[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF68005.1

[Show Plain Result]


## Summary of Sequence Search
    1::166
    1::166     7e-98 100%  166 aa  NUOE_SALTY RecName: Full=NADH-quinone oxidoreductase subunit E;    
    1::166     7e-98 100%  166 aa  NUOE_SALTI RecName: Full=NADH-quinone oxidoreductase subunit E;    
    1::166     6e-95  97%  166 aa  NUOE_SHIFL RecName: Full=NADH-quinone oxidoreductase subunit E;    
    1::166     6e-95  97%  166 aa  NUOE_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit E;    
    1::166     6e-95  97%  166 aa  NUOE_ECOL6 RecName: Full=NADH-quinone oxidoreductase subunit E;    
    1::165     2e-66  69%  166 aa  NUOE_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit E;    
    8::162     5e-61  72%  162 aa  NUOE_BUCAI RecName: Full=NADH-quinone oxidoreductase subunit E;    
   14::168     4e-51  61%  168 aa  NUOE_BUCAP RecName: Full=NADH-quinone oxidoreductase subunit E;    
   17::171     9e-43  50%  171 aa  NUOE_BUCBP RecName: Full=NADH-quinone oxidoreductase subunit E;    
    4::151     7e-26  37%  168 aa  NUOE2_RHIME RecName: Full=NADH-quinone oxidoreductase subunit E 2; 
    6::159     1e-25  33%  160 aa  NUOE_AQUAE RecName: Full=NADH-quinone oxidoreductase subunit E;    
   42::198     4e-25  35%  239 aa  NDUV2_CAEEL RecName: Full=Probable NADH dehydrogenase [ubiquinone]
   52::208     1e-24  37%  248 aa  NDUV2_RAT RecName: Full=NADH dehydrogenase [ubiquinone]
   68::209     2e-24  37%  249 aa  NDUV2_BOVIN RecName: Full=NADH dehydrogenase [ubiquinone]
   76::208     9e-24  38%  248 aa  NDUV2_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone]
   68::209     1e-23  37%  249 aa  NDUV2_PONAB RecName: Full=NADH dehydrogenase [ubiquinone]
   68::209     1e-23  37%  249 aa  NDUV2_PANTR RecName: Full=NADH dehydrogenase [ubiquinone]
   68::209     1e-23  37%  249 aa  NDUV2_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone]
   68::209     1e-23  37%  249 aa  NDUV2_GORGO RecName: Full=NADH dehydrogenase [ubiquinone]
   23::165     1e-19  32%  167 aa  NUOE_RICBR RecName: Full=NADH-quinone oxidoreductase subunit E;    
   20::161     1e-19  35%  167 aa  NUOE_RICFE RecName: Full=NADH-quinone oxidoreductase subunit E;    
   61::219     1e-19  34%  263 aa  NDUV2_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase 24 kDa
   25::166     4e-19  34%  177 aa  NUOE_RICPR RecName: Full=NADH-quinone oxidoreductase subunit E;    
   12::149     4e-19  33%  602 aa  HOXF_RALEH RecName: Full=NAD-reducing hydrogenase hoxS subunit
   25::166     7e-19  35%  170 aa  NUOE_RICTY RecName: Full=NADH-quinone oxidoreductase subunit E;    
   23::163     4e-18  32%  167 aa  NUOE_RICCN RecName: Full=NADH-quinone oxidoreductase subunit E;    
   12::173     7e-18  32%  275 aa  NUOE1_RHIME RecName: Full=NADH-quinone oxidoreductase subunit E 1; 
