCSA_ACOAM      ----------------------------------------------------------------------
CCSA_PROM4      ----------------------------------------------------------------------
CCSA_CUSEX      ----------------------------------------------------------------------
CCF1_ARATH      ----------------------------------------------------------------------
BCHG_RHOCA      ----------------------------------------------------------------------
CCSA_AMBTC      ----------------------------------------------------------------------
CCSA_WHEAT      ----------------------------------------------------------------------
CCSA_PINTH      ----------------------------------------------------------------------
CCSA_NYMAL      ----------------------------------------------------------------------
RESC_BACSU      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           HAEKRLYNTSRMVMTEAAIDGGLTRDLYAALGEELDNGAWAVRLYYKPFVRWIWXXXXXXXXXXXXXXXD
CCMF_ECOLI      YAEKRYYNTAGSMMTEAAIDGGITRDLYAALGEELENGAWAVRLYYKPFVRWIWXXXXXXXXXXXXCLFD
CCMF_HAEIN      FAEKRFYTVSRMSMTEAAIAGGLTRDLYVALGEKLEDNSWALRLYYKPFIRWIWIGGLFMALGGLLCMFD
CCMF_PSEAE      HPEKRLYTVQSSMMTEAGIDAGFTRDLYVALGEPLENGAWAVRVHVKPFVRWIW----------------
CCMF_PSEFL      HPEKRLYTVQSSMMTEAGIDAGFTRDLYVALGEPLGDGAWAVRVHVKPFVRWIW----------------
CCMF_RHIME      WSSKRLYSARRMPTTEAGIRTFGLSQLYVSLGDDMADGGIVVRIWWKPLILCIW----------------
CCMF_RHOCA      HPEKRIYPVQAMPTTEADIDNGFWRDVYLVIGDPQEGGGWAVRTYVKPFANWIW----------------
NRFE_HAEIN      IPERRYYDVRTMTMSEVGLDGGFWGDLYIVMGDSLGKGEFTFRLHYKPLIRWLW----------------
CCMF_BRAJA      TPSKRSFTTRGSSTTEAALLTRGASQLYISLGDANAEGAIAVRIYHKPLVLLIWWGPVLMAFGGVLSLSD
NRFE_ECOLI      TPERRFYEARRQQMMEPSIRWNGIHDWYAVMGEKTGPDRYAFRLYVQSGVR-------------------
CCF2_ARATH      ----------------------------------------------------------------------
CCBS_OENBE      ----------------------------------------------------------------------
CCBS_MARPO      ----------------------------------------------------------------------
CCBS_DAUCA      ----------------------------------------------------------------------
CCSA_SYNR3      ----------------------------------------------------------------------
CCSA_PROMM      ----------------------------------------------------------------------
CCSA_PROM3      ----------------------------------------------------------------------
CCSA_CUSRE      ----------------------------------------------------------------------
CCSA_TOBAC      ----------------------------------------------------------------------
CCSA_NICTO      ----------------------------------------------------------------------
CCSA_NICSY      ----------------------------------------------------------------------
CCSA_PANGI      ----------------------------------------------------------------------
CCSA_DAUCA      ----------------------------------------------------------------------
CCSA_SOLTU      ----------------------------------------------------------------------
CCSA_SOLLC      ----------------------------------------------------------------------
CCSA_SOLBU      ----------------------------------------------------------------------
CCSA_PROMS      ----------------------------------------------------------------------
CCSA_PROMP      ----------------------------------------------------------------------
CCSA_PROM5      ----------------------------------------------------------------------
CCSA_COFAR      ----------------------------------------------------------------------
CCSA_SYNPW      ----------------------------------------------------------------------
CCSA_PROM9      ----------------------------------------------------------------------
CCSA_PROM2      ----------------------------------------------------------------------
CCSA_PROM0      ----------------------------------------------------------------------
CCSA_GUIAB      ----------------------------------------------------------------------
CCSA_CHLVU      ----------------------------------------------------------------------
CCSA_HELAN      ----------------------------------------------------------------------
CCSA_ATRBE      ----------------------------------------------------------------------
CCSA_PROMT      ----------------------------------------------------------------------
CCSA_PROM1      ----------------------------------------------------------------------
CCSA_CERDE      ----------------------------------------------------------------------
CCSA_VITVI      ----------------------------------------------------------------------
CCSA_PLAOC      ----------------------------------------------------------------------
CCSA_LOTJA      ----------------------------------------------------------------------
