[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF67908.1

[Show Plain Result]


## Summary of Sequence Search
    1::406
    1::406       0.0  89%  406 aa  MLC_ECOLI RecName: Full=Protein mlc;AltName: Full=Making large
    7::405     6e-83  39%  406 aa  NAGC_SHIFL RecName: Full=N-acetylglucosamine repressor;
    7::405     6e-83  39%  406 aa  NAGC_ECOLI RecName: Full=N-acetylglucosamine repressor;
    7::405     6e-83  39%  406 aa  NAGC_ECOL6 RecName: Full=N-acetylglucosamine repressor;
    7::405     6e-83  39%  406 aa  NAGC_ECO57 RecName: Full=N-acetylglucosamine repressor;
    2::393     6e-27  24%  399 aa  XYLR_ANATD RecName: Full=Xylose repressor;
    9::348     4e-26  24%  384 aa  XYLR2_BACSU RecName: Full=Xylose repressor;
    9::341     2e-23  24%  384 aa  XYLR1_BACSU RecName: Full=Xylose repressor;
   67::313     8e-23  29%  321 aa  GLK_BACSU RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
   52::317     4e-20  27%  330 aa  GLK_BACHD RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
  100::314     5e-20  27%  328 aa  GLK_STAXY RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
    9::332     6e-19  22%  397 aa  YPHH_ECOLI RecName: Full=Uncharacterized protein yphH;
   57::307     1e-17  26%  317 aa  GLK_STRLI RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
   57::307     1e-17  26%  317 aa  GLK_STRCO RecName: Full=Glucokinase;         EC=2.7.1.2;AltName:
  466::687     4e-17  27%  722 aa  GLCNE_CRIGR RecName: Full=Bifunctional UDP-N-acetylglucosamine
  466::672     2e-16  26%  722 aa  GLCNE_RAT RecName: Full=Bifunctional UDP-N-acetylglucosamine
  466::672     2e-16  26%  722 aa  GLCNE_MOUSE RecName: Full=Bifunctional UDP-N-acetylglucosamine
  466::672     2e-15  25%  722 aa  GLCNE_HUMAN RecName: Full=Bifunctional UDP-N-acetylglucosamine
  167::393     3e-15  23%  399 aa  XYLR_CALSR RecName: Full=Putative xylose repressor;
   51::285     2e-14  24%  295 aa  Y188_CLOPE RecName: Full=Uncharacterized protein CPE0188;
   59::270     2e-11  28%  302 aa  MAK_ECOLI RecName: Full=Fructokinase;         EC=2.7.1.4;AltName:
   58::290     1e-10  27%  300 aa  NANK_HAEIG RecName: Full=N-acetylmannosamine kinase;       
   58::290     2e-10  27%  300 aa  NANK_HAEIN RecName: Full=N-acetylmannosamine kinase;       
   58::290     3e-10  27%  300 aa  NANK_HAEIE RecName: Full=N-acetylmannosamine kinase;       
   58::290     1e-09  26%  300 aa  NANK_HAEI8 RecName: Full=N-acetylmannosamine kinase;       
   10::370     2e-09  22%  388 aa  XYLR_LACPE RecName: Full=Xylose repressor;
   34::406     2e-09  22%  438 aa  Y495_MYCBO RecName: Full=Uncharacterized protein Mb0495;
   34::406     2e-09  22%  438 aa  Y485_MYCTU RecName: Full=Uncharacterized protein Rv0485/MT0503;
   49::176     3e-08  31%  293 aa  NANK_VIBVU RecName: Full=N-acetylmannosamine kinase;       
   86::176     5e-08  35%  293 aa  NANK_VIBVY RecName: Full=N-acetylmannosamine kinase;       
  143::250     1e-06  31%  291 aa  NANK_ECOK1 RecName: Full=N-acetylmannosamine kinase;       
  143::250     1e-06  31%  291 aa  NANK_ECO45 RecName: Full=N-acetylmannosamine kinase;       
   59::299     1e-06  26%  303 aa  NAGK_ECO24 RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-06  26%  303 aa  NAGK_SHIDS RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-06  26%  303 aa  NAGK_ECOSM RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-06  26%  303 aa  NAGK_ECOSE RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-06  26%  303 aa  NAGK_ECOLU RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-06  26%  303 aa  NAGK_ECOLI RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-06  26%  303 aa  NAGK_ECOLC RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-06  26%  303 aa  NAGK_ECOHS RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-06  26%  303 aa  NAGK_ECODH RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-06  26%  303 aa  NAGK_ECOBW RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-06  26%  303 aa  NAGK_ECO8A RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-06  26%  303 aa  NAGK_ECO7I RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-06  26%  303 aa  NAGK_ECO5E RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-06  26%  303 aa  NAGK_ECO57 RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-06  26%  303 aa  NAGK_ECO55 RecName: Full=N-acetyl-D-glucosamine kinase;       
   86::197     2e-06  30%  287 aa  NANK_VIBCM RecName: Full=N-acetylmannosamine kinase;       
   86::197     2e-06  30%  287 aa  NANK_VIBCH RecName: Full=N-acetylmannosamine kinase;       
   86::197     2e-06  30%  287 aa  NANK_VIBC3 RecName: Full=N-acetylmannosamine kinase;       
  143::250     2e-06  31%  291 aa  NANK_ECOL5 RecName: Full=N-acetylmannosamine kinase;       
  143::250     2e-06  31%  291 aa  NANK1_ECOL6 RecName: Full=N-acetylmannosamine kinase;       
   59::284     3e-06  24%  290 aa  NANK_YERPY RecName: Full=N-acetylmannosamine kinase;       
   59::284     3e-06  24%  290 aa  NANK_YERPS RecName: Full=N-acetylmannosamine kinase;       
   59::284     3e-06  24%  290 aa  NANK_YERPP RecName: Full=N-acetylmannosamine kinase;       
   59::284     3e-06  24%  290 aa  NANK_YERPN RecName: Full=N-acetylmannosamine kinase;       
   59::284     3e-06  24%  290 aa  NANK_YERPG RecName: Full=N-acetylmannosamine kinase;       
   59::284     3e-06  24%  290 aa  NANK_YERPE RecName: Full=N-acetylmannosamine kinase;       
   59::284     3e-06  24%  290 aa  NANK_YERPB RecName: Full=N-acetylmannosamine kinase;       
   59::284     3e-06  24%  290 aa  NANK_YERPA RecName: Full=N-acetylmannosamine kinase;       
   59::284     3e-06  24%  290 aa  NANK_YERP3 RecName: Full=N-acetylmannosamine kinase;       
   52::298     4e-06  21%  304 aa  NAGK_MANSM RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     6e-06  26%  303 aa  NAGK_ECOUT RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     6e-06  26%  303 aa  NAGK_ECOL5 RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     6e-06  26%  303 aa  NAGK_ECOK1 RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     6e-06  26%  303 aa  NAGK_ECO81 RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     6e-06  26%  303 aa  NAGK_ECO45 RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     6e-06  26%  303 aa  NAGK_ECO27 RecName: Full=N-acetyl-D-glucosamine kinase;       