   51::185     2e-17  30%  252 aa  NUOE_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit E;    
   51::185     2e-17  30%  252 aa  NUOE_MYCBO RecName: Full=NADH-quinone oxidoreductase subunit E;    
    9::169     2e-17  33%  239 aa  NQO2_PARDE RecName: Full=NADH-quinone oxidoreductase chain 2;      
   17::141     3e-17  32%  181 aa  NQO2_THET8 RecName: Full=NADH-quinone oxidoreductase subunit 2;    
   47::214     5e-17  32%  255 aa  NDUV2_ARATH RecName: Full=NADH-ubiquinone oxidoreductase 24 kDa
   75::209     8e-17  32%  247 aa  NDUV2_DICDI RecName: Full=NADH dehydrogenase [ubiquinone]
   29::155     7e-10  34%  162 aa  NDUV2_SCHPO RecName: Full=NADH-ubiquinone oxidoreductase 24 kDa
    2::70      7e-05  36%   75 aa  Y1420_THEMA RecName: Full=Protein TM_1420;
    1::166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVE
NUOE_SALTY      MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVE
NUOE_SALTI      MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVE
NUOE_SHIFL      MHENQQPQTEAFELSAAEREAIEHEMHHYEDPRAASIEALKIVQKQRGWVPDGAIHAIADVLGIPASDVE
NUOE_ECOLI      MHENQQPQTEAFELSAAEREAIEHEMHHYEDPRAASIEALKIVQKQRGWVPDGAIHAIADVLGIPASDVE
NUOE_ECOL6      MHENQQPQTEAFELSAAEREAIEHEMHHYEDPRAASIEALKIVQKQRGWVPDGAIHAIADVLGIPASDVE
NUOE_PSEAE      MSQSNLIQTDRFVLSETERSSIEHEMHHYEDPRAASIEALKIVQKQRGWVPDGAIPAIGEVLGIPASDVE
NUOE_BUCAI      -----------FKLTNEEINAIENQKKYYEDFRAISIEALKIVQKKRGWVSDQAIYAIAEILHINPSDVE
NUOE_BUCAP      -----------FTLTTFEINEIEKQKKYYENSRSVSIEALKIVQKKRGWVCDQXXXXXXXXXXXXPSEVE
NUOE_BUCBP      -----------FKLTIQEKIEIFNIIKNYRTVRSSLIEILKFVQKSYGWISNELITELACILKISKCDIE
NUOE2_RHIME     ------------------REEIEAAAARYPDRRSAIMPALMIAQKEHGHLPGPVLEEVAQILGVERVWVY
NUOE_AQUAE      -----------FEFPEELKTKLQEHINYFPKKRQAILLCLHEIQNYYGYIPPESLKPLADMLELPLNHVE
NDUV2_CAEEL     -----------FKFTSENQERIKAIMDIYPEGHKAGIPLLDLAQRQHGWLPISAMHEVAKILEVPRMRAY
NDUV2_RAT       -----------FDFTPENYERIEAIVRNYEGHRAAAVPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVY
NDUV2_BOVIN     -------------------------KNYPEGHKAAAVPVLDLAQRQNGWLPISAMNKVAEILQVPPMRVY
NDUV2_MOUSE     ---------------------------------AAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVY
NDUV2_PONAB     -------------------------KNYPEGHKAAAVPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVY
NDUV2_PANTR     -------------------------KNYPEGHKAAAVPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVY
NDUV2_HUMAN     -------------------------KNYPEGHKAAAVPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVY
NDUV2_GORGO     -------------------------KNYPEGHKAAAVPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVY
NUOE_RICBR      ------------------------KKYPPEGKRSAILPLLDLAQRQNGWLPVPAIEYVANMLEMPYMRAY
NUOE_RICFE      ------------------------KKYPPHGKRSAILPLLDLAQRQNGWLPVPAIEYVANMLEMPYMRAY
NDUV2_NEUCR     -----------FKFSADNEKVIEEIIKRYQYKKAAVMPLLDLGQRQHGFCSISVMNEVARLLEMPPMRVY
