[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF68113.1

[Show Plain Result]


## Summary of Sequence Search
    1::385
    1::385       0.0 100%  385 aa  BIOF_SALHS RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385       0.0 100%  385 aa  BIOF_SALTY RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385       0.0  96%  385 aa  BIOF_SALTI RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385       0.0  96%  385 aa  BIOF_SALG2 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385       0.0  96%  385 aa  BIOF_SALEP RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385       0.0  95%  385 aa  BIOF_SALSV RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385       0.0  95%  385 aa  BIOF_SALCH RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385       0.0  95%  385 aa  BIOF_SALPK RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385       0.0  95%  385 aa  BIOF_SALPA RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385       0.0  95%  385 aa  BIOF_SALDC RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385       0.0  95%  385 aa  BIOF_SALA4 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385       0.0  95%  385 aa  BIOF_SALPB RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385       0.0  95%  385 aa  BIOF_SALNS RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385       0.0  95%  385 aa  BIOF_SALPC RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385     e-174  87%  385 aa  BIOF_SALAR RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-170  84%  384 aa  BIOF_CITK8 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-145  74%  384 aa  BIOF_ENT38 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-144  71%  384 aa  BIOF_ECOLU RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-143  70%  384 aa  BIOF_ESCF3 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-142  70%  384 aa  BIOF_ECOSM RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-139  69%  384 aa  BIOF_ECO5E RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-139  69%  384 aa  BIOF_ECO57 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-139  68%  384 aa  BIOF_ECO8A RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-139  68%  384 aa  BIOF_ECOLC RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-139  68%  384 aa  BIOF_ECOHS RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-139  68%  384 aa  BIOF_SHIDS RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385     e-138  72%  385 aa  BIOF_ENTAG RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-138  68%  384 aa  BIOF_SHIBS RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-138  68%  384 aa  BIOF_SHIB3 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-138  68%  384 aa  BIOF_ECOLI RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-138  68%  384 aa  BIOF_ECODH RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-138  68%  384 aa  BIOF_ECOSE RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-138  68%  384 aa  BIOF_ECO24 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-137  68%  384 aa  BIOF_ECO55 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-137  68%  384 aa  BIOF_ECO27 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-137  68%  384 aa  BIOF_SHIFL RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-137  68%  384 aa  BIOF_SHIF8 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-136  68%  384 aa  BIOF_SHISS RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-136  68%  384 aa  BIOF_ECOL6 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-136  68%  384 aa  BIOF_ECOL5 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-136  68%  384 aa  BIOF_ECO81 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-136  68%  384 aa  BIOF_ECOUT RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-136  68%  384 aa  BIOF_ECOK1 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::384     e-136  68%  384 aa  BIOF_ECO45 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::382     e-135  68%  384 aa  BIOF_ECO7I RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385     e-125  65%  385 aa  BIOF_KLEP3 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::381     e-120  61%  385 aa  BIOF_ERWCT RecName: Full=8-amino-7-oxononanoate synthase;       
    1::380     e-114  63%  383 aa  BIOF_YERE8 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::380     e-112  57%  383 aa  BIOF_PHOLL RecName: Full=8-amino-7-oxononanoate synthase;       
    1::379     e-111  63%  383 aa  BIOF_ENTS8 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::385     e-110  58%  385 aa  BIOF_KLEP7 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::381     e-108  54%  387 aa  BIOF_PROMH RecName: Full=8-amino-7-oxononanoate synthase;       
    1::379     e-107  59%  383 aa  BIOF_SERP5 RecName: Full=8-amino-7-oxononanoate synthase;       
    5::383     e-106  58%  388 aa  BIOF_SODGM RecName: Full=8-amino-7-oxononanoate synthase;       
    1::382     e-104  60%  382 aa  BIOF_SERMA RecName: Full=8-amino-7-oxononanoate synthase;       
    1::380     e-103  59%  383 aa  BIOF_YERPS RecName: Full=8-amino-7-oxononanoate synthase;       
    1::380     e-103  59%  383 aa  BIOF_YERPB RecName: Full=8-amino-7-oxononanoate synthase;       
    1::380     e-103  59%  383 aa  BIOF_YERPY RecName: Full=8-amino-7-oxononanoate synthase;       
    1::380     e-103  59%  383 aa  BIOF_YERP3 RecName: Full=8-amino-7-oxononanoate synthase;       
    1::379     e-100  49%  384 aa  BIOF_ERWT9 RecName: Full=8-amino-7-oxononanoate synthase;       
    8::386     5e-97  50%  392 aa  BIOF_PHOPR RecName: Full=8-amino-7-oxononanoate synthase;       
    1::380     3e-96  57%  383 aa  BIOF_YERPP RecName: Full=8-amino-7-oxononanoate synthase;       
    1::380     3e-96  57%  383 aa  BIOF_YERPN RecName: Full=8-amino-7-oxononanoate synthase;       
    1::380     3e-96  57%  383 aa  BIOF_YERPG RecName: Full=8-amino-7-oxononanoate synthase;       
    1::380     3e-96  57%  383 aa  BIOF_YERPE RecName: Full=8-amino-7-oxononanoate synthase;       
    1::380     3e-96  57%  383 aa  BIOF_YERPA RecName: Full=8-amino-7-oxononanoate synthase;       
    3::372     1e-91  47%  383 aa  BIOF_VIBPA RecName: Full=8-amino-7-oxononanoate synthase;       
    4::376     4e-91  47%  403 aa  BIOF_VIBSL RecName: Full=8-amino-7-oxononanoate synthase;       
    4::379     2e-89  47%  383 aa  BIOF_ALISL RecName: Full=8-amino-7-oxononanoate synthase;       
    4::383     2e-89  48%  383 aa  BIOF_VIBF1 RecName: Full=8-amino-7-oxononanoate synthase;       
    4::383     8e-89  48%  383 aa  BIOF_VIBFM RecName: Full=8-amino-7-oxononanoate synthase;       
    1::379     4e-88  46%  384 aa  BIOF_BUCBP RecName: Full=8-amino-7-oxononanoate synthase;       
    3::364     4e-87  46%  383 aa  BIOF_VIBHB RecName: Full=8-amino-7-oxononanoate synthase;       
    4::378     7e-86  46%  385 aa  BIOF_VIBVU RecName: Full=8-amino-7-oxononanoate synthase;       
    4::378     1e-85  46%  385 aa  BIOF_VIBVY RecName: Full=8-amino-7-oxononanoate synthase;       
    3::376     3e-84  46%  384 aa  BIOF_VIBCH RecName: Full=8-amino-7-oxononanoate synthase;       
   15::383     3e-82  47%  398 aa  BIOF_AERHH RecName: Full=8-amino-7-oxononanoate synthase;       
   14::386     2e-79  43%  403 aa  BIOF_MARMS RecName: Full=8-amino-7-oxononanoate synthase;       
   37::383     2e-76  47%  398 aa  BIOF_AERS4 RecName: Full=8-amino-7-oxononanoate synthase;       
    8::379     3e-75  48%  392 aa  BIOF_THISH RecName: Full=8-amino-7-oxononanoate synthase;       
   11::377     4e-75  47%  394 aa  BIOF_MARAV RecName: Full=8-amino-7-oxononanoate synthase;       
   36::387     6e-74  46%  388 aa  BIOF_HERAR RecName: Full=8-amino-7-oxononanoate synthase;       
    1::382     8e-74  41%  396 aa  BIOF_HAHCH RecName: Full=8-amino-7-oxononanoate synthase;       
   19::378     2e-71  41%  392 aa  BIOF_PSEPF RecName: Full=8-amino-7-oxononanoate synthase;       
   19::378     3e-71  41%  390 aa  BIOF_PSEE4 RecName: Full=8-amino-7-oxononanoate synthase;       
   14::383     2e-70  41%  397 aa  BIOF_SACD2 RecName: Full=8-amino-7-oxononanoate synthase;       
   19::384     1e-69  40%  396 aa  BIOF_NITMU RecName: Full=8-amino-7-oxononanoate synthase;       
   19::378     2e-69  39%  392 aa  BIOF_PSEF5 RecName: Full=8-amino-7-oxononanoate synthase;       
    9::378     2e-69  40%  396 aa  BIOF_PSE14 RecName: Full=8-amino-7-oxononanoate synthase;       
    9::378     6e-69  39%  396 aa  BIOF_PSESM RecName: Full=8-amino-7-oxononanoate synthase;       
   28::372     7e-69  43%  386 aa  BIOF_ALCBS RecName: Full=8-amino-7-oxononanoate synthase;       
   19::378     2e-68  39%  396 aa  BIOF_PSEU2 RecName: Full=8-amino-7-oxononanoate synthase;       
    7::382     2e-68  43%  387 aa  BIOF_NITEC RecName: Full=8-amino-7-oxononanoate synthase;       
   36::380     2e-68  46%  386 aa  BIOF_AZOSE RecName: Full=8-amino-7-oxononanoate synthase;       
   37::385     1e-67  46%  401 aa  BIOF_XYLFT RecName: Full=8-amino-7-oxononanoate synthase;       
   37::385     1e-67  46%  401 aa  BIOF_XYLFM RecName: Full=8-amino-7-oxononanoate synthase;       
   37::385     1e-67  46%  401 aa  BIOF_XYLF2 RecName: Full=8-amino-7-oxononanoate synthase;       
    9::366     9e-67  41%  392 aa  BIOF_PSEU5 RecName: Full=8-amino-7-oxononanoate synthase;       