   98::264     9e-06  27%  309 aa  ALSK_ECOLI RecName: Full=D-allose kinase;         Short=Allokinase;
  175::299     2e-05  32%  303 aa  NAGK_SHIFL RecName: Full=N-acetyl-D-glucosamine kinase;       
  175::299     2e-05  32%  303 aa  NAGK_SHIF8 RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-05  25%  303 aa  NAGK_ECOL6 RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::257     5e-05  21%  304 aa  NAGK_PASMU RecName: Full=N-acetyl-D-glucosamine kinase;       
   42::298     5e-05  21%  305 aa  NAGK_HAES1 RecName: Full=N-acetyl-D-glucosamine kinase;       
   39::185     6e-05  31%  288 aa  SCRK_PEDPE RecName: Full=Fructokinase;         EC=2.7.1.4;
   84::293     2e-04  20%  297 aa  NANK_PASMU RecName: Full=N-acetylmannosamine kinase;       
   59::299     2e-04  23%  302 aa  NAGK_VIBCH RecName: Full=N-acetyl-D-glucosamine kinase;       
   59::299     2e-04  23%  303 aa  NAGK_ESCF3 RecName: Full=N-acetyl-D-glucosamine kinase;       
  175::299     2e-04  28%  303 aa  NAGK_CITK8 RecName: Full=N-acetyl-D-glucosamine kinase;       
  493::593     2e-04  24%  907 aa  CAPP_STRMU RecName: Full=Phosphoenolpyruvate carboxylase;       
   59::299     3e-04  25%  303 aa  NAGK_SHISS RecName: Full=N-acetyl-D-glucosamine kinase;       
   49::298     3e-04  21%  304 aa  NAGK_HAEI8 RecName: Full=N-acetyl-D-glucosamine kinase;       
  143::250     5e-04  30%  291 aa  NANK_SHIB3 RecName: Full=N-acetylmannosamine kinase;       
  175::299     9e-04  28%  303 aa  NAGK_SALPB RecName: Full=N-acetyl-D-glucosamine kinase;       
    1::406

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVADSQPGHIDQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEIKEAGS
MLC_ECOLI       MVAENQPGHIDQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEIKEAGN
NAGC_SHIFL      ----AQIGNVDLVKQLNSAAVYRLIDQYGPISRIQIAEQSQLAPASVTKITRQLIERGLIKEVD-QQAST
NAGC_ECOLI      ----AQIGNVDLVKQLNSAAVYRLIDQYGPISRIQIAEQSQLAPASVTKITRQLIERGLIKEVD-QQAST
NAGC_ECOL6      ----AQIGNVDLVKQLNSAAVYRLIDQYGPISRIQIAEQSQLAPASVTKITRQLIERGLIKEVD-QQAST
NAGC_ECO57      ----AQIGNVDLVKQLNSAAVYRLIDQYGPISRIQIAEQSQLAPASVTKITRQLIERGLIKEVD-QQAST
XYLR_ANATD      -------GNHTLLKQINKLLVLKTILDNKIISRTKISKLVDLNKATVSNLTDELIEGYVVEKGYGKSKG-
XYLR2_BACSU     ------------VKKVNQKLLLKEILKNSPISRAKLSEMTGLNKSTVSSQVNTLMKENLVFEIGQGQS-S
XYLR1_BACSU     ------------VKKVNQKLLLKEILKNSPISRAKLSEMTGLNKSTVSSQVNTLMKESMVFEIGQGQS-S
GLK_BACSU       ----------------------------------------------------------------------
GLK_BACHD       ----------------------------------------------------------------------
GLK_STAXY       ----------------------------------------------------------------------
YPHH_ECOLI      -----------QIRHHNKCVILELLYRQKRANKSTLARLAQISIPAVSNILQELESEKRVVNID-DESQT
GLK_STRLI       ----------------------------------------------------------------------
GLK_STRCO       ----------------------------------------------------------------------
GLCNE_CRIGR     ----------------------------------------------------------------------
GLCNE_RAT       ----------------------------------------------------------------------
GLCNE_MOUSE     ----------------------------------------------------------------------
GLCNE_HUMAN     ----------------------------------------------------------------------
XYLR_CALSR      ----------------------------------------------------------------------
Y188_CLOPE      ----------------------------------------------------------------------
MAK_ECOLI       ----------------------------------------------------------------------
NANK_HAEIG      ----------------------------------------------------------------------
NANK_HAEIN      ----------------------------------------------------------------------
NANK_HAEIE      ----------------------------------------------------------------------
NANK_HAEI8      ----------------------------------------------------------------------
XYLR_LACPE      -----------QLRNRNLKLVLQQIINHPATSRIAISHELNLNKSTISSLYNSLSADHFIEELEGAASNV
Y495_MYCBO      ------------LSDSAAASVFRAVRLRGPVGRDVIAGSTSLSIATVNRVIXXXXXXXXXXXXXXXVSGA
Y485_MYCTU      ------------LSDSAAASVFRAVRLRGPVGRDVIAGSTSLSIATVNRVIXXXXXXXXXXXXXXXVSGA
NANK_VIBVU      ----------------------------------------------------------------------
NANK_VIBVY      ----------------------------------------------------------------------
NANK_ECOK1      ----------------------------------------------------------------------
NANK_ECO45      ----------------------------------------------------------------------
NAGK_ECO24      ----------------------------------------------------------------------
NAGK_SHIDS      ----------------------------------------------------------------------
NAGK_ECOSM      ----------------------------------------------------------------------
NAGK_ECOSE      ----------------------------------------------------------------------
NAGK_ECOLU      ----------------------------------------------------------------------
NAGK_ECOLI      ----------------------------------------------------------------------
NAGK_ECOLC      ----------------------------------------------------------------------
NAGK_ECOHS      ----------------------------------------------------------------------
NAGK_ECODH      ----------------------------------------------------------------------
NAGK_ECOBW      ----------------------------------------------------------------------
NAGK_ECO8A      ----------------------------------------------------------------------
NAGK_ECO7I      ----------------------------------------------------------------------
NAGK_ECO5E      ----------------------------------------------------------------------
NAGK_ECO57      ----------------------------------------------------------------------
NAGK_ECO55      ----------------------------------------------------------------------
NANK_VIBCM      ----------------------------------------------------------------------
NANK_VIBCH      ----------------------------------------------------------------------
NANK_VIBC3      ----------------------------------------------------------------------
NANK_ECOL5      ----------------------------------------------------------------------