NUOE_RICPR      ------------------------KKYPPEGKRSAILPLLDLAQRQNGWLHVSAIEYVANMLEMPYMRAY
HOXF_RALEH      ----------------------------YRSDRTRLIDILWDVQHEYGHIPDAVLPQLGAGLKLSPLDIR
NUOE_RICTY      ------------------------KKYPPNGKRSAILPLLDLAQRQNGWLHISAIEYVANMLEMPYMRAY
NUOE_RICCN      ------------------------KKYPPHGKRSAILPLLDLAQRQNGWLPVPAIEYVANMLAMPYIRAY
NUOE1_RHIME     -----QPAAFAFSKENAAWAEATIKKYPEGREQSAVIPLLMRAQEQDGWVTRAAIESVADMLGMAYIRVL
NUOE_MYCTU      ----------------------------YPDRRSALLPLLHLVQGEDSYLTPAGLRFCADQLGLTGAEVS
NUOE_MYCBO      ----------------------------YPDRRSALLPLLHLVQGEDSYLTPAGLRFCADQLGLTGAEVS
NQO2_PARDE      -------QPDSFEFTPANLEWARAQMTKYPEGRSAIIPVLWRAQEQEGWLSRPAIEYCADLLGMPYIRAL
NQO2_THET8      -------------------------KYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVM
NDUV2_ARATH     -----------WEFSEANQSKVKEILSYYPSKQSAVIPLLDLAQQQNGWLPVSAMNAVAKVIEVAPIRVY
NDUV2_DICDI     --------------------------------QSALIPLLDLAQRQNGWISLRAMDKVAHICGIAPMTAY
NDUV2_SCHPO     ---------------------------------AALVPLLDLAQRQHGWIPPTAMYEIASLAGVSIDYVH
Y1420_THEMA     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKG
NUOE_SALTY      GVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKG
NUOE_SALTI      GVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKG
NUOE_SHIFL      GVATFYSQIFRQPVGRHVIRYCDSVVCHINGYQGIQAALEKKLNIKPGQTTFDGRFTLLPTCCLGNCDKG
NUOE_ECOLI      GVATFYSQIFRQPVGRHVIRYCDSVVCHINGYQGIQAALEKKLNIKPGQTTFDGRFTLLPTCCLGNCDKG
NUOE_ECOL6      GVATFYSQIFRQPVGRHVIRYCDSVVCHINGYQGIQAALEKKLNIKPGQTTFDGRFTLLPTCCLGNCDKG
NUOE_PSEAE      GVATFYSQIFRQPVGRHIIRVCDSMVCYIGGHESVVGEIQKQLGIGLGQTTADGRFTLLPVCCLGNCDKA
NUOE_BUCAI      GVATFYSQIFRKPVGRNIIRYCDSVVCFLTGYKRIQIALENYLKIKIGETTKDDRFTLLPVCCLGNCDKG
NUOE_BUCAP      SVATFYSQIYRQPVGRNVIRYCDSVVCYLTGYEKIKKFLEDYLFIKIGNTTVDGRFTLLPVCCLGNCDKA
NUOE_BUCBP      EIATFYSQIFRQPIGRNIIKYCDSVVCYVNGCEKIRCSLEKNLNVNVGETTKDFKFTLLPICCLGNCDKS
NUOE2_RHIME     ELATFYTLFHTEPIGRFHLQLCDNVSCMLCGSEALLTHLETTLGIRKGETTPDGAFTLSTVECLGACEMA
NUOE_AQUAE      GVVAFYDMFDREDKAKYRIRVCVSIVCHLMGTNKLLKALENILGIKPGEVTPDGKFKIVPVQCLGACSEA
NDUV2_CAEEL     EVATFYTMFNRQPVGKYFLQVCATTPCMLRGAETITETIEKKLGIHAGETTKDGLFTLAEVECLGACVNA
NDUV2_RAT       EVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACVNA
NDUV2_BOVIN     EVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNA
NDUV2_MOUSE     EVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACVNA
NDUV2_PONAB     EVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNA
NDUV2_PANTR     EVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNA
NDUV2_HUMAN     EVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNA
NDUV2_GORGO     EVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNA
NUOE_RICBR      EVATFYTMFNLKPVGKNHIQVCTTTPCWLRGSDDIMKTCKEKLGIKDEEVTKDQKFSLIEIECLGACVNA
NUOE_RICFE      EVATFYSMFNLKRVGKYHIQVCTTTPCWLHGSDDIMKICEKKLGIKLKETTEDQKFTLSEIECLGACVNA