   20::383     1e-65  39%  387 aa  BIOF_DECAR RecName: Full=8-amino-7-oxononanoate synthase;       
    5::385     3e-65  39%  397 aa  BIOF_THICR RecName: Full=8-amino-7-oxononanoate synthase;       
   34::382     3e-65  46%  394 aa  BIOF_BURPP RecName: Full=8-amino-7-oxononanoate synthase;       
   34::382     5e-65  46%  394 aa  BIOF_BURXL RecName: Full=8-amino-7-oxononanoate synthase;       
   10::385     2e-64  42%  391 aa  BIOF_ALHEH RecName: Full=8-amino-7-oxononanoate synthase;       
    2::386     4e-64  37%  391 aa  BIOF_GEOUR RecName: Full=8-amino-7-oxononanoate synthase;       
   18::384     5e-63  39%  389 aa  BIOF_GEOBB RecName: Full=8-amino-7-oxononanoate synthase;       
   30::391     6e-63  40%  396 aa  BIOF_METFK RecName: Full=8-amino-7-oxononanoate synthase;       
    3::373     8e-63  41%  377 aa  BIOF_NITOC RecName: Full=8-amino-7-oxononanoate synthase;       
    9::378     1e-62  40%  401 aa  BIOF_PSEAB RecName: Full=8-amino-7-oxononanoate synthase;       
    9::378     1e-62  40%  401 aa  BIOF_PSEA8 RecName: Full=8-amino-7-oxononanoate synthase;       
   36::382     1e-62  44%  390 aa  BIOF_AZOSB RecName: Full=8-amino-7-oxononanoate synthase;       
   27::391     2e-62  42%  396 aa  BIOF_GEOMG RecName: Full=8-amino-7-oxononanoate synthase;       
   21::391     3e-62  43%  394 aa  BIOF_BURP8 RecName: Full=8-amino-7-oxononanoate synthase;       
   19::378     4e-62  38%  390 aa  BIOF_PSEPG RecName: Full=8-amino-7-oxononanoate synthase;       
   37::385     5e-62  44%  401 aa  BIOF_XYLFA RecName: Full=8-amino-7-oxononanoate synthase;       
    9::378     5e-62  39%  401 aa  BIOF_PSEAE RecName: Full=8-amino-7-oxononanoate synthase;       
   19::378     9e-62  38%  390 aa  BIOF_PSEPW RecName: Full=8-amino-7-oxononanoate synthase;       
   21::391     2e-61  44%  394 aa  BIOF_BURM1 RecName: Full=8-amino-7-oxononanoate synthase;       
   18::384     7e-61  37%  390 aa  BIKB_GEOKA RecName: Full=Putative 8-amino-7-oxononanoate
    9::361     1e-60  40%  389 aa  BIOF_PSEMY RecName: Full=8-amino-7-oxononanoate synthase;       
    5::377     2e-60  40%  387 aa  BIOF_NITEU RecName: Full=8-amino-7-oxononanoate synthase;       
   13::385     2e-60  46%  389 aa  BIOF_ACIF5 RecName: Full=8-amino-7-oxononanoate synthase;       
   13::385     2e-60  46%  389 aa  BIOF_ACIF2 RecName: Full=8-amino-7-oxononanoate synthase;       
   56::410     4e-60  46%  471 aa  BIOF_BURCM RecName: Full=8-amino-7-oxononanoate synthase;       
   46::394     5e-60  38%  406 aa  BIOF_RALME RecName: Full=8-amino-7-oxononanoate synthase;       
   19::378     5e-60  37%  390 aa  BIOF_PSEPK RecName: Full=8-amino-7-oxononanoate synthase;       
   35::382     5e-60  45%  384 aa  BIKB_DESAP RecName: Full=Putative 8-amino-7-oxononanoate
   46::397     8e-60  42%  404 aa  BIOF_RALEH RecName: Full=8-amino-7-oxononanoate synthase;       
   19::366     1e-59  42%  383 aa  BIOF_CHRVO RecName: Full=8-amino-7-oxononanoate synthase;       
   56::410     1e-59  45%  445 aa  BIOF_BURA4 RecName: Full=8-amino-7-oxononanoate synthase;       
    2::385     2e-59  34%  393 aa  BIOF_GEOSF RecName: Full=8-amino-7-oxononanoate synthase;       
   21::379     3e-59  44%  406 aa  BIOF_BURCC RecName: Full=8-amino-7-oxononanoate synthase;       
   24::386     2e-58  40%  391 aa  BIOF_GEOSL RecName: Full=8-amino-7-oxononanoate synthase;       
    7::383     2e-58  39%  398 aa  BIOF_CELJU RecName: Full=8-amino-7-oxononanoate synthase;       
   16::387     2e-58  39%  394 aa  BIOF_JANMA RecName: Full=8-amino-7-oxononanoate synthase;       
   21::379     8e-58  44%  406 aa  BIOF_BURCH RecName: Full=8-amino-7-oxononanoate synthase;       
   21::379     8e-58  44%  406 aa  BIOF_BURCA RecName: Full=8-amino-7-oxononanoate synthase;       
   36::385     1e-57  41%  391 aa  BIOF_GEOLS RecName: Full=8-amino-7-oxononanoate synthase;       
    6::384     2e-57  36%  390 aa  BIKB_PELCD RecName: Full=Putative 8-amino-7-oxononanoate
   37::384     4e-57  39%  389 aa  BIOF_BACSU RecName: Full=8-amino-7-oxononanoate synthase;       
    9::378     7e-57  37%  401 aa  BIOF_PSEA7 RecName: Full=8-amino-7-oxononanoate synthase;       
    8::382     7e-57  38%  387 aa  BIOF_METCA RecName: Full=8-amino-7-oxononanoate synthase;       
   21::382     2e-56  43%  394 aa  BIOF_BURPS RecName: Full=8-amino-7-oxononanoate synthase;       
   21::382     2e-56  43%  394 aa  BIOF_BURP6 RecName: Full=8-amino-7-oxononanoate synthase;       
   21::382     2e-56  43%  394 aa  BIOF_BURP0 RecName: Full=8-amino-7-oxononanoate synthase;       
   21::382     2e-56  43%  394 aa  BIOF_BURMS RecName: Full=8-amino-7-oxononanoate synthase;       
   21::382     2e-56  43%  394 aa  BIOF_BURMA RecName: Full=8-amino-7-oxononanoate synthase;       
   21::382     2e-56  43%  394 aa  BIOF_BURM9 RecName: Full=8-amino-7-oxononanoate synthase;       
   21::382     2e-56  43%  394 aa  BIOF_BURM7 RecName: Full=8-amino-7-oxononanoate synthase;       
   21::397     2e-56  38%  405 aa  BIOF2_POLSJ RecName: Full=8-amino-7-oxononanoate synthase 2;       
   21::382     2e-56  42%  394 aa  BIOF_BURTA RecName: Full=8-amino-7-oxononanoate synthase;       
   21::382     4e-56  42%  394 aa  BIOF_BURP1 RecName: Full=8-amino-7-oxononanoate synthase;       
   19::378     6e-56  36%  390 aa  BIOF_PSEP1 RecName: Full=8-amino-7-oxononanoate synthase;       
   46::397     2e-55  40%  404 aa  BIOF_CUPTR RecName: Full=8-amino-7-oxononanoate synthase;       
   21::378     3e-55  43%  394 aa  BIOF_BURCJ RecName: Full=8-amino-7-oxononanoate synthase;       
   34::382     4e-55  44%  400 aa  BIOF_BURS3 RecName: Full=8-amino-7-oxononanoate synthase;       
    2::366     5e-55  34%  379 aa  BIOF_BACLD RecName: Full=8-amino-7-oxononanoate synthase;       
   44::407     1e-54  37%  415 aa  BIOF_RALPJ RecName: Full=8-amino-7-oxononanoate synthase;       
    5::380     2e-54  32%  395 aa  BIKB_BACHD RecName: Full=Putative 8-amino-7-oxononanoate
   18::385     2e-53  35%  390 aa  BIKB_EXIS2 RecName: Full=Putative 8-amino-7-oxononanoate
    8::359     3e-53  41%  386 aa  BIOF_CHRSD RecName: Full=8-amino-7-oxononanoate synthase;       
   19::384     3e-53  33%  389 aa  BIOF_BACSH RecName: Full=8-amino-7-oxononanoate synthase;       
    4::386     3e-53  31%  394 aa  BIKB_BACCQ RecName: Full=Putative 8-amino-7-oxononanoate
    4::386     3e-53  31%  394 aa  BIKB_BACC7 RecName: Full=Putative 8-amino-7-oxononanoate
   39::396     4e-53  39%  405 aa  BIOF1_POLSJ RecName: Full=8-amino-7-oxononanoate synthase 1;       
   23::387     4e-53  33%  395 aa  BIKB_BACC2 RecName: Full=Putative 8-amino-7-oxononanoate
   37::366     1e-52  41%  371 aa  BIOF_BACNA RecName: Full=8-amino-7-oxononanoate synthase homolog;
   40::387     1e-52  43%  407 aa  BIOF_STRM5 RecName: Full=8-amino-7-oxononanoate synthase;       
   37::384     2e-52  43%  407 aa  BIOF_STRMK RecName: Full=8-amino-7-oxononanoate synthase;       
    4::387     2e-52  31%  395 aa  BIKB_BACC4 RecName: Full=Putative 8-amino-7-oxononanoate
    4::387     2e-52  31%  395 aa  BIKB2_BACCR RecName: Full=Putative 8-amino-7-oxononanoate
   30::373     2e-52  36%  386 aa  BIOF_BACA2 RecName: Full=8-amino-7-oxononanoate synthase;       
    4::377     3e-52  31%  395 aa  BIKB_BACC1 RecName: Full=Putative 8-amino-7-oxononanoate
   19::363     4e-52  33%  390 aa  BIKB_ANOFW RecName: Full=Putative 8-amino-7-oxononanoate
   38::390     4e-52  36%  395 aa  BIKB_ALKOO RecName: Full=Putative 8-amino-7-oxononanoate
   37::385     5e-52  41%  401 aa  BIOF_XANC5 RecName: Full=8-amino-7-oxononanoate synthase;       
    5::377     5e-52  32%  395 aa  BIKB_BACWK RecName: Full=Putative 8-amino-7-oxononanoate
   47::398     6e-52  38%  408 aa  BIOF_RALEJ RecName: Full=8-amino-7-oxononanoate synthase;       
    4::389     8e-52  31%  395 aa  BIKB_BACCN RecName: Full=Putative 8-amino-7-oxononanoate
   43::388     1e-51  41%  408 aa  BIOF_LEPCP RecName: Full=8-amino-7-oxononanoate synthase;       
   37::385     1e-51  41%  401 aa  BIOF_XANAC RecName: Full=8-amino-7-oxononanoate synthase;       
   12::382     2e-51  35%  396 aa  BIOF_METPP RecName: Full=8-amino-7-oxononanoate synthase;       
    5::390     2e-51  30%  395 aa  BIKB_BACCZ RecName: Full=Putative 8-amino-7-oxononanoate
   46::387     2e-51  43%  403 aa  BIOF_BURVG RecName: Full=8-amino-7-oxononanoate synthase;       
   38::386     4e-51  34%  391 aa  BIKB_BACA2 RecName: Full=Putative 8-amino-7-oxononanoate
   28::387     7e-51  39%  387 aa  BIKB_PASMU RecName: Full=Putative 8-amino-7-oxononanoate
    5::387     7e-51  30%  395 aa  BIKB_BACHK RecName: Full=Putative 8-amino-7-oxononanoate
    9::387     9e-51  39%  391 aa  BIOF_MYXXD RecName: Full=8-amino-7-oxononanoate synthase;       
    1::377     1e-50  35%  385 aa  BIKB_DESOH RecName: Full=Putative 8-amino-7-oxononanoate
    5::387     1e-50  30%  395 aa  BIKB_BACC0 RecName: Full=Putative 8-amino-7-oxononanoate
    5::387     1e-50  30%  395 aa  BIKB2_BACAN RecName: Full=Putative 8-amino-7-oxononanoate
   37::385     2e-50  41%  401 aa  BIOF_XANOR RecName: Full=8-amino-7-oxononanoate synthase;       
   37::385     2e-50  41%  401 aa  BIOF_XANOP RecName: Full=8-amino-7-oxononanoate synthase;       
   37::385     2e-50  41%  401 aa  BIOF_XANOM RecName: Full=8-amino-7-oxononanoate synthase;       
   37::381     2e-50  34%  392 aa  BIKB_BACP2 RecName: Full=Putative 8-amino-7-oxononanoate