NANK1_ECOL6     ----------------------------------------------------------------------
NANK_YERPY      ----------------------------------------------------------------------
NANK_YERPS      ----------------------------------------------------------------------
NANK_YERPP      ----------------------------------------------------------------------
NANK_YERPN      ----------------------------------------------------------------------
NANK_YERPG      ----------------------------------------------------------------------
NANK_YERPE      ----------------------------------------------------------------------
NANK_YERPB      ----------------------------------------------------------------------
NANK_YERPA      ----------------------------------------------------------------------
NANK_YERP3      ----------------------------------------------------------------------
NAGK_MANSM      ----------------------------------------------------------------------
NAGK_ECOUT      ----------------------------------------------------------------------
NAGK_ECOL5      ----------------------------------------------------------------------
NAGK_ECOK1      ----------------------------------------------------------------------
NAGK_ECO81      ----------------------------------------------------------------------
NAGK_ECO45      ----------------------------------------------------------------------
NAGK_ECO27      ----------------------------------------------------------------------
ALSK_ECOLI      ----------------------------------------------------------------------
NAGK_SHIFL      ----------------------------------------------------------------------
NAGK_SHIF8      ----------------------------------------------------------------------
NAGK_ECOL6      ----------------------------------------------------------------------
NAGK_PASMU      ----------------------------------------------------------------------
NAGK_HAES1      ----------------------------------------------------------------------
SCRK_PEDPE      ----------------------------------------------------------------------
NANK_PASMU      ----------------------------------------------------------------------
NAGK_VIBCH      ----------------------------------------------------------------------
NAGK_ESCF3      ----------------------------------------------------------------------
NAGK_CITK8      ----------------------------------------------------------------------
CAPP_STRMU      ----------------------------------------------------------------------
NAGK_SHISS      ----------------------------------------------------------------------
NAGK_HAEI8      ----------------------------------------------------------------------
NANK_SHIB3      ----------------------------------------------------------------------
NAGK_SALPB      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RGRPAVGLMVETEAWHYLSIRISRGEIFLALRDLSSKLVVXXXXXXXXXXXXXXXXRIITHVDRFFTRHQ
MLC_ECOLI       RGRPAVGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDLPLLDRIISHIDQFFIRHQ
NAGC_SHIFL      GGRRAISIVTETRNFHAIGVRLGRHDATITLFDLSSKVLAEEHYPLPERTQQTLEHALLNAIAQFIDSYQ
NAGC_ECOLI      GGRRAISIVTETRNFHAIGVRLGRHDATITLFDLSSKVLAEEHYPLPERTQQTLEHALLNAIAQFIDSYQ
NAGC_ECOL6      GGRRAISIVTETRNFHAIGVRLGRHDATITLFDLSSKVLAEEHYPLPERTQQTLEHALLNAIAQFIDSYQ
NAGC_ECO57      GGRRAISIVTETRNFHAIGVRLGRHDATITLFDLSSKVLAEEHYPLPERTQQTLEHALLNAIAQFIDSYQ
XYLR_ANATD      -GRRPVLLQVNKDVGSIIGIDLGVDYIHIILSNFVGEVIFEEYANMKIGEDKEKLLRLLFDIEKSVKKAP
XYLR2_BACSU     GGRRPVMLVFNKKAGYSIGIDVGVDYISGILTDLEGTIILDQHHHLESNSPEITKDILIDMIHHFITRMP
XYLR1_BACSU     GGRRPVMLVFNKKAGYSVGIDVGVDYINGILTDLEGTIVLDQYRHLESNSPEITKDILIDMIHHFITQMP
GLK_BACSU       ----------------------------------------------------------------------
GLK_BACHD       -------------------------------------------------------------LDKRLSGHH
GLK_STAXY       ----------------------------------------------------------------------
YPHH_ECOLI      RGHSSGTWLIAPEGDWTLCLNVTPTSIEC---QVANACLSPKGEFEYLQIDAPTPQALLSEIEKCWHRHR
GLK_STRLI       ----------------------------------------------------------------------
GLK_STRCO       ----------------------------------------------------------------------
GLCNE_CRIGR     ----------------------------------------------------------------------
GLCNE_RAT       ----------------------------------------------------------------------
GLCNE_MOUSE     ----------------------------------------------------------------------
GLCNE_HUMAN     ----------------------------------------------------------------------
XYLR_CALSR      ----------------------------------------------------------------------
Y188_CLOPE      --------------------------------------------------------------------HE
MAK_ECOLI       ----------------------------------------------------------------------
NANK_HAEIG      ----------------------------------------------------------------------
NANK_HAEIN      ----------------------------------------------------------------------
NANK_HAEIE      ----------------------------------------------------------------------
NANK_HAEI8      ----------------------------------------------------------------------
XYLR_LACPE      GGRKPIMARLNKKYGYTITFDLGYRQLHAMANYLDAEIIDYQEIDTKGRPIEAMLDDCRHFVQEMQTQ-V
Y495_MYCBO      IGRPRVPVEVNHEPFVTLGIHIGARTTSIVATDLFGRTLDTVETPTPRNAAGAALTSLADSADRYL--QX
Y485_MYCTU      IGRPRVPVEVNHEPFVTLGIHIGARTTSIVATDLFGRTLDTVETPTPRNAAGAALTSLADSADRYL--QX
NANK_VIBVU      ---------------------------------------------------------------------Q
NANK_VIBVY      ----------------------------------------------------------------------
NANK_ECOK1      ----------------------------------------------------------------------
NANK_ECO45      ----------------------------------------------------------------------
NAGK_ECO24      ----------------------------------------------------------------------
NAGK_SHIDS      ----------------------------------------------------------------------
NAGK_ECOSM      ----------------------------------------------------------------------
NAGK_ECOSE      ----------------------------------------------------------------------
NAGK_ECOLU      ----------------------------------------------------------------------
NAGK_ECOLI      ----------------------------------------------------------------------