CCSA_LACSA      ----------------------------------------------------------------------
CCSA_JASNU      ----------------------------------------------------------------------
CCSA_SPIOL      ----------------------------------------------------------------------
CCSA_PELHO      ----------------------------------------------------------------------
CCSA_MANES      ----------------------------------------------------------------------
CCSA_IPOPU      ----------------------------------------------------------------------
CCSA_CYAPA      ----------------------------------------------------------------------
CCSA_TRACE      ----------------------------------------------------------------------
CCSA_PORYE      ----------------------------------------------------------------------
CCSA_PHAAO      ----------------------------------------------------------------------
CCSA_GUITH      ----------------------------------------------------------------------
CCSA_GOSHI      ----------------------------------------------------------------------
CCSA_GOSBA      ----------------------------------------------------------------------
CCSA_CRUWA      ----------------------------------------------------------------------
CCSA_SYNY3      ----------------------------------------------------------------------
CCSA_ORYSJ      ----------------------------------------------------------------------
CCSA_ORYSI      ----------------------------------------------------------------------
CCSA_ORYSA      ----------------------------------------------------------------------
CCSA_ORYNI      ----------------------------------------------------------------------
CCSA_OENPA      ----------------------------------------------------------------------
CCSA_OENGL      ----------------------------------------------------------------------
CCSA_OENEH      ----------------------------------------------------------------------
CCSA_OENBI      ----------------------------------------------------------------------
CCSA_OENAR      ----------------------------------------------------------------------
CCSA_ARAHI      ----------------------------------------------------------------------
CCSA_OLIPU      ----------------------------------------------------------------------
CCSA_NANDO      ----------------------------------------------------------------------
CCSA_MORIN      ----------------------------------------------------------------------
CCSA_FAGEA      ----------------------------------------------------------------------
CCSA_CYAP7      ----------------------------------------------------------------------
CCSA_CYAA5      ----------------------------------------------------------------------
CCSA_CITSI      ----------------------------------------------------------------------
CCSA_BUXMI      ----------------------------------------------------------------------
CCSA_BARVE      ----------------------------------------------------------------------
CCSA_ARATH      ----------------------------------------------------------------------
CCSA_TRIEI      ----------------------------------------------------------------------
CCSA_NASOF      ----------------------------------------------------------------------
CCSA_MICAN      ----------------------------------------------------------------------
CCSA_LOLPR      ----------------------------------------------------------------------
CCSA_LOBMA      ----------------------------------------------------------------------
CCSA_LIRTU      ----------------------------------------------------------------------
CCSA_HORVU      ----------------------------------------------------------------------
CCSA_CYAP8      ----------------------------------------------------------------------
CCSA_CARPA      ----------------------------------------------------------------------
CCSA_BRADI      ----------------------------------------------------------------------
CCSA_AGRST      ----------------------------------------------------------------------
CCSA_SYNP2      ----------------------------------------------------------------------
CCSA_SORBI      ----------------------------------------------------------------------
CCSA_SACOF      ----------------------------------------------------------------------
CCSA_SACHY      ----------------------------------------------------------------------
CCSA_ODOSI      ----------------------------------------------------------------------
CCSA_LEPVR      ----------------------------------------------------------------------
CCSA_CHLRE      ----------------------------------------------------------------------
