[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF67786.1

[Show Plain Result]


## Summary of Sequence Search
    1::233
    1::233     e-127 100%  233 aa  VG26_BPP22 RecName: Full=Tail needle protein gp26;AltName:
   21::130     3e-05  21%  284 aa  TPM_DERPT RecName: Full=Tropomyosin;AltName: Allergen=Der p 10;
   21::130     3e-05  21%  284 aa  TPM_DERFA RecName: Full=Tropomyosin;AltName: Full=Mag44;AltName:
   51::135     5e-05  28%  470 aa  SIGM1_REOVL RecName: Full=Outer capsid protein sigma-1;       
  308::399     5e-05  20%  944 aa  NUF1_YEAST RecName: Full=Protein NUF1;AltName: Full=Spindle poly
  305::458     6e-05  24%  518 aa  FLAA_AQUAE RecName: Full=Flagellin;
    8::123     8e-05  21%  284 aa  TPM2_SCHMA RecName: Full=Tropomyosin-2;AltName: Full=Tropomyosin
   21::130     1e-04  24%  284 aa  TPM_LEPDS RecName: Full=Tropomyosin;AltName: Allergen=Lep d 10;
   42::124     3e-04  26%  284 aa  TPM_SCHHA RecName: Full=Tropomyosin;
  108::218     4e-04  19%  228 aa  Y137_MYCPN RecName: Full=UPF0134 protein MPN_137;
   42::124     4e-04  26%  284 aa  TPM1_SCHMA RecName: Full=Tropomyosin-1;AltName: Full=Tropomyosin I;
 1662::1758    4e-04  27% 2017 aa  CROCC_HUMAN RecName: Full=Rootletin;AltName: Full=Ciliary rootlet
 1100::1195    9e-04  33% 1616 aa  SLAP_BACCI RecName: Full=S-layer-related protein;Flags: Precursor;
  250::318     9e-04  34%  473 aa  ATPB_THEYD RecName: Full=ATP synthase subunit beta;       
  254::323     9e-04  36%  472 aa  ATPB_CLOPH RecName: Full=ATP synthase subunit beta;       
    1::233

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVEL
VG26_BPP22      MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVEL
TPM_DERPT       -----------------------------------------------RAEIAEQKARDANLRAEKSEEEV
TPM_DERFA       -----------------------------------------------RAEIAEQKARDANLRAEKSEEEV
SIGM1_REOVL     ----------------------------------------------------GLGRQIADISNSISTIEL
NUF1_YEAST      ---------------------------------------------------------ELKIKSDEMDLQL
FLAA_AQUAE      ----------------------------------------------------------------------
TPM2_SCHMA      ----------------------------------MLAMKLDKENAVDEADQLEAKLREKELEMQTKDEEV
TPM_LEPDS       -----------------------------------------------RAEIAEQKSRDANLRAEKSEEEV
TPM_SCHHA       --------------------------------------------------------------------EI
Y137_MYCPN      ----------------------------------VLLHGEQINKLTQIVEKQGEQIRELQVEQKAQRQEF
TPM1_SCHMA      --------------------------------------------------------------------EI
CROCC_HUMAN     ----------------------------------------------------------------------
SLAP_BACCI      -------------------------------------------------------------KTNEKTVTI
ATPB_THEYD      ----------------------------------------------------------------------
ATPB_CLOPH      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADY
VG26_BPP22      ADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADY
TPM_DERPT       RALQKKIQQIENELDQVQEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEEKIATAKLEE
TPM_DERFA       RALQKKIQQIENELDQVQEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEEKIATAKLEE
SIGM1_REOVL     GEMDNRLVGISSQVTQLSNSVSQNTQSISSLGDRINAVEPRVDSLDTVTSNLTGRTSTLEADVGS-----
NUF1_YEAST      KQKQNESKRLKDELNELETKFSENGSQSSAKENELKMLKNKIAELEEEISTKNSQLIAKEGKLASLMAQL
FLAA_AQUAE      ------LDQFIADINNQAGGKLIASKDPSGTKLVLSTPNGETISVEVTVNDADGDTVVSSINLGALLQGA
TPM2_SCHMA      AEVLKKIQQVDTDKETAQTQLAETNTKLEETDKRATEAEAEVASLQKRIRQLEDELESTETRLATVKLEE
TPM_LEPDS       RGLQKKIQQIENELDQVQESLTANTK-LEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGKIATSKLEE
TPM_SCHHA       AELNTKMKQAQIDCDEVQETLQEQMNKLEETDKRATNAEAEVAAMTRRIRLLDLEVSSSRLTETLTKLEE
Y137_MYCPN      NARMDRLENLLVEFDSIEGRLDSMDSRLDSMENRLDSIEGRLDSVEGRLDSVEGRLDSMENRLDSME---
TPM1_SCHMA      AELNNKMKQAQIDCDEAQETLQEQMNKLEETDKRATNAEAEVAAMTRRIRLLDLEVSSSRLTETLTKLEE
CROCC_HUMAN     ---EGELQRSRLGLSDREAQAQALQDRVDSLQRQVADSEVKAGTLQLTVERLNGALAKVEESEGALRDKV
SLAP_BACCI      IGDEAAVKALKLDMNKGESLRLAVTAEYSSSSTDVT-GQAAYASLDPAVVSVDGRITALREGSGTVQATY
ATPB_THEYD      ---------------DNIFRYTLAGSEVSALLGRMPSAVGYQPTLSTEMGALQERITTAKGSITSMQAIY
ATPB_CLOPH      ---------------DNIFRFTQAGSEVSALLGRMPSAVGYQPTLQTEMGALQERITSTKNSITSVQAVY