NAGK_ECOLC      ----------------------------------------------------------------------
NAGK_ECOHS      ----------------------------------------------------------------------
NAGK_ECODH      ----------------------------------------------------------------------
NAGK_ECOBW      ----------------------------------------------------------------------
NAGK_ECO8A      ----------------------------------------------------------------------
NAGK_ECO7I      ----------------------------------------------------------------------
NAGK_ECO5E      ----------------------------------------------------------------------
NAGK_ECO57      ----------------------------------------------------------------------
NAGK_ECO55      ----------------------------------------------------------------------
NANK_VIBCM      ----------------------------------------------------------------------
NANK_VIBCH      ----------------------------------------------------------------------
NANK_VIBC3      ----------------------------------------------------------------------
NANK_ECOL5      ----------------------------------------------------------------------
NANK1_ECOL6     ----------------------------------------------------------------------
NANK_YERPY      ----------------------------------------------------------------------
NANK_YERPS      ----------------------------------------------------------------------
NANK_YERPP      ----------------------------------------------------------------------
NANK_YERPN      ----------------------------------------------------------------------
NANK_YERPG      ----------------------------------------------------------------------
NANK_YERPE      ----------------------------------------------------------------------
NANK_YERPB      ----------------------------------------------------------------------
NANK_YERPA      ----------------------------------------------------------------------
NANK_YERP3      ----------------------------------------------------------------------
NAGK_MANSM      ----------------------------------------------------------------------
NAGK_ECOUT      ----------------------------------------------------------------------
NAGK_ECOL5      ----------------------------------------------------------------------
NAGK_ECOK1      ----------------------------------------------------------------------
NAGK_ECO81      ----------------------------------------------------------------------
NAGK_ECO45      ----------------------------------------------------------------------
NAGK_ECO27      ----------------------------------------------------------------------
ALSK_ECOLI      ----------------------------------------------------------------------
NAGK_SHIFL      ----------------------------------------------------------------------
NAGK_SHIF8      ----------------------------------------------------------------------
NAGK_ECOL6      ----------------------------------------------------------------------
NAGK_PASMU      ----------------------------------------------------------------------
NAGK_HAES1      ---------------------------------------------------------VITHLVQ---KAD
SCRK_PEDPE      ----------------------------------------------------------MTAVDDYFTTHP
NANK_PASMU      ----------------------------------------------------------------------
NAGK_VIBCH      ----------------------------------------------------------------------
NAGK_ESCF3      ----------------------------------------------------------------------
NAGK_CITK8      ----------------------------------------------------------------------
CAPP_STRMU      --------------------------------------------------------------------HT
NAGK_SHISS      ----------------------------------------------------------------------
NAGK_HAEI8      -------------------------------------------------------------------RAD
NANK_SHIB3      ----------------------------------------------------------------------
NAGK_SALPB      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QKLERLTSIAITLPGIIDTENGVVHRMPYYEDVKEMPLGDALERHTGVPVYIQHDISAWTMAEALFGASR
MLC_ECOLI       KKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASR
NAGC_SHIFL      RKLRELIAISVILPGLVDPDSGKIHYMPHIQ-VENWGLVEALEERFKVTCFVGHDIRSLALAEHYFGASQ
NAGC_ECOLI      RKLRELIAISVILPGLVDPDSGKIHYMPHIQ-VENWGLVEALEERFKVTCFVGHDIRSLALAEHYFGASQ
NAGC_ECOL6      RKLRELIAISVILPGLVDPDSGKIHYMPHIQ-VENWGLVEALEERFKVTCFVGHDIRSLALAEHYFGASQ
NAGC_ECO57      RKLRELIAISVILPGLVDPDSGKIHYMPHIQ-VENWGLVEALEERFKVTCFVGHDIRSLALAEHYFGASQ
XYLR_ANATD      QTPKXXXXXXXXXXXXXEKESGTVLLAPNLK-WQNVPLRSIVQQKFNLPVYIDNEANAGALGEKWFGEWG
XYLR2_BACSU     QSPYGLIGIGICVPGLIDKNQKIVFTPN--SNWRDIDLKSFIQEKFNVPVFIENEANAGAYGEKVFGAAK
XYLR1_BACSU     QSPYGLIGIGICVPGLIDKDQKIVFTPN--SNWRDIDLKSSIQEKYNVPVFIENEANAGAYGEKVFGAAK
GLK_BACSU       --------IGMGAPGPVDMAAGVV-----YETVKNYALKNHLETETGIPAVIENDANIAALGEMWKGAGD
GLK_BACHD       KSKSDLIGIGLGAPGFIEMDTGFIYHAVNI-GWRDFPLKDKLEEETKLPVIVDNDANIAALGEMWKGAGD
GLK_STAXY       ---------------------------------------DIFKQFVDCPVYVDNDANVAALGEKHKGAGN
YPHH_ECOLI      KLWDHTINLALAIHGQVDPVTGVSQTMPQAPWTTPVEVKYLLEEKLGIRVMVDNDCVMLALAEKWQNNSQ
GLK_STRLI       -----IVAVGIGAAGYVNRQRSTVYFAPNI-DWRQEPLKEKVEARVGLPVVVENDANAAAWGEYKFGGGK
GLK_STRCO       -----IVAVGIGAAGYVNRQRSTVYFAPNI-DWRQEPLKEKVEARVGLPVVVENDANAAAWGEYKFGGGK
GLCNE_CRIGR     ----RILGVGISTGGRVNPQEGIVHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAAMAERKFGQGK
GLCNE_RAT       ----RILGVGISTGGRVNPQEGVVHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAAMAERKFGQGK
GLCNE_MOUSE     ----RILGVGISTGGRVNPQEGVVHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAAMAERKFGQGK
GLCNE_HUMAN     ----RILGVGISTGGRVNPREGIVHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAALAERKFGQGK
XYLR_CALSR      ---------------------------------QDVPLKRMVESRFGLPVYIDNEANAGALGEKWFGGWG
Y188_CLOPE      LKINNISGICVSTAGMVCPKEGIVYAGPTIPNYTGVEVKKILEEEFNLPCFVENDVNCAALGEFFGGAGK
MAK_ECOLI       -------TVGMGIPGSISPYTGVV-KNANSTWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDGAAA
NANK_HAEIG      --------VAVASTGIIN--NGILSALKNLGGLAEFPLKASIAKHTDKPIGLLNDAQAATYAEYQLQNSE
NANK_HAEIN      --------VAVASTGIIN--NGILSALKNLGGLAEFPLKASIAKHTDKPIGLLNDAQAATYAEYQLQNSE
NANK_HAEIE      --------VAVASTGIIN--NGILSALKNLGGLAEFPLKASIAKHTDKPIGLLNDAQAATYAEYQLQNSE