CCSA_CAPBU      ----------------------------------------------------------------------
CCSA_SYNS3      ----------------------------------------------------------------------
CCSA_SYNP6      ----------------------------------------------------------------------
CCSA_SYNE7      ----------------------------------------------------------------------
CCSA_PIPCE      ----------------------------------------------------------------------
CCSA_NOSP7      ----------------------------------------------------------------------
CCSA_MAIZE      ----------------------------------------------------------------------
CCSA_HETA4      ----------------------------------------------------------------------
CCSA_HETA2      ----------------------------------------------------------------------
CCSA_ANAVT      ----------------------------------------------------------------------
CCSA_ANASP      ----------------------------------------------------------------------
CCSA_AETGR      ----------------------------------------------------------------------
CCSA_AETCO      ----------------------------------------------------------------------
CCSA_RANMC      ----------------------------------------------------------------------
CCSA_EUCGG      ----------------------------------------------------------------------
CCSA_DRIGR      ----------------------------------------------------------------------
CCSA_SOYBN      ----------------------------------------------------------------------
CCSA_PORPU      ----------------------------------------------------------------------
CCSA_SYNJB      ----------------------------------------------------------------------
CCSA_SYNJA      ----------------------------------------------------------------------
CCSA_DRANE      ----------------------------------------------------------------------
CCSA_DIOEL      ----------------------------------------------------------------------
CCSA_THEEB      ----------------------------------------------------------------------
CCSA_SYNSC      ----------------------------------------------------------------------
CCSA_PHAVU      ----------------------------------------------------------------------
CCSA_MARPO      ----------------------------------------------------------------------
CCSA_CYACA      ----------------------------------------------------------------------
CCSA_CHLSC      ----------------------------------------------------------------------
CCSA_POPTR      ----------------------------------------------------------------------
CCSA_POPAL      ----------------------------------------------------------------------
CCSA_LEMMI      ----------------------------------------------------------------------
CCSA_CUCSA      ----------------------------------------------------------------------
CCSA_CALFG      ----------------------------------------------------------------------
CCSA_SYNPX      ----------------------------------------------------------------------
CCSA_MESVI      ----------------------------------------------------------------------
CCSA_ACAM1      ----------------------------------------------------------------------
CCSA_SYNS9      ----------------------------------------------------------------------
CCSA_GALSU      ----------------------------------------------------------------------
CCSA_ILLOL      ----------------------------------------------------------------------
CCSA_GLOVI      ----------------------------------------------------------------------
CCSA_ANTFO      ----------------------------------------------------------------------
CCSA_ADICA      ----------------------------------------------------------------------
CCSA_WELMI      ----------------------------------------------------------------------
CCSA_PROMA      ----------------------------------------------------------------------
CCSA_ACOCL      ----------------------------------------------------------------------
CCSA_ACOAM      ----------------------------------------------------------------------
CCSA_PROM4      ----------------------------------------------------------------------
CCSA_CUSEX      ----------------------------------------------------------------------
CCF1_ARATH      ----------------------------------------------------------------------
BCHG_RHOCA      ----------------------------------------------------------------------
CCSA_AMBTC      ----------------------------------------------------------------------
CCSA_WHEAT      ----------------------------------------------------------------------
CCSA_PINTH      ----------------------------------------------------------------------
CCSA_NYMAL      ----------------------------------------------------------------------