   27::387     3e-50  36%  387 aa  BIKB_HAEDU RecName: Full=Putative 8-amino-7-oxononanoate
   32::382     3e-50  33%  392 aa  BIKB_BACSU RecName: Full=Putative 8-amino-7-oxononanoate
    5::387     3e-50  30%  395 aa  BIKB_BACAH RecName: Full=Putative 8-amino-7-oxononanoate
   23::377     3e-50  33%  388 aa  BIOF_CLOTH RecName: Full=8-amino-7-oxononanoate synthase;       
   37::385     8e-50  40%  401 aa  BIOF_XANCB RecName: Full=8-amino-7-oxononanoate synthase;       
   37::390     8e-50  32%  395 aa  BIKB_ALKMQ RecName: Full=Putative 8-amino-7-oxononanoate
   37::385     1e-49  40%  401 aa  BIOF_XANCP RecName: Full=8-amino-7-oxononanoate synthase;       
   37::385     1e-49  40%  401 aa  BIOF_XANC8 RecName: Full=8-amino-7-oxononanoate synthase;       
   35::386     1e-49  32%  392 aa  BIKB_SYMTH RecName: Full=Putative 8-amino-7-oxononanoate
    8::383     2e-49  35%  386 aa  BIOF_THIDA RecName: Full=8-amino-7-oxononanoate synthase;       
   27::380     1e-48  38%  380 aa  BIKB_HAEPS RecName: Full=Putative 8-amino-7-oxononanoate
   41::376     2e-48  39%  398 aa  BIOF_ANASK RecName: Full=8-amino-7-oxononanoate synthase;       
   30::386     3e-48  31%  393 aa  BIKB_COPPD RecName: Full=Putative 8-amino-7-oxononanoate
    1::387     7e-48  36%  396 aa  BIOF_BORPD RecName: Full=8-amino-7-oxononanoate synthase;       
   33::377     7e-48  36%  388 aa  BIKB_THEYD RecName: Full=Putative 8-amino-7-oxononanoate
   10::390     1e-47  30%  395 aa  BIKB_THEP3 RecName: Full=Putative 8-amino-7-oxononanoate
   31::380     1e-47  41%  388 aa  BIKB_GLOVI RecName: Full=Putative 8-amino-7-oxononanoate
   10::390     2e-47  30%  395 aa  BIKB_THEPX RecName: Full=Putative 8-amino-7-oxononanoate
   13::374     2e-47  39%  389 aa  BIKB_PARL1 RecName: Full=Putative 8-amino-7-oxononanoate
    4::363     2e-47  34%  372 aa  BIKB_METJA RecName: Full=Putative 8-amino-7-oxononanoate
   40::389     3e-47  37%  395 aa  BIKB_THET8 RecName: Full=8-amino-7-oxononanoate
    5::374     4e-47  35%  391 aa  BIOF_PELPD RecName: Full=8-amino-7-oxononanoate synthase;       
    6::392     5e-47  31%  398 aa  KBL_ECOLI RecName: Full=2-amino-3-ketobutyrate coenzyme A ligase;  
    6::392     5e-47  31%  398 aa  BIKB_SHIFL RecName: Full=Putative 8-amino-7-oxononanoate
    6::392     5e-47  31%  398 aa  BIKB_ECO57 RecName: Full=Putative 8-amino-7-oxononanoate
    6::392     1e-46  31%  398 aa  BIKB_SALTY RecName: Full=Putative 8-amino-7-oxononanoate
   41::376     2e-46  38%  398 aa  BIOF_ANAD2 RecName: Full=8-amino-7-oxononanoate synthase;       
   31::386     3e-46  32%  391 aa  BIKB_THEM4 RecName: Full=Putative 8-amino-7-oxononanoate
   38::390     3e-46  35%  398 aa  BIKB_GLUDA RecName: Full=Putative 8-amino-7-oxononanoate
   19::402     5e-46  34%  409 aa  BIOF_POLNA RecName: Full=8-amino-7-oxononanoate synthase;       
   30::391     9e-46  34%  396 aa  BIKB_OCEIH RecName: Full=Putative 8-amino-7-oxononanoate
   12::371     2e-45  39%  384 aa  BIOF_DESDA RecName: Full=8-amino-7-oxononanoate synthase;       
   30::387     2e-45  40%  394 aa  BIKB_ACAM1 RecName: Full=Putative 8-amino-7-oxononanoate
   27::365     3e-45  35%  380 aa  BIKB_HAEIE RecName: Full=Putative 8-amino-7-oxononanoate
    6::382     4e-45  39%  397 aa  BIOF_ANADF RecName: Full=8-amino-7-oxononanoate synthase;       
   19::361     4e-45  34%  392 aa  BIKB_CHLP8 RecName: Full=Putative 8-amino-7-oxononanoate
   31::386     6e-45  31%  391 aa  BIKB_THEAB RecName: Full=Putative 8-amino-7-oxononanoate
   38::390     7e-45  31%  395 aa  BIKB_TREDE RecName: Full=Putative 8-amino-7-oxononanoate
   27::364     7e-45  36%  379 aa  BIKB_HAEIG RecName: Full=Putative 8-amino-7-oxononanoate
   27::364     7e-45  36%  379 aa  BIKB_HAEI8 RecName: Full=Putative 8-amino-7-oxononanoate
   27::365     1e-44  36%  380 aa  BIKB_NEIMF RecName: Full=Putative 8-amino-7-oxononanoate
   32::377     1e-44  38%  386 aa  BIKB_BEII9 RecName: Full=Putative 8-amino-7-oxononanoate
   29::368     2e-44  33%  381 aa  BIKB_META3 RecName: Full=Putative 8-amino-7-oxononanoate
   38::355     2e-44  39%  382 aa  BIKB_MYCS2 RecName: Full=Putative 8-amino-7-oxononanoate
   27::365     2e-44  35%  380 aa  BIKB_HAEIN RecName: Full=Putative 8-amino-7-oxononanoate
   28::414     4e-44  31%  416 aa  KBL_MOUSE RecName: Full=2-amino-3-ketobutyrate coenzyme A ligase,
   27::365     8e-44  36%  380 aa  BIKB_NEIMA RecName: Full=Putative 8-amino-7-oxononanoate
   27::365     8e-44  36%  380 aa  BIKB_NEIM0 RecName: Full=Putative 8-amino-7-oxononanoate
   31::390     8e-44  31%  395 aa  BIKB_FERNB RecName: Full=Putative 8-amino-7-oxononanoate
   27::365     1e-43  36%  380 aa  BIKB_NEIG2 RecName: Full=Putative 8-amino-7-oxononanoate
   35::374     1e-43  38%  381 aa  BIKB_ACICJ RecName: Full=Putative 8-amino-7-oxononanoate
   11::387     1e-43  40%  393 aa  BIKB_SYNY3 RecName: Full=Putative 8-amino-7-oxononanoate
   31::417     4e-43  31%  419 aa  KBL_BOVIN RecName: Full=2-amino-3-ketobutyrate coenzyme A ligase,
   27::365     4e-43  35%  380 aa  BIKB_NEIMB RecName: Full=Putative 8-amino-7-oxononanoate
   35::363     4e-43  33%  395 aa  BIKB_MAGSM RecName: Full=Putative 8-amino-7-oxononanoate
   68::417     7e-43  33%  419 aa  KBL_HUMAN RecName: Full=2-amino-3-ketobutyrate coenzyme A ligase,
   27::365     7e-43  35%  380 aa  BIKB_NEIG1 RecName: Full=Putative 8-amino-7-oxononanoate
   31::388     9e-43  30%  393 aa  BIKB_PETMO RecName: Full=Putative 8-amino-7-oxononanoate
   32::372     9e-43  35%  392 aa  BIKB_MAGSA RecName: Full=Putative 8-amino-7-oxononanoate
   36::381     1e-42  36%  392 aa  BIOF_MARMM RecName: Full=8-amino-7-oxononanoate synthase;       
   30::363     1e-42  32%  370 aa  BIKB_METVS RecName: Full=Putative 8-amino-7-oxononanoate
   32::394     2e-42  35%  405 aa  BIOF_DELAS RecName: Full=8-amino-7-oxononanoate synthase;       
   38::383     2e-42  39%  412 aa  BIOF_ACIAC RecName: Full=8-amino-7-oxononanoate synthase;       
   42::381     6e-42  38%  402 aa  BIOF_HALHL RecName: Full=8-amino-7-oxononanoate synthase;       
   11::381     8e-42  37%  395 aa  BIKB_SYNP2 RecName: Full=Putative 8-amino-7-oxononanoate
   52::358     1e-41  43%  387 aa  BIKB_METPB RecName: Full=Putative 8-amino-7-oxononanoate
    6::377     3e-41  34%  385 aa  BIKB_MICAN RecName: Full=Putative 8-amino-7-oxononanoate
   34::391     3e-41  31%  396 aa  BIKB1_BACAN RecName: Full=Putative 8-amino-7-oxononanoate
    4::366     4e-41  34%  381 aa  BIKB_CYAP8 RecName: Full=Putative 8-amino-7-oxononanoate
   34::374     4e-41  32%  396 aa  BIKB1_BACCR RecName: Full=Putative 8-amino-7-oxononanoate
   48::366     5e-41  39%  383 aa  BIKB_METC4 RecName: Full=Putative 8-amino-7-oxononanoate
   43::355     7e-41  43%  374 aa  BIKB_METRJ RecName: Full=Putative 8-amino-7-oxononanoate
   29::376     2e-40  37%  383 aa  BIKB_CAUSK RecName: Full=Putative 8-amino-7-oxononanoate
   38::386     3e-40  32%  397 aa  BIKB_BORPA RecName: Full=Putative 8-amino-7-oxononanoate
   39::390     4e-40  32%  395 aa  BIKB_STAAW RecName: Full=Putative 8-amino-7-oxononanoate
   39::390     4e-40  32%  395 aa  BIKB_STAAS RecName: Full=Putative 8-amino-7-oxononanoate
   39::390     4e-40  32%  395 aa  BIKB_STAAN RecName: Full=Putative 8-amino-7-oxononanoate
   39::390     4e-40  32%  395 aa  BIKB_STAAM RecName: Full=Putative 8-amino-7-oxononanoate
   39::390     4e-40  32%  395 aa  BIKB_STAAC RecName: Full=Putative 8-amino-7-oxononanoate
   53::392     6e-40  31%  405 aa  HEM1_RHIRD RecName: Full=5-aminolevulinate synthase;       
   48::366     6e-40  39%  383 aa  BIKB_METEP RecName: Full=Putative 8-amino-7-oxononanoate
   39::390     2e-39  31%  395 aa  BIKB_STAAR RecName: Full=Putative 8-amino-7-oxononanoate
   28::365     2e-39  31%  373 aa  BIKB_AQUAE RecName: Full=Putative 8-amino-7-oxononanoate
  158::539     5e-39  32%  582 aa  HEM0_OPSTA RecName: Full=5-aminolevulinate synthase,
    3::344     8e-39  36%  350 aa  BIKB_METSB RecName: Full=Putative 8-amino-7-oxononanoate
   40::382     1e-38  37%  397 aa  BIOF_ANADE RecName: Full=8-amino-7-oxononanoate synthase;       
   41::379     2e-38  35%  391 aa  BIKB_THEEB RecName: Full=Putative 8-amino-7-oxononanoate
   16::365     2e-38  40%  384 aa  BIKB_CAUCR RecName: Full=Putative 8-amino-7-oxononanoate
   16::365     2e-38  40%  384 aa  BIKB_CAUCN RecName: Full=Putative 8-amino-7-oxononanoate
    6::384     2e-38  38%  386 aa  BIKB_ANASP RecName: Full=Putative 8-amino-7-oxononanoate
   21::391     3e-38  33%  407 aa  HEM1_RHOS4 RecName: Full=5-aminolevulinate synthase 1;       
   39::381     3e-38  37%  381 aa  BIKB_MYCPA RecName: Full=Putative 8-amino-7-oxononanoate
    6::382     4e-38  38%  386 aa  BIKB_ANAVT RecName: Full=Putative 8-amino-7-oxononanoate
   54::393     7e-38  32%  401 aa  HEM1_RHOCA RecName: Full=5-aminolevulinate synthase;       
   38::375     2e-37  29%  414 aa  HEM1_RICBR RecName: Full=5-aminolevulinate synthase;       
   39::366     2e-37  36%  385 aa  BIKB_MYCLE RecName: Full=Putative 8-amino-7-oxononanoate
   39::366     2e-37  36%  385 aa  BIKB_MYCLB RecName: Full=Putative 8-amino-7-oxononanoate
   40::386     3e-37  41%  399 aa  BIKB_CYAP4 RecName: Full=Putative 8-amino-7-oxononanoate
   54::393     3e-37  33%  409 aa  HEM1_PARDP RecName: Full=5-aminolevulinate synthase;       
   46::395     3e-37  31%  407 aa  HEM0_RHOS4 RecName: Full=5-aminolevulinate synthase 2;       