NANK_HAEI8      --------VAVASTGIIN--NGILSALKNLGGLAEFPLKASIAKHTDKPIGLLNDAQAATYAEYQLQNFE
XYLR_LACPE      HAIHGLLGICFSIHGIIN-DNQIVHSP--WIDMHDIDIVKQFKAEFDVPVILENEANLSAIYERDFNAGL
Y495_MYCBO      XXXXXALWVGVTLGGAVDSATGHVDRLGW----RQAPVGPVLADALGLPVSVASHVDAMAGAELMLGMRR
Y485_MYCTU      XXXXXALWVGVTLGGAVDSATGHVDRLGW----RQAPVGPVLADALGLPVSVASHVDAMAGAELMLGMRR
NANK_VIBVU      AWLSDVDAIGISTTGLV-SEQGISAINPTLSFPTPFPLHSELHRLSGKPVKMLNDAQAAAWYEFLLSPEL
NANK_VIBVY      ------------------------------------PLHSELHRLSGKPVKMLNDAQAAAWYEFLLSPEL
NANK_ECOK1      ----------------------------------------------------------------------
NANK_ECO45      ----------------------------------------------------------------------
NAGK_ECO24      -------SVGIGIPGMPETEDGTLYAANV-PAASGQPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_SHIDS      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECOSM      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECOSE      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECOLU      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECOLI      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECOLC      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECOHS      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECODH      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECOBW      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECO8A      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECO7I      -------SVGIGIPGMPETEDGTLYASNV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECO5E      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECO57      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECO55      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NANK_VIBCM      ------------------------------------PLAQTLEQLTNKPVSILNDAQAAAWFEFV-QLKN
NANK_VIBCH      ------------------------------------PLAQTLEQLTNKPVSILNDAQAAAWFEFV-QLKN
NANK_VIBC3      ------------------------------------PLAQTLEQLTNKPVSILNDAQAAAWFEFV-QLKN
NANK_ECOL5      ----------------------------------------------------------------------
NANK1_ECOL6     ----------------------------------------------------------------------
NANK_YERPY      --------IAVASTGIISGGRLTALNPANLGGLADFPLYDCIRSISDLPCVLLNDGQAAAWAE--YQALG
NANK_YERPS      --------IAVASTGIISGGRLTALNPANLGGLADFPLYDCIRSISDLPCVLLNDGQAAAWAE--YQALG
NANK_YERPP      --------IAVASTGIISGGRLTALNPANLGGLADFPLYDCIRSISDLPCVLLNDGQAAAWAE--YQALG
NANK_YERPN      --------IAVASTGIISGGRLTALNPANLGGLADFPLYDCIRSISDLPCVLLNDGQAAAWAE--YQALG
NANK_YERPG      --------IAVASTGIISGGRLTALNPANLGGLADFPLYDCIRSISDLPCVLLNDGQAAAWAE--YQALG
NANK_YERPE      --------IAVASTGIISGGRLTALNPANLGGLADFPLYDCIRSISDLPCVLLNDGQAAAWAE--YQALG
NANK_YERPB      --------IAVASTGIISGGRLTALNPANLGGLADFPLYDCIRSISDLPCVLLNDGQAAAWAE--YQALG
NANK_YERPA      --------IAVASTGIISGGRLTALNPANLGGLADFPLYDCIRSISDLPCVLLNDGQAAAWAE--YQALG
NANK_YERP3      --------IAVASTGIISGGRLTALNPANLGGLADFPLYDCIRSISDLPCVLLNDGQAAAWAE--YQALG
NAGK_MANSM      QKFACKGSVGLGLPGFVNHETGIAE-ITNIRVADNKPIIKDLSERLGREVRAENDANCFALSEA-WDEEN
NAGK_ECOUT      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECOL5      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECOK1      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECO81      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECO45      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_ECO27      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
ALSK_ECOLI      -------------------------------------LADKLENTLNCPVEFSRDVNSWDVVENRLTQQL
NAGK_SHIFL      ----------------------------------------------------------------------
NAGK_SHIF8      ----------------------------------------------------------------------
NAGK_ECOL6      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_PASMU      -------TVGLGIPGFVNPATGIAE-IVNIRAADHKPIIQDLETRLGREVRAENDANCFALSEA-WDEEN
NAGK_HAES1      EKFACKGTVGIGVPGFVNQETGIAE-ITNIRVADNKPILKDLSERLGREVRAENDANCFALSEA-WDKDN
SCRK_PEDPE      -----VDAIGIGSFGPI----GVNPHDPKYGYITTTPKGDFLKSQFNIPLYWTTDVNEAAYGESMIGIAK
NANK_PASMU      ----------------------------------EFPLKESIARHTDKPIGLLNDVQAAACAEYKDEDKN
NAGK_VIBCH      -------TVGLGIPGMEDADNGCVLTVNV-PAAKGKPLRADLETKLGRAVKVENDANCFALSEAWDDELK
NAGK_ESCF3      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_CITK8      ----------------------------------------------------------------------
CAPP_STRMU      ESISDMFELAIMLKGLVDTDKARVQIVPLFETIEDLDNSREIMRQ-----YLNYDI-----VKKWIAANH
NAGK_SHISS      -------SVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
NAGK_HAEI8      EKFGEVGTVGLGVPGFVNQQTGLAE-ITNIRVADNKPILRDLSVRLGREVRAENDANCFALSEA-WDTEN
NANK_SHIB3      ----------------------------------------------------------------------
NAGK_SALPB      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSVLELTQL
MLC_ECOLI       GARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQL
NAGC_SHIFL      DCEDSILVRVHRGTGAGIISNGRIFIGRNGNVGEIGHIQVEPLGERCHCGNFGCLETIAANAAIEQRVLN
NAGC_ECOLI      DCEDSILVRVHRGTGAGIISNGRIFIGRNGNVGEIGHIQVEPLGERCHCGNFGCLETIAANAAIEQRVLN
NAGC_ECOL6      DCEDSILVRVHRGTGAGIISNGRIFIGRNGNVGEIGHIQVEPLGERCHCGNFGCLETIAANAAIEQRVLN
NAGC_ECO57      DCEDSILVRVHRGTGAGIISNGRIFIGRNGNVGEIGHIQVEPLGERCHCGNFGCLETIAANAAIEQRVLN
XYLR_ANATD      KVSDLIYLSVGIGLGAGIIIDNKLFRGAAGFAGEVGHTTINFQDDVCSCGNIGCLENFASERALLSVIKK
XYLR2_BACSU     NHNNIIYASISTXXXXXXXXNNHLYRGVSGFSGEMGHMTIDFNGPKCSCGNRGCWELYASEKALLKSLQT
XYLR1_BACSU     NHDNXXXXXXXXXXXXXXXXNNHLYRGVSGFSGEMGHMTIDFNGPKCSCGNRGCWELYASEKALLKSLQT
GLK_BACSU       GAKDXXXXXXXXXXXXXXXANGEIVHGINGAGGEIGHISIPEGGAPCNCGKTGCIETIASATGIVRIAKE
GLK_BACHD       GAKNMXXXXXXXXXXXXXXXXXXXXHGVNGMAGEIGHITVIPEGGACNCGKTGCLETVASATGIARIATE
GLK_STAXY       GADDVVAXXXXXXXXXXXXSNGEIVHGHNGSGAEIGHFRVDHDQRKCNCGKSGCIETVASATGVVNLVKL
YPHH_ECOLI      -ERDFCVINVDYGIGSSFVINEQIYRGSLYGSGQIGHTIVNPDGVVCDCGRYGCLETVASLSALKKQARV
GLK_STRLI       GHRNVICXXXXXXXXXXXXXXNKLRRGHFGVAAEFGHIRMVPDGLLCGCGSQGCWEQYASGRALVRYAKQ
GLK_STRCO       GHRNVICXXXXXXXXXXXXXXNKLRRGHFGVAAEFGHIRMVPDGLLCGCGSQGCWEQYASGRALVRYAKQ
GLCNE_CRIGR     GQENFVTLXXXXXXXXXXXHQHELIHGSSFCAAELGHLVVSLDGPDCSCGSHGCIEAYAS-GMALQREAK
GLCNE_RAT       GQENFVTLXXXXXXXXXXXHQHELIHGSSFCAAELGHLVVSLDGPDCSCGSHGCIEAYAS-GMALQREAK
GLCNE_MOUSE     GQENFVTLXXXXXXXXXXXHQHELIHGSSFCAAELGHLVVSLDGPDCSCGSHGCIEAYAS-GMALQREAK
GLCNE_HUMAN     GLENFVTLXXXXXXXXXXXHQHELIHGSSFCAAELGHLVVSLDGPDCSCGSHGCIEAYAS-GMALQREAK