                         +         .         .         .         .         *         .:210
query           VSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKGVFDADLTFAVSDTYTQSEIQAIAN
VG26_BPP22      VSKTATTSQSLASPLNVTTSYSVGGKKVLGARQTGWTAATGTANKGVFDADLTFAVSDTYTQSEIQAIAN
TPM_DERPT       ASQSADESERMRKML-------------------------------------------------------
TPM_DERFA       ASQSADESERMRKML-------------------------------------------------------
SIGM1_REOVL     ----------------------------------------------------------------------
NUF1_YEAST      TQLESKLNQ-------------------------------------------------------------
FLAA_AQUAE      AGTVVNTSGATASAVKVGTLIVMGSENVQGTGIAYFTAATSGTFNSLNDVDVTTNKGAEIAQVLIQRAVR
TPM2_SCHMA      ASKAADES--------------------------------------------------------------
TPM_LEPDS       ASQSADESERMRKML-------------------------------------------------------
TPM_SCHHA       ASKTAEESE-------------------------------------------------------------
Y137_MYCPN      ----------------------------------------------------------------------
TPM1_SCHMA      ASKTAEESE-------------------------------------------------------------
CROCC_HUMAN     RGLTEALAQSSAS-LNSTRDKNLHLQKALTA---------------------------------------
SLAP_BACCI      EGHTATARVSV-----------------------------------------------------------
ATPB_THEYD      VPADDLTDPAVAA---------------------------------------------------------
ATPB_CLOPH      V-----PADDLTDPAPATT---------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ALITERRRTKALEDALRAHGLID
VG26_BPP22      ALITERRRTKALEDALRAHGLID
TPM_DERPT       -----------------------
TPM_DERFA       -----------------------
SIGM1_REOVL     -----------------------
NUF1_YEAST      -----------------------
FLAA_AQUAE      QVDTIRTQIGSTINNLQA-----
TPM2_SCHMA      -----------------------
TPM_LEPDS       -----------------------
TPM_SCHHA       -----------------------
Y137_MYCPN      -----------------------
TPM1_SCHMA      -----------------------
CROCC_HUMAN     -----------------------
SLAP_BACCI      -----------------------
ATPB_THEYD      -----------------------
ATPB_CLOPH      -----------------------