    2::373     3e-37  35%  382 aa  BIKB_GRABC RecName: Full=Putative 8-amino-7-oxononanoate
    8::379     4e-37  33%  380 aa  BIKB_CYAP7 RecName: Full=Putative 8-amino-7-oxononanoate
   36::391     6e-37  33%  404 aa  HEM1_RHIME RecName: Full=5-aminolevulinate synthase;       
   45::390     1e-36  32%  409 aa  HEM1_BRAJA RecName: Full=5-aminolevulinate synthase;       
  168::552     2e-36  29%  603 aa  LCB2_SCHPO RecName: Full=Serine palmitoyltransferase 2;       
  158::531     3e-36  30%  583 aa  HEM0_DANRE RecName: Full=5-aminolevulinate synthase,
  196::536     4e-36  31%  587 aa  HEM0_PONAB RecName: Full=5-aminolevulinate synthase,
   35::386     5e-36  31%  397 aa  BIKB_BORPE RecName: Full=Putative 8-amino-7-oxononanoate
  191::534     6e-36  30%  582 aa  HEM0_DELLE RecName: Full=5-aminolevulinate synthase,
   42::375     8e-36  29%  414 aa  HEM1_RICCN RecName: Full=5-aminolevulinate synthase;       
   40::388     8e-36  31%  399 aa  BIKB_BORBR RecName: Full=Putative 8-amino-7-oxononanoate
   42::375     1e-35  29%  414 aa  HEM1_RICFE RecName: Full=5-aminolevulinate synthase;       
  196::536     1e-35  30%  587 aa  HEM0_BOVIN RecName: Full=5-aminolevulinate synthase,
  196::536     2e-35  30%  587 aa  HEM0_HUMAN RecName: Full=5-aminolevulinate synthase,
   44::402     7e-35  31%  416 aa  BIOF_RALSO RecName: Full=8-amino-7-oxononanoate synthase;       
    7::388     7e-35  35%  393 aa  BIKB_TRIEI RecName: Full=Putative 8-amino-7-oxononanoate
   38::356     7e-35  35%  380 aa  BIKB_MYCGI RecName: Full=Putative 8-amino-7-oxononanoate
   16::390     1e-34  35%  394 aa  BIKB_NOSP7 RecName: Full=Putative 8-amino-7-oxononanoate
   38::356     2e-34  35%  380 aa  BIKB_MYCVP RecName: Full=Putative 8-amino-7-oxononanoate
  196::536     5e-34  29%  587 aa  HEM0_RAT RecName: Full=5-aminolevulinate synthase,
  196::536     5e-34  29%  587 aa  HEM0_MOUSE RecName: Full=5-aminolevulinate synthase,
   48::354     8e-34  38%  379 aa  BIKB_METNO RecName: Full=Putative 8-amino-7-oxononanoate
   38::373     1e-33  34%  382 aa  BIKB_MYCSJ RecName: Full=Putative 8-amino-7-oxononanoate
  160::525     2e-33  29%  552 aa  SPTC3_HUMAN RecName: Full=Serine palmitoyltransferase 3;       
  113::475     2e-33  28%  490 aa  SPTC2_DICDI RecName: Full=Serine palmitoyltransferase 2;       
   38::373     5e-33  33%  382 aa  BIKB_MYCSS RecName: Full=Putative 8-amino-7-oxononanoate
   38::373     5e-33  33%  382 aa  BIKB_MYCSK RecName: Full=Putative 8-amino-7-oxononanoate
   39::381     2e-32  34%  381 aa  BIKB_MYCA1 RecName: Full=Putative 8-amino-7-oxononanoate
   43::377     3e-32  34%  386 aa  BIKB_MYCTU RecName: Full=Putative 8-amino-7-oxononanoate
   43::377     3e-32  34%  386 aa  BIKB_MYCTF RecName: Full=Putative 8-amino-7-oxononanoate
   43::377     3e-32  34%  386 aa  BIKB_MYCTA RecName: Full=Putative 8-amino-7-oxononanoate
   43::377     3e-32  34%  386 aa  BIKB_MYCBP RecName: Full=Putative 8-amino-7-oxononanoate
   43::377     3e-32  34%  386 aa  BIKB_MYCBO RecName: Full=Putative 8-amino-7-oxononanoate
  219::592     6e-32  29%  642 aa  HEM1_RAT RecName: Full=5-aminolevulinate synthase, nonspecific,
   42::375     7e-32  28%  414 aa  HEM1_RICPR RecName: Full=5-aminolevulinate synthase;       
  171::533     9e-32  30%  562 aa  SPTC2_HUMAN RecName: Full=Serine palmitoyltransferase 2;       
  169::531     2e-31  30%  560 aa  SPTC2_CRIGR RecName: Full=Serine palmitoyltransferase 2;       
  169::531     2e-31  30%  560 aa  SPTC2_MOUSE RecName: Full=Serine palmitoyltransferase 2;       
  115::520     6e-31  27%  561 aa  LCB2_YEAST RecName: Full=Serine palmitoyltransferase 2;       
   42::375     1e-30  27%  414 aa  HEM1_RICTY RecName: Full=5-aminolevulinate synthase;       
  250::585     4e-30  29%  647 aa  HEM1_BOVIN RecName: Full=5-aminolevulinate synthase, nonspecific,
   43::360     4e-30  35%  379 aa  BIKB_METS4 RecName: Full=Putative 8-amino-7-oxononanoate
  181::508     7e-30  30%  558 aa  HEM1_SCHPO RecName: Full=5-aminolevulinate synthase, mitochondrial;
  230::565     1e-29  28%  627 aa  HEM1_OPSTA RecName: Full=5-aminolevulinate synthase, nonspecific,
  243::578     2e-29  29%  640 aa  HEM1_DELLE RecName: Full=5-aminolevulinate synthase, nonspecific,
  243::590     3e-29  29%  640 aa  HEM1_PONAB RecName: Full=5-aminolevulinate synthase, nonspecific,
  243::590     3e-29  29%  640 aa  HEM1_HUMAN RecName: Full=5-aminolevulinate synthase, nonspecific,
  219::580     3e-29  28%  642 aa  HEM1_MOUSE RecName: Full=5-aminolevulinate synthase, nonspecific,
  114::519     8e-29  26%  562 aa  LCB2_KLULA RecName: Full=Serine palmitoyltransferase 2;       
   46::380     8e-29  26%  389 aa  CQSA_VIBCH RecName: Full=CAI-1 autoinducer synthase;       
  142::484     1e-28  30%  564 aa  HEM1_CANAL RecName: Full=5-aminolevulinate synthase, mitochondrial;
   43::380     2e-28  34%  386 aa  BIKB_PHEZH RecName: Full=Putative 8-amino-7-oxononanoate
  245::585     3e-28  28%  635 aa  HEM1_CHICK RecName: Full=5-aminolevulinate synthase, nonspecific,
  128::466     8e-28  36%  513 aa  HEM0_CHICK RecName: Full=5-aminolevulinate synthase,
  134::488     4e-27  28%  556 aa  HEM1_ASHGO RecName: Full=5-aminolevulinate synthase, mitochondrial;
  102::450     7e-27  29%  530 aa  HEM1_CANGA RecName: Full=5-aminolevulinate synthase, mitochondrial;
  199::556     1e-26  29%  648 aa  HEM1_EMENI RecName: Full=5-aminolevulinate synthase, mitochondrial;
   77::468     2e-26  28%  548 aa  HEM1_YEAST RecName: Full=5-aminolevulinate synthase, mitochondrial;
   50::378     6e-26  27%  393 aa  CQSA_VIBHB RecName: Full=CAI-1 autoinducer synthase;       
  184::534     1e-24  27%  629 aa  HEM1_NEUCR RecName: Full=5-aminolevulinate synthase, mitochondrial;
   27::351     1e-24  32%  373 aa  BIKB_HELPY RecName: Full=Putative 8-amino-7-oxononanoate
  148::502     2e-24  28%  570 aa  HEM1_KLULA RecName: Full=5-aminolevulinate synthase, mitochondrial;
  163::508     6e-23  25%  563 aa  SPTC3_MOUSE RecName: Full=Serine palmitoyltransferase 3;       
  151::506     3e-22  26%  621 aa  HEM1_AGABI RecName: Full=5-aminolevulinate synthase, mitochondrial;
   43::360     2e-21  30%  389 aa  BIKB_MYCUA RecName: Full=Putative 8-amino-7-oxononanoate
   43::360     3e-21  30%  389 aa  BIKB_MYCMM RecName: Full=Putative 8-amino-7-oxononanoate
  153::495     6e-21  27%  575 aa  HEM1_DEBHA RecName: Full=5-aminolevulinate synthase, mitochondrial;
  167::519     2e-20  25%  563 aa  HEM1_YARLI RecName: Full=5-aminolevulinate synthase, mitochondrial;
   84::295     6e-20  27%  473 aa  SPTC1_PONAB RecName: Full=Serine palmitoyltransferase 1;       
   84::295     6e-20  27%  473 aa  SPTC1_MACFA RecName: Full=Serine palmitoyltransferase 1;       
   84::295     1e-19  27%  473 aa  SPTC1_HUMAN RecName: Full=Serine palmitoyltransferase 1;       
   27::351     4e-19  29%  373 aa  BIKB_HELPJ RecName: Full=Putative 8-amino-7-oxononanoate
   93::295     7e-19  27%  473 aa  SPTC1_MOUSE RecName: Full=Serine palmitoyltransferase 1;       
   93::295     9e-19  27%  473 aa  SPTC1_CRIGR RecName: Full=Serine palmitoyltransferase 1;       
   86::286     2e-18  27%  479 aa  SPTC1_DICDI RecName: Full=Serine palmitoyltransferase 1;       
  149::366     2e-18  30%  558 aa  LCB1_YEAST RecName: Full=Serine palmitoyltransferase 1;       
   84::295     3e-18  25%  473 aa  SPTC1_BOVIN RecName: Full=Serine palmitoyltransferase 1;       
  125::324     3e-16  25%  509 aa  LCB1_SCHPO RecName: Full=Serine palmitoyltransferase 1;       
   62::199     5e-07  31%  401 aa  CSD_CHLTR RecName: Full=Probable cysteine desulfurase;       
   26::273     2e-06  26%  406 aa  ASTC_ECOUT RecName: Full=Succinylornithine transaminase;       
   26::273     2e-06  26%  406 aa  ASTC_ECOL6 RecName: Full=Succinylornithine transaminase;       
   26::273     2e-06  26%  406 aa  ASTC_ECOL5 RecName: Full=Succinylornithine transaminase;       
   26::273     2e-06  26%  406 aa  ASTC_ECOK1 RecName: Full=Succinylornithine transaminase;       
   26::273     2e-06  26%  406 aa  ASTC_ECO81 RecName: Full=Succinylornithine transaminase;       
   26::273     2e-06  26%  406 aa  ASTC_ECO45 RecName: Full=Succinylornithine transaminase;       
   62::199     5e-06  31%  400 aa  CSD_CHLMU RecName: Full=Probable cysteine desulfurase;       
   67::197     1e-04  31%  392 aa  SPSS_METKA RecName: Full=Sep-tRNA:Cys-tRNA synthase;       
   67::195     4e-04  30%  480 aa  YAAO_BACSU RecName: Full=Uncharacterized protein yaaO;
  207::282     6e-04  33%  411 aa  ARGD_XYLFA RecName: Full=Acetylornithine aminotransferase;       
  210::282     8e-04  33%  411 aa  ARGD_XYLFT RecName: Full=Acetylornithine aminotransferase;       
    1::385

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSWQQRVDDALTARRVTDTLRRRYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFX
BIOF_SALHS      MSWQQRVDDALTARRVTDTLRRRYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFX
BIOF_SALTY      MSWQQRVDDALTARRVTDTLRRRYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFX
BIOF_SALTI      MSWQQRVXXXXXXXXXXXXXXXXYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFX
BIOF_SALG2      MSWQQRVXXXXXXXXXXXXXXXXYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFX
BIOF_SALEP      MSWQQRVXXXXXXXXXXXXXXXXYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFX
BIOF_SALSV      MSWQQRVXXXXXXXXXXXXXXXXYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAAMRFX
BIOF_SALCH      MSWQQRVXXXXXXXXXXXXXXXXYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFX
BIOF_SALPK      MSWQQRVXXXXXXXXXXXXXXXXYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAAIRFX
BIOF_SALPA      MSWQQRVXXXXXXXXXXXXXXXXYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAAIRFX
BIOF_SALDC      MSWQQRVXXXXXXXXXXXXXXXXYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFX
BIOF_SALA4      MSWQQRVXXXXXXXXXXXXXXXXYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAAIRFX
BIOF_SALPB      MSWQQRVXXXXXXXXXXXXXXXXYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFX
BIOF_SALNS      MSWQQRVXXXXXXXXXXXXXXXXYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFX
BIOF_SALPC      MSWQQRVXXXXXXXXXXXXXXXXYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFX
BIOF_SALAR      MSWQQRVXXXXXXXXXXXXXXXXYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFX
BIOF_CITK8      MTWQQKIDDALTARRSADALRRRYAVTQGAGRWLVANERQYLNFSSNDYLGLSHHPQIIRAWQQGAERFX
BIOF_ENT38      MTWQQRITTALEKRRATDAFRVRTVVEGGAGRFLIRDQCQFCNFSSNDYLGLSQHPAIVRAWQDGAERYX
BIOF_ECOLU      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSCNDYLGLSHHPDIIRAWKQGAEQFX
BIOF_ESCF3      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADECQYLNFSSNDYLGLSHHPDIIRAWKQGAEQFX
BIOF_ECOSM      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRHYLNFSSNDYLGLSHHPQIIRAWKLSAEQFX
BIOF_ECO5E      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWKQGAEQFX
BIOF_ECO57      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWKQGAEQFX
BIOF_ECO8A      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFX
BIOF_ECOLC      MSWQDKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWKQSAEQFX
BIOF_ECOHS      MSWQDKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWKQSAEQFX
BIOF_SHIDS      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWKQGAEQFX
BIOF_ENTAG      MSWQQRIXXXXXXXXXXXXXXXXXVVEQGAGRWLTVGDSRYCNFSSNDYLGLSQHPAIVRAWQQGAEQYX
BIOF_SHIBS      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFX
BIOF_SHIB3      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFX
BIOF_ECOLI      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFX
BIOF_ECODH      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFX
BIOF_ECOSE      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFX
BIOF_ECO24      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFX
BIOF_ECO55      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFX
BIOF_ECO27      MSWQEKIXXXXXXXXXXXXXXXXYPVAQGAGRWLVADDCQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFX
BIOF_SHIFL      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWKQGAEQFX
BIOF_SHIF8      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWKQGAEQFX
BIOF_SHISS      MSWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEKFX
BIOF_ECOL6      MIWQEKIXXXXXXXXXXXXXXXXYPVAQGAGRWLVADDCQYLNFSSNDYLGLSHHPQIIRAWQQGADQFX
BIOF_ECOL5      MIWQEKIXXXXXXXXXXXXXXXXYPVAQGAGRWLVADDCQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFX
BIOF_ECO81      MIWQEKIXXXXXXXXXXXXXXXXYPVAQGAGRWLVADDCQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFX
BIOF_ECOUT      MIWQEKIXXXXXXXXXXXXXXXXYPVAQGAGRWLVADDCQYLNFSSNDYLGLSHHPQIIRAWQQGADQFX
BIOF_ECOK1      MIWQEKIXXXXXXXXXXXXXXXXYPVAQGAGRWLVADDCQYLNFSSNDYLGLSHHPQIIRAWQQGADQFX
BIOF_ECO45      MIWQEKIXXXXXXXXXXXXXXXXYPVAQGAGRWLVADDCQYLNFSSNDYLGLSHHPQIIRAWQQGADQFX
BIOF_ECO7I      MSWQDKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWKLGAEQFX
BIOF_KLEP3      MTWQQRIERALDERQQTDAFRRRLPVSHGAGRWLEREGERWLNFSSNDYLGLSQHAGIIAAWQQGAERXX
BIOF_ERWCT      MSWQQRIEAALVQRQHDDAYRVRQSNQGGSGRWLIQGDRCYLNFSSNDYLGLSHHPEIVRAWQQXXXXXX
BIOF_YERE8      MSWQNKIDLGLQQRHEAAAYRCRQVNDGANGRWLQTGAQQYLNFSSNDYLGLSQDAAVIAAWQQGAQRXX
BIOF_PHOLL      MDWSSYLSRQLSERRSTSLWRQRQVNQKSDGRFLYAADGKYLNFSSNDYLGLSANPAIISAWQRXXXXXX
BIOF_ENTS8      MTWQARIDAALRAREASHSLRRRVVCTPAPGGALVHQGVRYRNFSGNDYLGLSQHPALIAAWQQGAQTXX
BIOF_KLEP7      MSWQQXXXXXXXXXXXXXXXXXXXPVTHGAGRWLEREGERWLNFSSNDYLGLSQHPAIIAAWQQGATRXX
BIOF_PROMH      MSWQNYLDKRLNERRNTPLWRKRQVIQHSNGRYLTTSGDKYVNFSGNDYLGISQHPDVIQAWQRXXXXXX
BIOF_SERP5      MSWQQRIEQALEERQQSAAYXXXXXXXXXXXXYIQLNGEHYLNFSGNDYLGLSQNAQVIAAWXXXXXXXX
BIOF_SODGM      --WMARIDDALAQRRREQTYRERWALSGGNDRLIRDGDRQYLNFSSNDYLGLARHPEVIXXXXXXXXXXX
BIOF_SERMA      MSWQQRIEQALAERRLNAAYRRRQTTEGGNGRQIRLGDRLYLNFSGNDYLGLSQDARVIAAWQQGA-RYX
BIOF_YERPS      MSWQDKIAQGLQRRRDAAAYRTRQVNEGANGRWLQSGERQYLNFSSNDYLGLSQNDEVIAAWQQXXXXXX
BIOF_YERPB      MSWQDKIAQGLQRRRDAAAYRTRQVNEGANGRWLQSGERQYLNFSSNDYLGLSQNDEVIAAWQQXXXXXX
BIOF_YERPY      MSWQDKIAQGLQRRRDAAAYRTRQVNEGANGRWLQSGERQYLNFSSNDYLGLSQNDEVIAAWQQXXXXXX
BIOF_YERP3      MSWQDKIAQGLQRRRDAAAYRTRQVNEGANGRWLQSGERQYLNFSSNDYLGLSQNDEVIAAWQQXXXXXX
BIOF_ERWT9      MAWSQRIEQALVKRRLDGQYRQRHPTGQADGRTLSVAGHNYLNFSANDYLGLSHDGRVVRAWQQGAERYG
BIOF_PHOPR      --FNHKIKHALEARETQGLYRQRACLSR-ADQSVYHQGTSLLNFSSNDYLGLAQDPAILSAWQEGLTLFG
BIOF_YERPP      MSWQDKIAQGLQRRRDAAAYRTRQVNEGANGRWLQSGERQYLNFSSNDYLGLSQNDEVIAAWQQXXXXXX
BIOF_YERPN      MSWQDKIAQGLQRRRDAAAYRTRQVNEGANGRWLQSGERQYLNFSSNDYLGLSQNDEVIAAWQQXXXXXX
BIOF_YERPG      MSWQDKIAQGLQRRRDAAAYRTRQVNEGANGRWLQSGERQYLNFSSNDYLGLSQNDEVIAAWQQXXXXXX
BIOF_YERPE      MSWQDKIAQGLQRRRDAAAYRTRQVNEGANGRWLQSGERQYLNFSSNDYLGLSQNDEVIAAWQQXXXXXX
BIOF_YERPA      MSWQDKIAQGLQRRRDAAAYRTRQVNEGANGRWLQSGERQYLNFSSNDYLGLSQNDEVIAAWQQXXXXXX
BIOF_VIBPA      -AFKSRIESALAARKAQGLNRSMNVVFAGNQSILEHEGRRYINFSSNDYLGLANDQALVRAWQQGLSVYG
BIOF_VIBSL      --FKSRIKSALVHRREQGLTRQLKVLENSNGPLLTSEGSSFINFSSNDYLGLANDSELVDAWQVGLSQYG
BIOF_ALISL      -AFSERISSALTLRKQAGLTRARTVIEQGNQSRLSVDGKSYLNFSGNDYLGLAGSQELTQAWQQXXXXXX
BIOF_VIBF1      -AFNQRISSALNQRKQAGLNRSRRVVSQGNQATLVVDGKSYLNFSGNDYLGLASSKELMEAWQEXXXXXX
BIOF_VIBFM      -AFNQRIRSALNQRKQAGLNRSRRVVSQGNQATLVVDGKSYLNFSGNDYLGLASSKELMEAWQEXXXXXX
BIOF_BUCBP      MNWNKRINHKLNMHIFNKKFRVKVAVQKNNNRIINVNGMQYINFSSNDYLGLRNNARIVQAWKTAATRXX
BIOF_VIBHB      -AFKSRIESALADRKAQGLNRSINVVFSGNQSILECEGRRYINFSSNDYLGLANDQALVRAWQQGLSVYG
BIOF_VIBVU      -AFNERIAQALKQRREQGLSRQSEVIFSGNQTVLEHQGKRYLNFSANDYLGLANDQSLVRAWQQGLSLYG
BIOF_VIBVY      -AFNERIVQALKQRREQGLNRQSEVIFSGNQTVLEHQGKRYLNFSANDYLGLANDQSLVRAWQQGLSLYG
BIOF_VIBCH      LRFKSRIEQALNEREHSRLTRRLQLLDRSAQGELIQQDRTYLNFSSNDYLGLANDAELVQAWQTGLARFG
BIOF_AERHH      ---------ALSEREQAGLLRSRIATDGASGGRLRVAGRDYLNFSANDYLGLAGHSAIKTAFQGGIDRYG
BIOF_MARMS      ---------ALEERRQQDLMRRTITLDSPQIPHTQIHSQDYTAFCSNDYLGLANHPKLIKALNDTAQAYG
BIOF_AERS4      ------------------------------GRLQVA-GRDYLNFSANDYLGLADHSTIKAAFKEGIDCYG
BIOF_THISH      ----------LEQRRAKGLYRSRRVLEGRQTPEQVVDGRQVIAFCSNDYLGLASHPKVIAALRKGASEYX
BIOF_MARAV      -------------RKQAGLYRTRRLIAGPQQPTLTADGRSLLSFCSNDYLGLASHGENMRALEQALPEVG
BIOF_HERAR      ------------------------------------DGRSLLSFCSNDYLGLAAEPTLIDAAREAALRWX
BIOF_HAHCH      MSKWGHLAQTLTARKQQDLYRSRLTIDSPQAPRVMIEGREYLAFCSNDYLGLANDPRLIAAAQQALSEFG
BIOF_PSEPF      --------------------RQRPLLESPQGPQVVVDGQPLLAFCNNDYLGLANHPQVIEAWRAGASKWG
BIOF_PSEE4      --------------------RQRPLLQSPQGPQVVVDGQPLLAFCSNDYLGLANHPDVIQAWRAGAERWG
BIOF_SACD2      -------------RKAINRYRSRRVALSPSGVRMRVEGKELIAFCSNDYLGLAQHPKVIEAFTQAARHYG
BIOF_NITMU      ----------LRSRGNRSLYRYRLTLESPQAPRITVSGREYLAFCSNDYLGLANHPELIAALCEGATQYG
BIOF_PSEF5      --------------------RQRPLLQSPQGPQVVVDGQPLLAFCNNDYLGLANHPQVIEAWRSGASRWG
BIOF_PSE14      ----------LDARRAEHLYRQRPLLQSPQGPQVVVDGQPLLAFCNNDYMGLANHPEVIAAWQAGAERWG
BIOF_PSESM      ----------LDARRTAHLYRQRPLLQSPQGPHVIVDGQPLLAFCNNDYMGLANHPEVIAAWQAGAERWG
BIOF_ALCBS      -----------------------------SGRHALLGGRQYLNFCSNDYLGLANDPAVVAAFQQGAADWG
BIOF_PSEU2      --------------------RQRPLLQSPQGPQVIVDGQPLLAFCNNDYMGLANHPEVIAAWQAGAERWG
BIOF_NITEC      --------EALQQRRQEGLYRFRQVLEGPQSPRVTIDGRDFLAFCSNDYLGLANHPALIEAVAAGAQRYG
BIOF_AZOSE      ------------------------------------DGRDMLAFCSNDYLGLAANPALTRALQTGAVHWG
BIOF_XYLFT      ---------------------------------LEINGSWLVEFCSNDYLGLAQHFEIIAALQDAAARNG
BIOF_XYLFM      ---------------------------------LEINGSWLVEFCSNDYLGLAQHFEIIAALQDAAARNG
BIOF_XYLF2      ---------------------------------LEINGSWLVEFCSNDYLGLAQHFEIIAALQDAAARNG
BIOF_PSEU5      ----------LAARRAEHLYRRRPLLQSPQGPEVTVDGERLLAFSSNDYLGLANHPEVIAALQQGAATWG
BIOF_DECAR      --------------------RRRRVLETPCGRMATVDGTNLLNFASNDYLGLAGNADIARVLADGALQWG
BIOF_THICR      -SIKNRFAPVLAKREAEALYRRRPLVTSPQTAEMQINGLQVINFSSNDYLGLANHPALKHSCETIQD-LS
BIOF_BURPP      ---------------------------------MTVDGRAIIGFASNDYLGLAAHPQLIAAIAEGAQRYX
BIOF_BURXL      ---------------------------------MTVDGRAIIGFASNDYLGLAAHPQLIAAIAEGAQRYX
BIOF_ALHEH      ------LSEGLAARRAEGLYRSPRVLKSVDGACLTADGRTVVVFCANDYLGLASDPRPGRVMARVAEEQG
BIOF_GEOUR      ----QTFAEELAALRMEGLFRSMRLVEGNQSKRAVLDGREVLLLCSNNYLGLADHPLLKEAAIRAVERYG
BIOF_GEOBB      --------------------RSMRVIKGAQGSRVELDGKQVLMLCSNNYLGLADHPEL-RXXXXXXXXXX
BIOF_METFK      -------------------LRQRRVLHGMQGVYVEIEGKRLLSFCSNDYLGLASHPSLISAMRDCAVTTG
BIOF_NITOC      ----------LRQRQTQSLYRYRRVLEGPQGAELQMDGRRILAFCSNDYLGLANHPATRAAFMQGVREYG
BIOF_PSEAB      ----------LASRRAEDLYRQRPLLESAQGPDVVVDGQPLLAFCSNDYLGLANHPEVIAALRAGAERWG
BIOF_PSEA8      ----------LASRRAEDLYRQRPLLESAQGPDVVVDGQPLLAFCSNDYLGLANHPEVIAALRAGAERWG
BIOF_AZOSB      ----------------------------------LVDGREMLAFCSNDYXXXXXXXXXXXXXXXXXXXXX
BIOF_GEOMG      ---------------------RRIAGSQGSRA--VVDGKEALLLCSNNYLGLADHPRLAEAAIRAVERYG
BIOF_BURP8      --------------------RRRRTVDSPCSAHMTVDGRNMIGFASNDYLGLAAHPLLVAAITEXXXXXX
BIOF_PSEPG      --------------------RQRPLLESPQGPEVVVDGQRLLAFCSNDYLGLANHPEVISAWQAGAERWG