XYLR_CALSR      DVSHLLYXXXXXXXXXXXXXXXXXYRGAKGFAGEVGHMTIDFNDDVCSCGNVGCLENFASERALLSLIKT
Y188_CLOPE      GTHSMACXXXXXXXXXXXXXDGKVLHGFSNSAGEIGYMMVN--------GEH--IQDIASASALVKNVAL
MAK_ECOLI       GAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLDELRYRCYCGKQGCIETFIS-GTGFAMDYR
NANK_HAEIG      QVSNXXXXXXXXXXXXXXXLN-QILQTGSRGIAHIGHTLADPNGAICGCGRRGCVEAIASGRAI------
NANK_HAEIN      QVSNXXXXXXXXXXXXXXXLN-QILQTGSRGIAHIGHTLADPNGAICGCGRRGCVEAIASGRAI------
NANK_HAEIE      QVSNXXXXXXXXXXXXXXXLN-QILQTGSRGIAHIGHTLADPNGAICGCGRRGCVEAIASGRAI------
NANK_HAEI8      QVSNXXXXXXXXXXXXXXXLN-QILQTGSRGIAHIGHTLADPNGAICGCGRRGCVEAIASGRAI------
XYLR_LACPE      DYRNSITLSIHRGIGAGIILDKHLFRGKQGEAGEVGRTLLGPNTA------GQSVESICSEEAIINRVK-
Y495_MYCBO      FAPSSLYVYARETVGYALMIGGHCPASGPGTIAPLPHSEM--------LGGTGQLESTVSDEAVXXXXXX
Y485_MYCTU      FAPSSLYVYARETVGYALMIGGHCPASGPGTIAPLPHSEM--------LGGTGQLESTVSDEAVXXXXXX
NANK_VIBVU      DVRNMAYITVSTGVGGGLVINQQL-HKGKSNFAHIGHTVLDPNGPLCGCQQRGCVE--------------
NANK_VIBVY      DVRNMAYITVSTGVGGGLVINQQL-HKGKSNFAHIGHTVLDPNGPLCGCQQRGCVE--------------
NANK_ECOK1      ------------------------LRTGPGGLAHIGHTLADPHGPACGCGRTGCVEAIASGRGIATAAQG
NANK_ECO45      ------------------------LRTGPGGLAHIGHTLADPHGPACGCGRTGCVEAIASGRGIATAAQG
NAGK_ECO24      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_SHIDS      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECOSM      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECOSE      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECOLU      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECOLI      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECOLC      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECOHS      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECODH      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECOBW      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECO8A      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECO7I      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECO5E      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECO57      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECO55      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NANK_VIBCM      PSLNMAFXXXXXXXXXXXXXDGKL-HKGNSGLAHIGHMSVAIEGPLCGCGQRGCVESMASGNAIQKESEA
NANK_VIBCH      PSLNMAFXXXXXXXXXXXXXDGKL-HKGNSGLAHIGHMSVAIEGPLCGCGQRGCVESMASGNAIQKESEA
NANK_VIBC3      PSLNMAFXXXXXXXXXXXXXDGKL-HKGNSGLAHIGHMSVAIEGPLCGCGQRGCVESMASGNAIQKESEA
NANK_ECOL5      ------------------------LRTGPGGLAHIGHTLADPHGPVCGCGRTGCVEAIASGRGIATAAQG
NANK1_ECOL6     ------------------------LRTGPGGLAHIGHTLADPHGPVCGCGRTGCVEAIASGRGIATAAQG
NANK_YERPY      DKNDNMMFXXXXXXXXXXIILNKKLLVGQRGLAHIGHTLSDPHGVLXXXXXXXXVESVASGTAI------
NANK_YERPS      DKNDNMMFXXXXXXXXXXIILNKKLLVGQRGLAHIGHTLSDPHGVLXXXXXXXXVESVASGTAI------
NANK_YERPP      DKNDNMMFXXXXXXXXXXIILNKKLLVGQRGLAHIGHTLSDPHGVLXXXXXXXXVESVASGTAI------
NANK_YERPN      DKNDNMMFXXXXXXXXXXIILNKKLLVGQRGLAHIGHTLSDPHGVLXXXXXXXXVESVASGTAI------
NANK_YERPG      DKNDNMMFXXXXXXXXXXIILNKKLLVGQRGLAHIGHTLSDPHGVLXXXXXXXXVESVASGTAI------
NANK_YERPE      DKNDNMMFXXXXXXXXXXIILNKKLLVGQRGLAHIGHTLSDPHGVLXXXXXXXXVESVASGTAI------
NANK_YERPB      DKNDNMMFXXXXXXXXXXIILNKKLLVGQRGLAHIGHTLSDPHGVLXXXXXXXXVESVASGTAI------
NANK_YERPA      DKNDNMMFXXXXXXXXXXIILNKKLLVGQRGLAHIGHTLSDPHGVLXXXXXXXXVESVASGTAI------
NANK_YERP3      DKNDNMMFXXXXXXXXXXIILNKKLLVGQRGLAHIGHTLSDPHGVLXXXXXXXXVESVASGTAI------
NAGK_MANSM      QQYPFVXXXXXXXXXXXXXXXXXKVHSGQIGMAELGHLQLNYHALKCGCGNRACLDTYLSG---------
NAGK_ECOUT      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECOL5      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECOK1      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECO81      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECO45      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECO27      QYSXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQHGCIENYLSGRGFAWLYQ-
ALSK_ECOLI      ----VLAAYLGTGMGFAVWMNGAPWTGAHGVAGELGHIPLGDMTQHCACGNPGCLETNCS--------GM
NAGK_SHIFL      --------------------------------------------RRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_SHIF8      --------------------------------------------RRCGCGQHGCIENYLSGRGFAWLYQ-
NAGK_ECOL6      QYPXXXXXXXXXXXXXXXXFNGRPITGKSYITGEFGHMRLDFPLRRCGCGQYGCIENYLSGRGFAWLYQ-
NAGK_PASMU      AQYPSVXXXXXXXXXXXXXXXXXKVHSGQTGMAEVGHTQLNYHALRCGCGNRACLDTYLSG---------
NAGK_HAES1      QQYPXXXXXXXXXXXXXXXXXXXXXHSGQSGMAELGHLQLNYHALKCGCGNKACLDTYLSG---------
SCRK_PEDPE      DVPNSIYMTIGTGVGAGVISQNHIFNGRTHT--ELGHMRLNRLDFKSNCPYHDCLEGLAAGPAV------
NANK_PASMU      AVQNXXXXXXXXXXXXXXXLERRLLTEPNGVAGHIGHTLADPNGPXXXXXXXXXXXXXXXXXXI------
NAGK_VIBCH      EAASVMXXXXXXXXXXXXXXXXKVFSGRNHVAGEIGHMRIDAWGEKCGCGNKGCMDNYLSG---------
NAGK_ESCF3      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQIGCIENYLSGRGFAWLWQ-
NAGK_CITK8      --------------------------------------------RRCGCGQLGCIENYLSGRGFAWLYQ-
CAPP_STRMU      NYQEIMLGYSDSNKDGGYLSSGWALYKAQNELTEIGY---------------------------------
NAGK_SHISS      QYPXXXXXXXXXXXXXXXXFNGKPITGKSYITGEFGHMRLDFPLRRCGCGQIGCIENYLSGRGFAWLWQ-
NAGK_HAEI8      QQYPXXXXXXXXXXXXXXXXXXXKVHSGQVGMAELGHLQLNYHALKCGCGNKACLDNYLSG---------
NANK_SHIB3      ------------------------LLTGPSGLAHIGHTLADPHGPVCGCGRTGCVEXXXXXXXXXXXXQ-
NAGK_SALPB      --------------------------------------------RRCGCGQMGCIENYLSGRGFAWLYQH


                         .         *         .         .         .         .         +:350
query           RLNQSMSSMLHGQPLTVDSLCQAAMQGDLLAKDIISGVGTHVGRILAIMVNLFNPQKILIGSPLSKAADI
MLC_ECOLI       RLNQSMSSMLHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADI
NAGC_SHIFL      LLKQGYQSRVPLDDCTIKTICKAANKGDSLASEVIEYVGRHLGKTIAIAINLFNPQKIVIAGEITEADKV
NAGC_ECOLI      LLKQGYQSRVPLDDCTIKTICKAANKGDSLASEVIEYVGRHLGKTIAIAINLFNPQKIVIAGEITEADKV
NAGC_ECOL6      LLKQGYQSRVPLDDCTIKTICKAANKGDSLASEVIEYVGRHLGKTIAIAINLFNPQKIVIAGEITEADKV
NAGC_ECO57      LLKQGYQSRVPLDDCTIKTICKAANKGDSLASEVIEYVGRHLGKTIAIAINLFNPQKIVIAGEITEADKV
XYLR_ANATD      LVKQGVESWENVDEITPSRIIQAAKEGSRVCRMAILEVAEKMGIGVANLVNIFNPEMVIIGNKASFFGEL
XYLR2_BACSU     K----------EKKVSYQDIIDLAHLNDIGTLNALQNFGFYLGIGLTNILNTFNPQAIILRNSIIESHPM
XYLR1_BACSU     K----------EKKLSYQDIINLAHLNDIGTLNALQNFGFYLGIGLTNILNTFNPQAVILRNSIIES---