RESC_BACSU      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           PRYRRRKPLPEAx
CCMF_ECOLI      PRYRKRKTAPEA-
CCMF_HAEIN      RRYR---------
CCMF_PSEAE      -------------
CCMF_PSEFL      -------------
CCMF_RHIME      -------------
CCMF_RHOCA      -------------
NRFE_HAEIN      -------------
CCMF_BRAJA      RRLRVGAPKP---
NRFE_ECOLI      -------------
CCF2_ARATH      -------------
CCBS_OENBE      -------------
CCBS_MARPO      -------------
CCBS_DAUCA      -------------
CCSA_SYNR3      -------------
CCSA_PROMM      -------------
CCSA_PROM3      -------------
CCSA_CUSRE      -------------
CCSA_TOBAC      -------------
CCSA_NICTO      -------------
CCSA_NICSY      -------------
CCSA_PANGI      -------------
CCSA_DAUCA      -------------
CCSA_SOLTU      -------------
CCSA_SOLLC      -------------
CCSA_SOLBU      -------------
CCSA_PROMS      -------------
CCSA_PROMP      -------------
CCSA_PROM5      -------------
CCSA_COFAR      -------------
CCSA_SYNPW      -------------
CCSA_PROM9      -------------
CCSA_PROM2      -------------
CCSA_PROM0      -------------
CCSA_GUIAB      -------------
CCSA_CHLVU      -------------
CCSA_HELAN      -------------
CCSA_ATRBE      -------------
CCSA_PROMT      -------------
CCSA_PROM1      -------------
CCSA_CERDE      -------------
CCSA_VITVI      -------------
CCSA_PLAOC      -------------
CCSA_LOTJA      -------------
CCSA_LACSA      -------------
CCSA_JASNU      -------------
CCSA_SPIOL      -------------
CCSA_PELHO      -------------
CCSA_MANES      -------------
CCSA_IPOPU      -------------
CCSA_CYAPA      -------------
CCSA_TRACE      -------------
CCSA_PORYE      -------------
CCSA_PHAAO      -------------
CCSA_GUITH      -------------
CCSA_GOSHI      -------------
CCSA_GOSBA      -------------
CCSA_CRUWA      -------------
CCSA_SYNY3      -------------
CCSA_ORYSJ      -------------
CCSA_ORYSI      -------------
CCSA_ORYSA      -------------
CCSA_ORYNI      -------------
CCSA_OENPA      -------------
CCSA_OENGL      -------------
CCSA_OENEH      -------------
CCSA_OENBI      -------------
CCSA_OENAR      -------------
CCSA_ARAHI      -------------
CCSA_OLIPU      -------------
CCSA_NANDO      -------------
CCSA_MORIN      -------------
CCSA_FAGEA      -------------
CCSA_CYAP7      -------------
CCSA_CYAA5      -------------
CCSA_CITSI      -------------
CCSA_BUXMI      -------------
CCSA_BARVE      -------------
CCSA_ARATH      -------------
CCSA_TRIEI      -------------
CCSA_NASOF      -------------
CCSA_MICAN      -------------
CCSA_LOLPR      -------------
CCSA_LOBMA      -------------
CCSA_LIRTU      -------------
CCSA_HORVU      -------------
CCSA_CYAP8      -------------
CCSA_CARPA      -------------
CCSA_BRADI      -------------
CCSA_AGRST      -------------
CCSA_SYNP2      -------------
CCSA_SORBI      -------------
CCSA_SACOF      -------------
CCSA_SACHY      -------------
CCSA_ODOSI      -------------
CCSA_LEPVR      -------------
CCSA_CHLRE      -------------
CCSA_CAPBU      -------------
CCSA_SYNS3      -------------
CCSA_SYNP6      -------------
CCSA_SYNE7      -------------
CCSA_PIPCE      -------------
CCSA_NOSP7      -------------
CCSA_MAIZE      -------------
CCSA_HETA4      -------------
CCSA_HETA2      -------------
CCSA_ANAVT      -------------
CCSA_ANASP      -------------
CCSA_AETGR      -------------
CCSA_AETCO      -------------
CCSA_RANMC      -------------
CCSA_EUCGG      -------------
CCSA_DRIGR      -------------
CCSA_SOYBN      -------------
CCSA_PORPU      -------------
CCSA_SYNJB      -------------
CCSA_SYNJA      -------------
CCSA_DRANE      -------------
CCSA_DIOEL      -------------
CCSA_THEEB      -------------
CCSA_SYNSC      -------------
CCSA_PHAVU      -------------
CCSA_MARPO      -------------
CCSA_CYACA      -------------
CCSA_CHLSC      -------------
CCSA_POPTR      -------------
CCSA_POPAL      -------------
CCSA_LEMMI      -------------
CCSA_CUCSA      -------------
CCSA_CALFG      -------------
CCSA_SYNPX      -------------
CCSA_MESVI      -------------
CCSA_ACAM1      -------------
CCSA_SYNS9      -------------
CCSA_GALSU      -------------
CCSA_ILLOL      -------------
CCSA_GLOVI      -------------
CCSA_ANTFO      -------------
CCSA_ADICA      -------------
CCSA_WELMI      -------------
CCSA_PROMA      -------------
CCSA_ACOCL      -------------
CCSA_ACOAM      -------------
CCSA_PROM4      -------------
CCSA_CUSEX      -------------
CCF1_ARATH      -------------
BCHG_RHOCA      -------------
CCSA_AMBTC      -------------
CCSA_WHEAT      -------------
CCSA_PINTH      -------------
CCSA_NYMAL      -------------
RESC_BACSU      -------------