BIOF_XYLFA      ---------------------------------LEINGSWLVEFCSNDYLGLAQHFEIIAALQDAAARDG
BIOF_PSEAE      ----------LASRRAEDLYRQRPLLESAQGPDVVVDGQPLLAFCSNDYLGLANHPEVIAALRAGAERWG
BIOF_PSEPW      --------------------RQRPLLQSPQGPNVVVDGQPLLAFCSNDYLGLANHPEVIAAWQAGAERWG
BIOF_BURM1      --------------------RVRRTADSACDAHMTVNGREIVGFASNDYLGLAAHPKLVAAFAEGAQRYX
BIKB_GEOKA      --------------------KRQLRRAEASGATVILNGKPMLNLASNNYLGLADDRRLIEAGCEAMRAYG
BIOF_PSEMY      ----------LAERQAADLFRQRPLLQTPQGPQVRADDQELLAFCSNDYLGLANHPEVIRALQLGAEKWG
BIOF_NITEU      ------LSEALRERQQEGLYRSRPVLEGPQSPHVTIDGRDFLAFCSNDYLGLANHPALIEAAAEGARCYG
BIOF_ACIF5      ----------LSALRAHDLWRELQVLQRGPPTFVGTRGEPLLSFASNDYLGLSAESALRDAAIAEIQQSX
BIOF_ACIF2      ----------LSALRAHDLWRELQVLQRGPPTFVGTRGEPLLSFASNDYLGLSAESALRDAAIAEIQQSX
BIOF_BURCM      ------------------------------------DGRDIVGFASNDYXXXXXXXXXXXXXXEGARRYX
BIOF_RALME      -----------------------------------------LTFCSNDYLGLANHGSIAHALAEGAHRYG
BIOF_PSEPK      --------------------RQRPLLESPQGPEVVVDGQRLLAFCSNDYLGLANHPEVIAAWQAGAERWG
BIKB_DESAP      ------------------------------------NGREVTLFCTNNYLGLTHHPRVTARAQEALRKYG
BIOF_RALEH      -----------------------------------------LTFCSNDYMGLANHPDVIAALVEGAQRYG
BIOF_CHRVO      -------------------LRRRATLESPQGDEVVIDGRSYISFASNDYLGLADHPSLVRALQQGADRWG
BIOF_BURA4      ------------------------------------DGRDIVGFASNDYXXXXXXXXXXXXXXEGARRYX
BIOF_GEOSF      ----QTFGEELESLRAAGLFRSMRLVEGEQSSRIILDGREVLLLCSNNYLGLADHPLLKEAAIRAVERFG
BIOF_BURCC      --------------------RVRRIAYTACDAHMTVNGREIVGFASNDYXXXXXXXXXXXXXXEGAQRYX
BIOF_GEOSL      -------------------------VAGSQGSRVVAEGREVVLLCSNNYLGLADHPSLKRAAVEAVERYG
BIOF_CELJU      ----QTLAAALSERRAQYRYRQRKLLQSPQTPELVVDGKTYLAFCSNDYLGLANHPQVIXXXXXXXXXXX
BIOF_JANMA      --------DAQSLRR-----RRRTTESPCAPRVQV-DGRAMLAFCSNDYLGLAAHPRIIDALQQXXXXXX
BIOF_BURCH      --------------------RVRRIADTACDARMIVNRREIVGFASNDYXXXXXXXXXXXXXXEGAQRYX
BIOF_BURCA      --------------------RVRRIADTACDARMIVNRREIVGFASNDYXXXXXXXXXXXXXXEGAQRYX
BIOF_GEOLS      -------------------------------------GRQALLFCSNNYLGLAEHPSXXXXXXXXXXXYG
BIKB_PELCD      --WQKTLDHL----RDEEMLRGLKTVSGAQRDHVLLDGKDVLLLCSNNYLGLADHPALIEATCRATRDCG
BIOF_BACSU      ------------------------------------DGENQTVWSSNNYLGLASDRRLIDAAQTALQQFX
BIOF_PSEA7      ----------LAARRAEDLYRQRPLLQSAQGPDVVVDGQPLLAFCSNDYLGLASHPEVIAALRAGAERWG
BIOF_METCA      ---------ALAEIKARDAYRWRRIVESPQDTRVVIDGAPRVNFCSNDYLGLANHPAVREAFRRGVDRWG
BIOF_BURPS      --------------------RCRRVADTACGAHMTVDGRAIIGFASNDYLGLAAHPRLVEAFAEGARRYX
BIOF_BURP6      --------------------RCRRVADTACGAHMTVDGRAIIGFASNDYLGLAAHPRLVEAFAEGARRYX
BIOF_BURP0      --------------------RCRRVADTACGAHMTVDGRAIIGFASNDYLGLAAHPRLVEAFAEGARRYX
BIOF_BURMS      --------------------RCRRVADTACGAHMTVDGRAIIGFASNDYLGLAAHPRLVEAFAEGARRYX
BIOF_BURMA      --------------------RCRRVADTACGAHMTVDGRAIIGFASNDYLGLAAHPRLVEAFAEGARRYX
BIOF_BURM9      --------------------RCRRVADTACGAHMTVDGRAIIGFASNDYLGLAAHPRLVEAFAEGARRYX
BIOF_BURM7      --------------------RCRRVADTACGAHMTVDGRAIIGFASNDYLGLAAHPRLVEAFAEGARRYX
BIOF2_POLSJ     --------------------QRRIAESPCAPRWVSQDGREMLAFCSNDYLGLANHPALVEALAEGARQFG
BIOF_BURTA      --------------------RRRRIADTACSAHMSVDGREIVGFASNDYLGLAAHPRLIEAFAEXXXXXX
BIOF_BURP1      --------------------RCRRVADTACGAHMTVDGRAIIGFASNDYLGLAAHPRLVEAFAEGARRYX
BIOF_PSEP1      --------------------RQRPLLESPQGPEVVVDGQRLLAFCSNDYLGLANHPEVITAWQAGAERWG
BIOF_CUPTR      -----------------------------------------LTFCSNDYLGLANHPQVIAALVEGAQRYG
BIOF_BURCJ      --------------------RVRRIADTACDARMTVNGREIVGFASNDYXXXXXXXXXXXXXXEGAQRYX
BIOF_BURS3      ---------------------------------MTVDGREIVGFASNDYXXXXXXXXXXXXXXEGAQRYX
BIOF_BACLD      --------------RIDEWLSSRLAKTKAAGRSLKLPQAERTNWASNDYLGLANDKRLIHAAETALRRFG
BIOF_RALPJ      --------------------------------------RDILGFCGNDYLGLAAHPALVEAMTQGTQQYG
BIKB_BACHD      --WLHAIEEKLTRLKDRGSFRQLVPTSEAALPWLTRENCRLLNLASNNYLGIADSKEFIERTEQLASSYA
BIKB_EXIS2      ------------------TFRELVALESAQHNRVTVDGKELIQLSSNNYLGLAAHPRLAKRAADAALEFG
BIOF_CHRSD      --WSARLAKAAEQRHADGGWRQRPTLSDVA---------PFIDFAGNDYLGLADDPRXXXXXXXXXXXXX
BIOF_BACSH      --------------------RKLRLFSTGNESEVVMNGKKFLLFSSNNYLGLATDSRLKKKATEGISKYG
BIKB_BACCQ      -TWRTHLQSKLQQLHEREQYRNLHVTEQAEETWLIRDEKRMLNLASNNYLGLAGDERLKEAAIACTRKYG
BIKB_BACC7      -TWRTHLQSKLQQLHEREQYRNLHVTEQAEETWLIRDEKRMLNLASNNYLGLAGDERLKEAAIACTRKYG
BIOF1_POLSJ     ------------------------------GAHLQVDGQRMLAFCSNDYLGLAGHPALVQAACDGARAFG
BIKB_BACC2      --------------------RNLYVTEQAEETWLIRDKKRMLNLASNNYLGLAGDERLKEAAIACTKRYG
BIOF_BACNA      ------------------------------------DGENQTVWSSNNYLGLASDRRLIDAAQTALQQFX
BIOF_STRM5      ------------------------------------DGQWLTGFCSNDYLGLAQQFSVVNALQDXXXXXX
BIOF_STRMK      ---------------------------------LEVDGQWLTGFCSNDYLGLAQQFSVVNALQDXXXXXX
BIKB_BACC4      -TWRAHLQCKLQQLHEQGQYRDLHVTEKAEETWLIRDKKRMLNLASNNYLGLAGDERLKEAAIACTKRYG
BIKB2_BACCR     -TWRAHLQCKLQQLHEQGQYRDLHVTEKAEETWLIRDKKRMLNLASNNYLGLAGDERLKEAAIACTKRYG
BIOF_BACA2      ---------------------------------LKTKGQKRQTWASNDYLGLSKDERLITAAQTAMSRFG
BIKB_BACC1      -TWRTHLQSKLQQLHERGQYRNLHVTEQAEETWLIRDEKRMLNLASNNYLGLAGDERLKEAAIACTRKYG
BIKB_ANOFW      --------------------KRTLIQAESDGCFIHIDGRHLLNFSSNNYLGFAHDERLIHASMEATRRYG
BIKB_ALKOO      ----------------------------------ILNGKKVINLSSNNYLGFANHPRLKKAAIEAVEKYG
BIOF_XANC5      ---------------------------------LEIDGRWLTGFCSNDYLGLSQQFEVVXXXXXXXXXXX
BIKB_BACWK      --WRTHLQSKVEQLKEQGQYRNLHVTEKAEETWLIRNEKRMLNLASNNYLGLAGDERLKEAAIACTRKYG
BIOF_RALEJ      -----------------------------------------LTFCSNDYMGLASHPDVVAALADGARLYG
BIKB_BACCN      -AWNLHFYASLNRLKEKSQYREVVVTNQAEEPWLIRNGARMLNLASNNYLGLAGDSRLKEAAIEAIRTYG
BIOF_LEPCP      -----------------------------------SEARELLAFCSNDYLGLANHPALIGALAEGARLWG
BIOF_XANAC      ---------------------------------LEIDGRWLTGFCSNDYLGLSQQFEVVXXXXXXXXXXX
BIOF_METPP      ---------ALAALDTQQLRRHRRVVSALDGAMVQADTQPRLAFAGNDYLGLSQHPALIEAARQGAARYG
BIKB_BACCZ      --WRTHLQTKLQQLHEQGQYRNLHVTEQAEETWLIRDEKRMLNLASNNYLGLSGDERLKEAAIASTRKYG
BIOF_BURVG      ------------------------------------DGRDIVGFASNDYXXXXXXXXXXXXXXEGAQRYX
BIKB_BACA2      -------------------------------------GENVIQLSSNNYLGLTSHPRLVEAAKRAAEEFG
BIKB_PASMU      ------------------------------GRFIQREDNTMLNMSSNDYLGLANNEALRQAFQYQDQLPA
BIKB_BACHK      --WRTHLQTKLKQLHEQGQYRNLHVTEQAEETWLIRDEKRMLNLASNNYLGLAGDERLKEAAIVCTRKYG
BIOF_MYXXD      -AWAREDLEALSERGL-----RRYLLDSPQGPVVRVGGETLVNFSSNDYLGLAASPTVRAAALAAVERYG
BIKB_DESOH      MSKLDFVEAELEKRRAASRLRTLRPVAPADGAAVTINGARLLNVCSNDYLGLSCHPLLVERXXXXXXXXX
BIKB_BACC0      --WRTHLQTKLKQLHEQGQYRNLHVTEQAEETWLIRDEKRMLNLASNNYLGLAGDERLKEAAIVCTRKYG
BIKB2_BACAN     --WRTHLQTKLKQLHEQGQYRNLHVTEQAEETWLIRDEKRMLNLASNNYLGLAGDERLKEAAIVCTRKYG
BIOF_XANOR      ---------------------------------LEIDGRWLTGFCSNDYLGLSQQFEVIXXXXXXXXXXX
BIOF_XANOP      ---------------------------------LEIDGRWLTGFCSNDYLGLSQQFEVIXXXXXXXXXXX
BIOF_XANOM      ---------------------------------LEIDGRWLTGFCSNDYLGLSQQFEVIXXXXXXXXXXX
BIKB_BACP2      ------------------------------------NEQSVIQLSSNNYLGLTSHPRLMKAAKEAIDEFG
BIKB_HAEDU      ------------------------------GKWIIAQNRKMLNFSSNDYLGLASDTELQQTFQEAPLHQW
BIKB_BACSU      ------------------------------GPSVTVNHQKVIQLSSNNYLGFTSHPRLINAAQEAVQQYG
BIKB_BACAH      --WRTHLQTKLQQLHEQGQYRNLHVTEQAEETWLIRDEKRMLNLASNNYLGLAGDERLKEAAIVCTRKYG
BIOF_CLOTH      -------------------------VNAAQGPYTVIDGRKMLMMSSNNYLGLCDDIRLKRAAIESIRKFG
BIOF_XANCB      ---------------------------------LEIDGRWLTGFCSNDYLGLSQQFEVVXXXXXXXXXXX
BIKB_ALKMQ      ---------------------------------IMLNGKKVINLSSNNYLGFANHPQIKKAAIDAVEKYG
BIOF_XANCP      ---------------------------------LEIDGRWLTGFCSNDYLGLSQQFEVVXXXXXXXXXXX
BIOF_XANC8      ---------------------------------LEIDGRWLTGFCSNDYLGLSQQFEVVXXXXXXXXXXX
BIKB_SYMTH      ----------------------------------IIDGREVINLSSNNYLGLADDPRLKQAMIEATEAYG
BIOF_THIDA      -----RLEHGLAALKADHLARRRPLLDGAQGAHVTIDGRRVVSFCSNDYLGXXXXXXXXXXXXXXXDGCG
BIKB_HAEPS      ------------------------------GKFVIARDLTMLNLSSNDYLGLANDAQQVERFLQSIGKNQ
BIOF_ANASK      --------------------------------------RALVNLCSNDYLGLXXXXXXXXXXXXXXMRFG
BIKB_COPPD      ------------------------------GAWIIVDGKKVLNLSSNNYLGFANHPRLKEAAKKGIDDYG
BIOF_BORPD      MQLLDNLDAALRKLDAQHLRRRRRTAESPCAPHVRVDGRDMLAFCSNDYLGLAAHPVIVXXXXXXXXXXX
BIKB_THEYD      ------------------------------GMEITIQGKKYINFASNDYLGLSQHPLVKEAGIDAIKTFX
BIKB_THEP3      ------IKEKLEELKKAGVYRKLTVLESPSGPRSIIDGKEVINLSSNNYLGLANHPRLKKAAIEAIEKWG
BIKB_GLOVI      -----------------------------AGPQMDVDGKPVLQFASNDYLGLSGDERLIEAACRAVRLYG
BIKB_THEPX      ------IKEKLEELKKAGVYRKLTVLESPSGPRSIIDGKKVINLSSNNYLGLANHPRLKKAAIEAIEKWG
BIKB_PARL1      --------DALEAQ----ALRRRLVTDRREGAIAFREGRRLVSFCCNDYLNLSQHPDVKRAAVEATGKYG
BIKB_METJA      -----------------EKLRREIEIIKNNGRFLRKKDDGVLDFSSNDYLCLSKHPEVIEAVKEGLK--Y
BIKB_THET8      -------------------------------------GREVVNLASNNYLGFANHPYLKEKARQYLEKWG
BIOF_PELPD      ------VQDELEQIRAKGLFRSTRLIQGRQSARVTMEGRQXXXXXXXXXXXXAEHPALIAASMAAAEQFX
KBL_ECOLI       --YQQLTNDLETARAEGLFKEERIITSAQQADITVADGSHVINFCANNYLGLANHPDLIAAAKAGMDSHG
BIKB_SHIFL      --YQQLTNDLETARAEGLFKEERIITSAQQADITVADGSHVINFCANNYLGLANHPDLIAAAKAGMDSHG
BIKB_ECO57      --YQQLTNDLETARAEGLFKEERIITSAQQADITVADGSHVINFCANNYLGLANHPDLIAAAKAGMDSHG
BIKB_SALTY      --YKQLTNDLETARAEGLFKEERIITSAQQADITVADGSHVINFCANNYLGLANHPELINAAKAGMDSHG