GLK_BACSU       KINAKKTTRLKAEQLSARDVFEAAGENDEIALEVVDYVAKHLGLVLGNLASSLNPSKIVLGGGVSRAGEL
GLK_BACHD       GVTEHKESQLHGV-LTAKXXXXXXXXXXXXXXXXXXHIAYYLGFAIANLANALNPEKIVIGGGVSKAGDT
GLK_STAXY       TFKSSILQLIKDNKVSAKAVFDAAKAGDQFCIFITERVANYIAYLCSIVSVTSNPKYIVLGGGMSTAGLI
YPHH_ECOLI      WLSQPVSTQLDPEKLTTAQLIAAWQSGEPWITSWVDRSANAIGLSLYNFLNILNINQI------------
GLK_STRLI       RANEVLLALGDGTPDGIEGISVAARQGCPVAVDSYRELARWAGAGLADLASLFDPSAFIVGGGLSDEGDL
GLK_STRCO       RANEVLLALGDGTPDGIEGISVAARQGCPVAVDSYRELARWAGAGLADLASLFDPSAFIVGGGLSDEGDL
GLCNE_CRIGR     KLHDEDLLLVEGEPVGALHLIQAAKLGNVKAQNILRTAGTALGLGVVNILHTMDPSLVILSGVL---ASH
GLCNE_RAT       KLHDEDLLLVEGMSVPKDELIQAAKLGNVKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVLA-----
GLCNE_MOUSE     KLHDEDLLLVEGMSVPKDELIQAAKLGNVKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVLA-----
GLCNE_HUMAN     KLHDEDLLLVEGMSVPKDELIQAAKLGNAKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVLA-----
XYLR_CALSR      LVESGVEDEYINEEMDAGYIIQSALQRSRVAMNAITDIANKLGIGIANLVNIFNPDIVVIGNKASFMGDL
Y188_CLOPE      RKGVEPSS-IDGR-YVLDNY----ENGDLICKEEVEKLADNLALGISNIVYLINPEVVVLGGGIMAREEV
MAK_ECOLI       RLS--------GHALKGSEIIRLVEESDPVXXXXXXXXXXXXXKSLAHVVNILDPDVIVLGGGMSN-VDR
NANK_HAEIG      ---EAVSSQWE-EPCDPKEVFERFRKNDEKATALVERSAKAIANLIADLVISLDIQKIAIGGSVGLAEGY
NANK_HAEIN      ---EAVSSQWE-EPCDPKEVFERFRKNDEKATALVERSAKAIANLIADLVISLDIQKIAIGGSVGLAEGY
NANK_HAEIE      ---EAVSSQWE-DPCDPKEVFERFRKNDEKATALVERSAKAIANLIADLVISLDIQKIAIGGSVGLAEGY
NANK_HAEI8      ---EAVSSQWE-DPCDPKEVFERFRKNDEKATALVERSAKAIANLIADLVISLDIQKIAIGGSVGLAEGY
XYLR_LACPE      RIKQD-------ETTNRQTVVQLYQQHDREVERILSQSCSVIAGLIYNVVTTLNPDAIFINSELLAETPE
Y495_MYCBO      XXXXASRTRTGGSATAITDLLRVARAGNQQAKELLAERARVLGGAVALLRDLLNPDEVVVGG----QAFT
Y485_MYCTU      XXXXASRTRTGGSATAITDLLRVARAGNQQAKELLAERARVLGGAVALLRDLLNPDEVVVGG----QAFT
NANK_VIBVU      ----------------------------------------------------------------------
NANK_VIBVY      ----------------------------------------------------------------------
NANK_ECOK1      ELAGA----------NAKTIFTRAGQGDEQAQQLIHRSARTLARLIADIKATTDCQCVVVGGSVGLAEGY
NANK_ECO45      ELAGA----------NAKTIFTRAGQGDEQAQQLIHRSARTLARLIADIKATTDCQCVVVGGSVGLAEGY
NAGK_ECO24      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_SHIDS      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECOSM      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECOSE      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECOLU      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECOLI      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECOLC      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECOHS      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECODH      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECOBW      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECO8A      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECO7I      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECO5E      --------HYYHQPLPAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECO57      --------HYYHQPLPAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECO55      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NANK_VIBCM      TFTETMSNV-------------------------------------------------------------
NANK_VIBCH      TFTETMSNV-------------------------------------------------------------
NANK_VIBC3      TFTETMSNV-------------------------------------------------------------
NANK_ECOL5      ELAGA----------NAKTIFTRAGQGDEQAQQLIHRSARTLARLIADIKATTDCQCVVVGGSVGLAEGY
NANK1_ECOL6     ELAGA----------NAKTIFTRAGQGDEQAQQLIHRSARTLARLIADIKATTDCQCVVVGGSVGLAEGY
NANK_YERPY      ----GAETLGWKQPVSAATVFDMAQQGDAQAGKVINRSAAAIAQMLADMKMALDLEVVILGGSVGLAVGY
NANK_YERPS      ----GAETLGWKQPVSAATVFDMAQQGDAQAGKVINRSAAAIAQMLADMKMALDLEVVILGGSVGLAVGY
NANK_YERPP      ----GAETLGWKQPVSAATVFDMAQQGDAQAGKVINRSAAAIAQMLADMKMALDLEVVILGGSVGLAVGY
NANK_YERPN      ----GAETLGWKQPVSAATVFDMAQQGDAQAGKVINRSAAAIAQMLADMKMALDLEVVILGGSVGLAVGY
NANK_YERPG      ----GAETLGWKQPVSAATVFDMAQQGDAQAGKVINRSAAAIAQMLADMKMALDLEVVILGGSVGLAVGY
NANK_YERPE      ----GAETLGWKQPVSAATVFDMAQQGDAQAGKVINRSAAAIAQMLADMKMALDLEVVILGGSVGLAVGY
NANK_YERPB      ----GAETLGWKQPVSAATVFDMAQQGDAQAGKVINRSAAAIAQMLADMKMALDLEVVILGGSVGLAVGY
NANK_YERPA      ----GAETLGWKQPVSAATVFDMAQQGDAQAGKVINRSAAAIAQMLADMKMALDLEVVILGGSVGLAVGY
NANK_YERP3      ----GAETLGWKQPVSAATVFDMAQQGDAQAGKVINRSAAAIAQMLADMKMALDLEVVILGGSVGLAVGY
NAGK_MANSM      RGFEMLYRDLKGEALSAKEIIERFYAADKTAVDFVGLFIELCAISLGNIITALDPHVIVLGGGLSN-FDY
NAGK_ECOUT      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECOL5      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECOK1      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECO81      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECO45      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_ECO27      --------HYYHQPLQAPEIIAFYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
ALSK_ECOLI      ALRRWYEQQPRNYPLR-DLFVHAE------NAPFVQSLLENAARAIATSINLFDPDAVILGGGV------
NAGK_SHIFL      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVSLGNILTIVDPDLVVIGGGLSN----
NAGK_SHIF8      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVSLGNILTIVDPDLVVIGGGLSN----
NAGK_ECOL6      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSN----
NAGK_PASMU      RGFEMLYRDMQGEALSAQAIIQRFYAGDQSAVKFVELFIELCAISIGNLITVLDPHVIVLGGGLS-----
NAGK_HAES1      RGFEMLYRDLQGKALSAKEIIRCFYDKDESAVKFVELFIELCAISIGNIITALDPHVIILGGGLSN-FDY
SCRK_PEDPE      ----------------------------------------------------------------------
NANK_PASMU      ---EAVSSQWN-PPCTPKQAFELFRKNDEKATALIQRSASAIANLIADLVIGLDVQKVVVGGSVGLAEGY
NAGK_VIBCH      RGFELLYEHYYGEKKKAIDIITAQKEGESKAVE-------HVERFMELLANIFDPHVVVLGGGLSN-YDL
NAGK_ESCF3      --------HYYHQPLQAPEIIALWEEGDERAQAHVDRYLDLLAVCLGNILTIVDPDLVVIGGGLSNFTAI
NAGK_CITK8      --------HYYHQPLQAPEIIALWEQGDERARAHVERYLDLLAVCLGNILTIVDPDLVVIGGGLSNFTAI
CAPP_STRMU      ----------------------------------------------------------------------
NAGK_SHISS      --------HYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDSDLVVIGGGLSN----
NAGK_HAEI8      RGFEMLYRDLKGETLSAREIIDLFYQGNESAVDFVNLFVELAAISIGNIITAFDPHMIVLGGGLSN-FDY
NANK_SHIB3      -----------GELMGADTIFTRAGQGDEQAQQLIHRSAHVLARLIADIKATTDCQCVVVGGSVGLAEGY