NDUV2_NEUCR     EVASFYTMYNRTPVGKFHVQACTTTPCQLGGCGSIVKAIKEHLGIKQGETTPDGLFTFIEVECLGACANA
NUOE_RICPR      EVATFYTMFNLNPIGKYHIQVCTTTPCWLRGSDNIMKICEKKLAIKHKETTKDQKFTLSEIECLGACVNA
HOXF_RALEH      ETASFYHFFLDKPSGKYRIYLCNSVIAKINGYQAVREALERETGIRFGETDPNGMFGLFDTPCIGLSDQE
NUOE_RICTY      EVATFYSMFNLSPVGKYHIQVCTTTPCWLRGSDDIMKICEKKLAIKHKETTKDQKFTLSEIECLGACVNA
NUOE_RICCN      EVATFYTMFNLKRVGKYHIQVCTTTPCWLRGSDDIMKICEKKLGVKLKETTEDQKFTLSEIECLGACVNA
NUOE1_RHIME     EVATFYTQFQLQPVGRAHVQVCGTTPCMLRGAEDLIKICKKKIASEPFTLNEGGTLSWEEVECQGACVNA
NUOE_MYCTU      AVASFYTMYRRRPTGEYLVGVCTNTLCAVMGGDAIFDRLKEHLGVGHDETTSDGVVTLQHIECNAACDYA
NUOE_MYCBO      AVASFYTMYRRRPTGEYLVGVCTNTLCAVMGGDAIFDRLKEHLGVGHDETTSDGVVTLQHIECNAACDYA
NQO2_PARDE      EVATFYFMFQLQPVGSVAIQICGTTTCMICGAEDLIRVCKEKIAPEPHALSADGRFSWEEVECLGACTNA
NQO2_THET8      GVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTA
NDUV2_ARATH     EVATFYSMFNRAKVGKYHLLVCGTTPCMIRGSRDIESALLDHLGVKRGEVTKDGLFSVGEMECMGCCVNA
NDUV2_DICDI     EVASFYTMFNRTKIGENFVQVCTTTPCMLRGSGEIIKTCKSHLGIQVGETTPDNKFTLVEVECLGACVNA
NDUV2_SCHPO     SLILAYPNDFFWRPKKPRVRICNSWMCQ-------QAAEEQ------GNSNWDSQFDVENTGCLGNCFQG
Y1420_THEMA     -----------------IVRVCMGSSCHLKGYEVVRRELQKKYNFK-----------LYGSLCFGNCSQG


                         +         .         .         .         .         *         .:210
query           PNMMIDEDTHSHLTPEAIPELLERYK
NUOE_SALTY      PNMMIDEDTHSHLTPEAIPELLERYK
NUOE_SALTI      PNMMIDEDTHSHLTPEAIPELLERYK
NUOE_SHIFL      PNMMIDEDTHAHLTPEAIPELLERYK
NUOE_ECOLI      PNMMIDEDTHAHLTPEAIPELLERYK
NUOE_ECOL6      PNMMIDEDTHAHLTPEAIPELLERYK
NUOE_PSEAE      PALMIDDDTHGDVRPDGVAKLLEAY-
NUOE_BUCAI      PTIMINEDTYSVLTPESIPSLLESYK
NUOE_BUCAP      PTIMINEDLYSHLNPDLIPNLLELYK
NUOE_BUCBP      PTIMINDDLYSNVTEYSVIVLLESYQ
NUOE2_RHIME     PVMQVGDDYHGNLDAARLDALLESFR
NUOE_AQUAE      PVFMVNDDEYKFESEVQLNEILSRY-
NDUV2_CAEEL     PMIQINDDYFEDLTPKDVNEILDDLK
NDUV2_RAT       PMVQINDDYYEDLTPKDIEEIIDELR
NDUV2_BOVIN     PMVQINDNYYEDLTPKDIEEIIDELK
NDUV2_MOUSE     PMVQINDNYYEDLTPKDIEEIIDELK
NDUV2_PONAB     PMVQINDNYYEDLTAKDIEEIIDELK
NDUV2_PANTR     PMVQINDNYYEDLTAKDIEEIIDELK
NDUV2_HUMAN     PMVQINDNYYEDLTAKDIEEIIDELK
NDUV2_GORGO     PMVQINDNYYEDLTAKDIEEIIDELK
NUOE_RICBR      PVVQINDDYYEDLTPEKMEAIIDKLR
NUOE_RICFE      PVVQINDDYYEDLTEEKMEKLIDEY-
NDUV2_NEUCR     PMVQINDDYFEDLTPETIKQVLSALK
NUOE_RICPR      PVVQINDDYYEDLNEAKMEKLIEQY-
HOXF_RALEH      PAMLIDKVVFTRLRPGKITDIIAQLK
NUOE_RICTY      PVVQINDDYYEDLNEAKMEKLIEQY-
NUOE_RICCN      PVVQINDDYYEDLTQDKMGKIIDK--
NUOE1_RHIME     PMVMIFKDTFEDLTPERLEEIIDRFE
NUOE_MYCTU      PVVMVNWEFFDNQTPESARELVD---
NUOE_MYCBO      PVVMVNWEFFDNQTPESARELVD---
NQO2_PARDE      PMAQIGKDFYEDLTVEKLAALIDRF-
NQO2_THET8      PVIQVNDEPY----------------
NDUV2_ARATH     PMITVADYSNEDVTPEKVVEIVEKLR
NDUV2_DICDI     PMMCINDDFYEDLTSASTINLLDQIK
NDUV2_SCHPO     PAMWINDKIYGVNTKEKLVDIME---
Y1420_THEMA     VCVEIDGRLFSRVTPENAEEILKK--