BIOF_ANAD2      --------------------------------------RALVNLCSNDYLGLXXXXXXXXXXXXXXMRFG
BIKB_THEM4      ------------------------------GAWLVIDGKKVLNLCSNNYLGFANEERLKNAAKQAVEKWG
BIKB_GLUDA      ------------------------------------DGASLLDFSSNDYLGLSHHPALRARAIDWTERFG
BIOF_POLNA      ------------------TRQRRIAESPCAPRQRVSQARDLLAFCSNDYLGLANHPALVRALAEGAQLYG
BIKB_OCEIH      ---------------------------QGAGPEITIEGKKLINLSSNNYLGLATNNEMKEIAKKAIDSHG
BIOF_DESDA      --------------RAAHLYRRLRTLSTPQDREVVIDGRRVLLFSSNSYLGLGINAHIRRSAVRALEKFG
BIKB_ACAM1      ------------------------------GPTAVLNGQTVINFASNDYLGLAGDSRLAEAAIAAINTYX
BIKB_HAEIE      ------------------------------GRYIMRENRKMLNMSSNDYLGLASNENLRQSFQQYGGNFP
BIOF_ANADF      LDWIDRELEALEAKGLRRALEP---LASPQGPVVEVGGRRLVNLCSNDYLGLAADPRLXXXXXXXXXXXX
BIKB_CHLP8      --------------------RYRTLPETGAGPYITVGGRELLNLSSNDYLGLGSEPKLLASWMAADGRFA
BIKB_THEAB      ------------------------------GAWLTINGKKVLNLCSNNYLGFANEERLKKAAIEAIEKWG
BIKB_TREDE      ----------------------------------VINGKKVINLSSNNYLGFANHPRLKKAAIEAIEKYG
BIKB_HAEIG      ------------------------------GRYIMRENRKMLNMSSNDYLGLASNENLRQSFQQYGGNFP
BIKB_HAEI8      ------------------------------GRYIMRENRKMLNMSSNDYLGLASNENLRQSFQQYGGNFP
BIKB_NEIMF      ------------------------------GRYITRENRKMLNMSSNDYLGLASDENLRRSFQQYGGNFP
BIKB_BEII9      ------------------------------GLWISVDGQKLLSFSCNDYLNLTHHPALKAAAIRAIETYG
BIKB_META3      ------------------------------------NNKNYLDFSSNDYLCLSTNKEIIDAIKEGGLKYG
BIKB_MYCS2      -----------------------------------------LDLASNDYLGLSQHPDVLDGGVEALRTWG
BIKB_HAEIN      ------------------------------GRYITRENRKMLNMSSNDYLGLASNENLRQSFQQYGGNFP
KBL_MOUSE       ------LDSELEGIRGAGTWKSERVITSRQGPSIRVDGISILNFCANNYLGLSSHPAVIQAGLQTLEEFG
BIKB_NEIMA      ------------------------------GRYITRENCKMLNMSSNDYLGLASDENLRRSFQQYGGNFP
BIKB_NEIM0      ------------------------------GRYITRENCKMLNMSSNDYLGLASDENLRRSFQQYGGNFP
BIKB_FERNB      ------------------------------GAWIVVNGKRVLNLCSNNYLGFASDERLKQAAKKAIDEWG
BIKB_NEIG2      ------------------------------GRYITRENRKMLNMSSNDYLGLASDENLRRSFQQYGGNFP
BIKB_ACICJ      ---------------------------------LERDGQRLISFSCNDYLNLSTHPXXXXXXXXXXXXXX
BIKB_SYNY3      ------LDDALETIQRAHWHRHPQIITQGPGPEIKLEGQRLVNFASNDYLGLASHPHLKTAAIKAIAEWX
KBL_BOVIN       ------LEEELESIRGAGTWKSERVITSRQGPHIHVDGAPIINFCANNYLGLSSHPEVIQAGLRTLKEFG
BIKB_NEIMB      ------------------------------GRYITRENRKMLNMSSNDYLGLASDENLRRSFQQYGGNFP
BIKB_MAGSM      ---------------------------------VLRDGVELINFSSNNYMGLADHPLLKQRAMAWTEQWG
KBL_HUMAN       -----------------------------------------LNFCANNYLGLSSHPEVIQAGLQALEEFG
BIKB_NEIG1      ------------------------------GRYITRENRKMLNMSSNDYLGLASDENLRRSFQQYGGNFP
BIKB_PETMO      ------------------------------GAWININGKKVLNMCSNNYLGLANNERLKEAAINAIKNWG
BIKB_MAGSA      -----------------------------AGRVRVG-GRELVNFSSNDYLGLSRHPEVVERSRRWLNEYG
BIOF_MARMM      ------------------------------GALVERDGRQLVNACSNDYLGLSQHPXXXXXXXXXXXXXX
BIKB_METVS      -----------------------------------------LNFSTNDYLGLSKNEEVILAYNEGL-KDG
BIOF_DELAS      ---------------------------QGAGAHMEVDGHPMLAFCSNDYLGLAGHPTLVRAACAGAQAFX
BIOF_ACIAC      ------------------------------GAHLDVDGQPMLAFCSNDYLGLAGHPALADAACAGAREFX
BIOF_HALHL      -----------------------------------SDGQRCTVFCGNDYLGXXXXXXXXXXXXEHARRQG
BIKB_SYNP2      ------LETALATIKKANWYRQPKTITSQSGATVTLNGQSVVNFASNDYLGLAGDRRLIDAAIAATEAXX
BIKB_METPB      -----------------------------------------VSFSCNDYLGLAHDPRVIAAASDALRRYG
BIKB_MICAN      -SW---IEDSLKTLHRANWYRRVKTIQGRGGAVIELEGRSLINFASNDYLGLAADERMXXXXXXXTQRYX
BIKB1_BACAN     ------------------------------GPIITIGGKEYINLSSNNYLGLATDSRLQEAAIGAIHKYG
BIKB_CYAP8      ----QWLEKALKTIHQANWYRSVTAITSLPGSTIEIDGNTFINFASNDYLGLAGDPRLIKAAVEATQQFX
BIKB1_BACCR     ------------------------------GPIITIGGKEYINLSSNNYLGLATDSRLQEAAIGAIHKYG
BIKB_METC4      -----------------------------------------VSFSCNDYLGLAHDPRVIAAATEALARYG
BIKB_METRJ      -----------------------------------------VSFSCNDYLGLSHHPRVIXXXXXXXXXXX
BIKB_CAUSK      ---------------------------RSAGVVVERDGRKLLSFSCNDYLGLAHHPKVKAAAQAAIETYG
BIKB_BORPA      ------------------------------------DGRTLVNFSSNDYLGLARHPLLAERASLWATRHG
BIKB_STAAW      ------------------------------------NGKSYINLSSNNYLGLATNEDLKSAAKAAIDTHG
BIKB_STAAS      ------------------------------------NGKSYINLSSNNYLGLATNEDLKSAAKAAIDTHG
BIKB_STAAN      ------------------------------------NGKSYINLSSNNYLGLATNEDLKSAAKAAIDTHG
BIKB_STAAM      ------------------------------------NGKSYINLSSNNYLGLATNEDLKSAAKAAIDTHG
BIKB_STAAC      ------------------------------------NGKSYINLSSNNYLGLATNEDLKSAAKAAIDTHG
HEM1_RHIRD      ---------------------------------------------SNDYLGMGQNPKVIEAMKAAIDHCG
BIKB_METEP      -----------------------------------------VSFSCNDYLGLAHDPRVIAAATEALARYG
BIKB_STAAR      ------------------------------------NGKSYINLSSNNYLGLATNEDLKSAAKAAIDTHG
BIKB_AQUAE      ------------------------------------------DFCSNDYLGLRKHPEVVEESIRVLKEAG
HEM0_OPSTA      --------------RVFKTVNRNAVVFPFAEDYSVSDGSQVSVWCSNDYLGMSRHPRVLEAIREVLERHG
BIKB_METSB      ---------------------------------ILRGGRRLISFSCNDYLNLTHHPAVKSAAIAAINLYG
BIOF_ANADE      -------------------------------------GRALVNLCSNDYLXXXXXXXXXXXXXXXXXXXX
BIKB_THEEB      --------------------------------------RPLINFCSNDYLGLANHPQVKXXXXXXXXXWG
BIKB_CAUCR      --------DAQSLRRRLSPTRRH------DGAVVERDGKRMISFSCNDYLNLSQHHLVRXXXXXXXXXXX
BIKB_CAUCN      --------DAQSLRRRLSPTRRH------DGAVVERDGKRMISFSCNDYLNLSQHHLVRXXXXXXXXXXX
BIKB_ANASP      -AWLQ--NSLLTIHRA-DWYRSVQAIQGRAGASVVLGGQEVINFASNDYLGLAGDERLIAAAVAATQEFX
HEM1_RHOS4      -------------RTFIDIERRKGAFPKAMWRKPDGSEKEITVWCGNDYLGMGQHPVVLGAMHEALDSTG
BIKB_MYCPA      -----------------------------------------LDLASNDYLGLSQHPDVIDGGVAALRMWG
BIKB_ANAVT      -AWLQ--NSLLTIHRA-DWYRSVQTIQGRAGASVVLGGKEVINFASNDYLGLAGDERLIAAAVAATQEFX
HEM1_RHOCA      ----------------------------------------------NDYLGMGQHPVVLAAMHEALEAVG
HEM1_RICBR      ----------------------------------MCDDKQIVMWCINDYLGMSKHPKVVQASIDAVLKYG
BIKB_MYCLE      -----------------------------------------LDLASNDYLGLSQHPDVIDGGVAALRVWG
BIKB_MYCLB      -----------------------------------------LDLASNDYLGLSQHPDVIDGGVAALRVWG
BIKB_CYAP4      -------------------------------------GQRVLNFASNDYLGLAGDQRLIRAAIQATEQXX
HEM1_PARDP      ----------------------------------------------NDYLGMGQHPVVLAAMHEALDATG
HEM0_RHOS4      --------------------------------------RRVTVWCSNDYLGMGQNAEVLAAMHRSIDLSG
BIKB_GRABC      ----QTLDD-FAARRLSALEKRQHETGRDSSPWVMRGERRMLSLSCNDYLNLSTHPATIRAAIDATAQFG
BIKB_CYAP7      ------IEKSLETLHKANWYRSVKTIHSRSGSVVNLKGNLVINFASNDYLGLAGDERLINASIDAIKQYX
HEM1_RHIME      -----------------------------ATRYTADGAQEVTVWCSNDYLGMGQCPIVTEAMKNAIDECG
HEM1_BRAJA      --------------------------------------RDVVIWCSNDYLGMGQHPKVVGAMVEXXXXXX
LCB2_SCHPO      -------------------LMNRYSTDSNSTFKLTGDTSLALNVSSYNYLGFAQHGPCATKVEEAMQKYG
HEM0_DANRE      --------------RIFKTVNRFAEVFPFAEDYSIAGGSQVSVWCSNDYLGMSRHPRVVKAIGDALKKHG
HEM0_PONAB      ---------------------------------------------SNDYLGMSRHPQVLRATQETLQRHG
BIKB_BORPE      ---------------------------------LALDGRTLVNFSSNDYLGLARHPLLAERASLWATRHG
HEM0_DELLE      ---------------------------------------------SNDYLGMSRHPRVLQATQETLQRHG
HEM1_RICCN      --------------------------------------KQIVMWCINDYLGMSKHAKVMHASIDALLKYG
BIKB_BORBR      ------------------------------------DGRTLVNFSSNDYLGLARHPLLAERASLWATRHG
HEM1_RICFE      --------------------------------------KQIVMWCINDYLGMSKHAKVMQASIDALLKYG
HEM0_BOVIN      ---------------------------------------------SNDYLGMSRHPRVLQATQEILQRHG
HEM0_HUMAN      ---------------------------------------------SNDYLGMSRHPQVLQATQETLQRHG
BIOF_RALSO      --------------------------------------REILGFCGNDYLGLAAHPALMQAVGEGARRYG
BIKB_TRIEI      -SW---IESSLSTIHKANWYRSVKTIESIPGAIIKLEGKKLINFASNDYLGLAGDERLIAAAIQATKEFX
BIKB_MYCGI      -----------------------------------------LDLASNDYLGLSQHPRVIDGGVAALRTWG
BIKB_NOSP7      ------LEQSLATIHRADWYRSVQPINGRPGATVVLAGQEVINFASNDYLGLAGDKRLMXXXXXXXXEFX
BIKB_MYCVP      -----------------------------------------LDLASNDYLGLSQHPRVIDGGVSALRTWG
HEM0_RAT        ---------------------------------------------SNDYLGISRHPRVLQAIEETLKNHG
HEM0_MOUSE      ---------------------------------------------SNDYLGISRHPRVLQAIEETLKNHG
BIKB_METNO      -----------------------------------------VSFSCNDYLGLATHPXXXXXXXXXLERYG
BIKB_MYCSJ      -----------------------------------------VDLASNDYLGLSTHPXXXXXXXXXXXXWG
SPTC3_HUMAN     --------------------------------------KDVINMGSYNFLGLAKYDESMRTIKDVLEVYG
SPTC2_DICDI     -----------------------------------------LNLGSYNYLGFAQNEPVADKVIDSIYKYG
BIKB_MYCSS      -----------------------------------------VDLASNDYLGLSTHPXXXXXXXXXXXXWG
BIKB_MYCSK      -----------------------------------------VDLASNDYLGLSTHPXXXXXXXXXXXXWG
BIKB_MYCA1      -----------------------------------------LDLASNDYLGLSQHPDVIDGGVAALRLWG
BIKB_MYCTU      -----------------------------------------LDLASNDYLGLSRHPAVIDGGVQALRIWG
BIKB_MYCTF      -----------------------------------------LDLASNDYLGLSRHPAVIDGGVQALRIWG
BIKB_MYCTA      -----------------------------------------LDLASNDYLGLSRHPAVIDGGVQALRIWG
BIKB_MYCBP      -----------------------------------------LDLASNDYLGLSRHPAVIDGGVQALRIWG
BIKB_MYCBO      -----------------------------------------LDLASNDYLGLSRHPAVIDGGVQALRIWG
HEM1_RAT        --------------RVFKTVNRRAQIFPMADDYTLITKKQVSVWCSNDYLGMSRHPRVCGAVIETVKQHG