NAGK_SALPB      YYDQSLQA-----PEIIALWEQGDEQAQAHVERYLNLLAVCLGNILTIV----DPDLLVIGGGLSNFTAI


                         .         .         .         .         *         .         .:420
query           LFPAIADSIRQQALPAYSRNTVVESTQFTNQGTMAGAALVKDAMYNGSLLIRLLQG
MLC_ECOLI       LFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG
NAGC_SHIFL      LLPAIESCINTQALKAFRTNLPVVRSELDHRSAIGAFALVKRAMLNGILLQHLLE-
NAGC_ECOLI      LLPAIESCINTQALKAFRTNLPVVRSELDHRSAIGAFALVKRAMLNGILLQHLLE-
NAGC_ECOL6      LLPAIESCINTQALKAFRTNLPVVRSELDHRSAIGAFALVKRAMLNGILLQHLLE-
NAGC_ECO57      LLPAIESCINTQALKAFRTNLPVVRSELDHRSAIGAFALVKRAMLNGILLQHLLE-
XYLR_ANATD      FLEKLREVINQRSFIAQFYNLKIEVSKLKDRAVVLGAMVISDML------------
XYLR2_BACSU     VLNSIRSEVSSRVYP-----------------------------------------
XYLR1_BACSU     -HPMVLNSMRSE--------------------------------------------
GLK_BACSU       LRSKVEKTFRKCAFPRXXXXXXXXXXXLGNDGVIGGAWIAKN--------------
GLK_BACHD       LLKPIKQHFEAYALPRVADGAEFRATLGNDAGVIGGGWLVK---------------
GLK_STAXY       LIENIKTEYHNLTFTPAQQNTEIVQAQLGNDAGITGAA------------------
YPHH_ECOLI      --------------------------------------------------------
GLK_STRLI       VLDPIRKSYKRWLVGGNWRPVAVIAAQLGNKAGLVGAA------------------
GLK_STRCO       VLDPIRKSYKRWLVGGNWRPVAVIAAQLGNKAGLVGAA------------------
GLCNE_CRIGR     YIHIVKDVIRQQA-------------------------------------------
GLCNE_RAT       --------------------------------------------------------
GLCNE_MOUSE     --------------------------------------------------------
GLCNE_HUMAN     --------------------------------------------------------
XYLR_CALSR      FLEELRRIVYKRAFITQYHHVRVEVSKLKDRACVLGAMVISDML------------
Y188_CLOPE      FRPLIENSLRKYLIESVYNNTKIAFAKLKNTAGMKGA-------------------
MAK_ECOLI       LYQTVGQLIKQ---------------------------------------------
NANK_HAEIG      L--PLVEKYLQDFPSIYC--CEIESAKFGQDAGLIGAAYVKDVL------------
NANK_HAEIN      L--SLVEKYLQDFPSIYC--CEIETAKFGQDAGLIGAAYVKDVL------------
NANK_HAEIE      L--SLVEKYLQDFPSIYC--CEIETAKFGQDAGLIGAAYVKDVL------------
NANK_HAEI8      L--SLVEKYLQDFPSIYC--CEIETAKFGQDAGLIGAAYVKDVL------------
XYLR_LACPE      LLGDIQDNYRQDQLPI----TLTKNTQFAT--SLGGCSLI----------------
Y495_MYCBO      EYP----EAMEQVEAAFTAGSVIRVTVFGNRVQEAGAGIV----------------
Y485_MYCTU      EYP----EAMEQVEAAFTAGSVIRVTVFGNRVQEAGAGIV----------------
NANK_VIBVU      --------------------------------------------------------
NANK_VIBVY      --------------------------------------------------------
NANK_ECOK1      L-------------------------------------------------------
NANK_ECO45      L-------------------------------------------------------
NAGK_ECO24      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_SHIDS      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECOSM      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECOSE      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECOLU      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECOLI      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECOLC      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECOHS      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECODH      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECOBW      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECO8A      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECO7I      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECO5E      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECO57      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECO55      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NANK_VIBCM      --------------------------------------------------------
NANK_VIBCH      --------------------------------------------------------
NANK_VIBC3      --------------------------------------------------------
NANK_ECOL5      L-------------------------------------------------------
NANK1_ECOL6     L-------------------------------------------------------
NANK_YERPY      LERVVA---AQKTLPGIYRVPVQEAHHRQDSG-LLGAAL-----------------
NANK_YERPS      LERVVA---AQKTLPGIYRVPVQEAHHRQDSG-LLGAAL-----------------
NANK_YERPP      LERVVA---AQKTLPGIYRVPVQEAHHRQDSG-LLGAAL-----------------
NANK_YERPN      LERVVA---AQKTLPGIYRVPVQEAHHRQDSG-LLGAAL-----------------
NANK_YERPG      LERVVA---AQKTLPGIYRVPVQEAHHRQDSG-LLGAAL-----------------
NANK_YERPE      LERVVA---AQKTLPGIYRVPVQEAHHRQDSG-LLGAAL-----------------
NANK_YERPB      LERVVA---AQKTLPGIYRVPVQEAHHRQDSG-LLGAAL-----------------
NANK_YERPA      LERVVA---AQKTLPGIYRVPVQEAHHRQDSG-LLGAAL-----------------
NANK_YERP3      LERVVA---AQKTLPGIYRVPVQEAHHRQDSG-LLGAAL-----------------
NAGK_MANSM      LYEALPKALPKHLMRS-AKVPVIKKAKYGDSGGVRGAA------------------
NAGK_ECOUT      -FPAIAERLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECOL5      -FPAIAERLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECOK1      -FPAIAERLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECO81      -FPAIAERLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECO45      -FPAIAERLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECO27      -FPAIAERLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
ALSK_ECOLI      -----------MDMPAFPRETLVAMTQ-----------------------------
NAGK_SHIFL      -FPAIADRLPCHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_SHIF8      -FPAIADRLPCHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_ECOL6      -FPAIAERLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_PASMU      --------------------------------------------------------
NAGK_HAES1      LYEALPKALPQH-LMRTAKVPLIKKAKFGDSGGVRGAA------------------
SCRK_PEDPE      --------------------------------------------------------
NANK_PASMU      L-PLVKQYLNM--MPHFYHCTVEQARHGQDAGLLGAAWWVADCLKQG---------
NAGK_VIBCH      IYEEMPKRVPKHLLSVAKCPKIVKA-KHGDSGGVRGAAFL----------------
NAGK_ESCF3      T-TQLADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_CITK8      T-TQLADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
CAPP_STRMU      --------------------------------------------------------
NAGK_SHISS      -FPAIADRLPRHLLPV-ARVPRIERARHGDAGGMRGAAFL----------------
NAGK_HAEI8      LYEAL-----PKALPPHLMRTAIKKAKHGDSGGVRGAA------------------
NANK_SHIB3      L-------------------------------------------------------
NAGK_SALPB      T-TQLAERLPRHLLPV-ARAPRIERARHGDAGGMRGAAFL----------------