HEM1_RICPR      --------------------------------------KQIVMWCINDYLGMSKHVKVMQASIDALLKYG
SPTC2_HUMAN     -----------------------------------------INMGSYNYLGFARNTG---SCQEAAAKVL
SPTC2_CRIGR     -----------------------------------------INMGSYNYLGFARNTG---SCQEAAAEVL
SPTC2_MOUSE     -----------------------------------------INMGSYNYLGFARNTG---SCQEAAAEVL
LCB2_YEAST      ---KMRIDDCFS--RPTTGVPGRFIISHNINEYFTYSGAVYMNLSSYNYLGFAQSKQCTDAALESVDKYS
HEM1_RICTY      --------------------------------------KQIVMWCINDYLGMSKHIKVMQASIDALLEYG
HEM1_BOVIN      --------------------------------------KQVSVWCSNDYLGMSRHPRVCGAVIDTLKQHG
BIKB_METS4      ------------------------------------DGRAVVSFSCNDYLGLATHPEVVAAAHAALDRYG
HEM1_SCHPO      ---------------------------------------------SNDYLNMGGHKKIREAMHQCIETYX
HEM1_OPSTA      --------------------------------------REVSVWCSNDYLGMSRHPRVAQAIMETLRKHG
HEM1_DELLE      --------------------------------------KQVSVWCSNDYLGMSCHPRVCGAVMDTLKQHG
HEM1_PONAB      --------------------------------------KQVSVWCSNDYLGMSRHPRVCGAVMDTLKQHG
HEM1_HUMAN      --------------------------------------KQVSVWCSNDYLGMSRHPRVCGAVMDTLKQHG
HEM1_MOUSE      --------------RVFKTVNRRAQIFPMADDYTLITKKQVSVWCSNDYLGMSRHPRVCGAVMETVKQHG
LCB2_KLULA      ---KQRIDDCFS--RPTTGVPGRFIVSHNLNDYFTYPGTMCLNLSSYNYLGFAQSEQCTTAALEATDKYG
CQSA_VIBCH      ---------------------------------------------SNDYLALANHPLIKARLAKSLLEEQ
HEM1_CANAL      ---------------------------------------------SNDYLGMGKNENTLKEMKRVLDKYG
BIKB_PHEZH      -------------------------------------GRRLVSFSCNDYLGLSHHPAVKXXXXXXXXXXX
HEM1_CHICK      ---------------------------------------------SNDYLGMSRHPRVCGAVMDTLKQHG
HEM0_CHICK      ---------------------------------------------SSDYLGLSRHPXXXXXXXXXXXXXX
HEM1_ASHGO      ---------------------------------------------SNDYLTYSRNEKVMETMKRTIDKYG
HEM1_CANGA      ---------------------------------------------SNDYLALSKNPQVLDAMRKTIDKYG
HEM1_EMENI      ---------------------------------------------SNDYLGMGRNPEVLATMHKTLDTYG
HEM1_YEAST      ------IDSELQKKRLDKSYRYFNNINRLAKEFPLAHRQREADWCSNDYLALSKHPEVLDAMHKTIDKYG
CQSA_VIBHB      ---------------------------------------------SNDYLSLSHNLQIQQAHRDAIYEHD
HEM1_NEUCR      ---------------------------------------------ANDYLGMGRNKHVLEAMHTTLDEYG
BIKB_HELPY      ------------------------------------------DYASNDYLGLSVKKDLLQAFNKLQSFVS
HEM1_KLULA      ---------------------------------------------SNDYLALSKNQEVIEVMKKTLDKYG
SPTC3_MOUSE     -----------------------------------------INMASYNYLGLAKYDDSMVRVKDTLEKYG
HEM1_AGABI      ---------------------------------------------SNDYLGMGNNPVVLETMHRTLDKYG
BIKB_MYCUA      -----------------------------------------LDLASNDYLGLSQHPDVIEGGVQALRIWG
BIKB_MYCMM      -----------------------------------------LDLASNDYLGLSQHPDVIEGGVQALRIWG
HEM1_DEBHA      ---------------------------------------------SNDYLGMGKNENTINEMKRVLTKYG
HEM1_YARLI      ---------------------------------------------ANDYLGMGRNPVVVDAMHETLDKYG
SPTC1_PONAB     ------------------------IVSGPPSHKIVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYG
SPTC1_MACFA     ------------------------IVSGPPSHKIVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYG
SPTC1_HUMAN     ------------------------IVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYG
BIKB_HELPJ      ------------------------------------------DYASNDYLGLSVKKDLLQAFDKLQSFDC
SPTC1_MOUSE     ---------------------------------IVVNGKECVNFASFNFLGLLANPRVKAAAFSSLKKYG
SPTC1_CRIGR     ---------------------------------IVVNGKECVNFASFNFLGLLANPRVKAAALASLKKYG
SPTC1_DICDI     ------------------------IIQESEGTHVTINNKKYLNLARSNYLGLINNPEINKISENAIRKYG
LCB1_YEAST      ------------------------------------------NLASNNFLQLSATEPVKEVVKTTIKNYG
SPTC1_BOVIN     ------------------------IVSGPPSHNIVVNGKECINFASFNFLGLLDNPRXXXXXXXXXXXYG
LCB1_SCHPO      ------------------------------------DGRPITNFASFNFLDLAENKHITECAVATLRECG
CSD_CHLTR       ----------------------------------------------------------------------
ASTC_ECOUT      ------------------------VRGEGSRLW-DQQGKEYIDFAGGNALGHA-HPELREALNEQASKFW
ASTC_ECOL6      ------------------------VRGEGSRLW-DQQGKEYIDFAGGNALGHA-HPELREALNEQASKFW
ASTC_ECOL5      ------------------------VRGEGSRLW-DQQGKEYIDFAGGNALGHA-HPELREALNEQASKFW
ASTC_ECOK1      ------------------------VRGEGSRLW-DQQGKEYIDFAGGNALGHA-HPELREALNEQASKFW
ASTC_ECO81      ------------------------VRGEGSRLW-DQQGKEYIDFAGGNALGHA-HPELREALNEQASKFW
ASTC_ECO45      ------------------------VRGEGSRLW-DQQGKEYIDFAGGNALGHA-HPELREALNEQASKFW
CSD_CHLMU       ----------------------------------------------------------------------
SPSS_METKA      ----------------------------------------------------------------------
YAAO_BACSU      ----------------------------------------------------------------------
ARGD_XYLFA      ----------------------------------------------------------------------
ARGD_XYLFT      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_SALHS      XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_SALTY      XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_SALTI      XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_SALG2      XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_SALEP      XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_SALSV      XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_SALCH      XXXXXXXXXXXXXVAHRALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_SALPK      XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_SALPA      XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_SALDC      XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_SALA4      XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_SALPB      XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_SALNS      XXXXXXXXXXXXXVAHQALEVELAQWLEYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_SALPC      XXXXXXXXXXXXXVAHRALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_SALAR      XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
BIOF_CITK8      XXXXXXXXXXXXXXAHQALEEALAGWLGYSRALLFISGFAANQAVIAALMAKDDRIVADRLSHASLLEAA
BIOF_ENT38      XXXXXXXXXXXYTTAHHALEESLADWLGYSRALLFISGFAANQALIAALMEKDDRIVADRLSHASLLEAA
BIOF_ECOLU      XXXXXXXXXXXXXXAHQALEEELAEWLGYSRALLFISGFAANQAVITAMTAKEDRIVADRXXXXXXXXXX
BIOF_ESCF3      XXXXXXXXXXXXXXAHQALEEELAEWLGYSRALLFISGFAANQAVITAMMAKEDRIVADRXXXXXXXXXX
BIOF_ECOSM      XXXXXXXXXXXXXXAHQALEEELAEWLGYSRALLFISGFAANQAVITAMMAKEDRIVADRXXXXXXXXXX
BIOF_ECO5E      XXXXXXXXXXXXXXAHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_ECO57      XXXXXXXXXXXXXXAHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_ECO8A      XXXXXXXXXXXXXXAHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIAADRXXXXXXXXXX
BIOF_ECOLC      XXXXXXXXXXXXXXAHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_ECOHS      XXXXXXXXXXXXXXAHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_SHIDS      XXXXXXXXXXXXXXAHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_ENTAG      XXXXXXXXXXXYTRAHYALESELAEWLGYPRALLFISGFAANQAVIAALTGKEDRIVADKLSHASLLEAA
BIOF_SHIBS      XXXXXXXXXXXXXXAHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_SHIB3      XXXXXXXXXXXXXXAHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_ECOLI      XXXXXXXXXXXXXXXHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIAADRXXXXXXXXXX
BIOF_ECODH      XXXXXXXXXXXXXXXHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIAADRXXXXXXXXXX
BIOF_ECOSE      XXXXXXXXXXXXXXAHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_ECO24      XXXXXXXXXXXXXXAHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_ECO55      XXXXXXXXXXXXXXAHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_ECO27      XXXXXXXXXXXXXXAHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_SHIFL      XXXXXXXXXXXXXXXHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_SHIF8      XXXXXXXXXXXXXXXHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_SHISS      XXXXXXXXXXXXXXXXQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_ECOL6      XXXXXXXXXXXXXXAHQVLEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_ECOL5      XXXXXXXXXXXXXXAHQVLEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_ECO81      XXXXXXXXXXXXXXAHQVLEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_ECOUT      XXXXXXXXXXXXXXAHQVLEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_ECOK1      XXXXXXXXXXXXXXAHQVLEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_ECO45      XXXXXXXXXXXXXXAHQVLEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_ECO7I      XXXXXXXXXXXXXXAHQVLEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIVADRXXXXXXXXXX
BIOF_KLEP3      XXXXXXXXXXXXXEAHRALEEELADWLGYPRALLFISGFXXXXXXXXXXXEKEDRIVADRXXXXXXXXXX
BIOF_ERWCT      XXXXXXXXXXXYTDAHASLENQLADWLGYPRALLFISGYXXXXXXXXXXXXXEDRIFADKLSHASLLEAA
BIOF_YERE8      XXXXXXXXXXXXXLPHAQLEQQLADWLGYPRALLFISGFAANQAVLTALTAADDRILADKLSHASLLEAA
BIOF_PHOLL      XXXXXXXXXXXYTKAHQLLEQQLADWLGYPKALLFISGYSANQGVIAALMTEQDRIIADRLSHASLMEAA
BIOF_ENTS8      XXXXXXXXXXXXXDAHQSLENALAHWLGFDRALLFISGFAANQAVVAALMQQSDRILADRXXXXXXXXXX
BIOF_KLEP7      XXXXXXXXXXXXXEAHRALEEALADWLGYPRALLFISGFXXXXXXXXXXXEKDDRIVADRXXXXXXXXXX
BIOF_PROMH      XXXXXXXXXXXFTQAHQQLEQQLADWLGYDHALLFSSGYSANQGVIATLLEKEDAIIADKLCHASLMEAA
BIOF_SERP5      XXXXXXXXXXXFSTAHQVLEQQLADWLGYPRALLFISGYXXXXXXXXXXXXXEDRILADRXXXXXXXXXX
BIOF_SODGM      XXXXXXXHVTGYGLHHQRLEQRLADWLGFPRALLFTSGFAANQALVGALTASGDHILADRLSHASLLEAA
BIOF_SERMA      XXXXXXXXXXXFSXXXXXXXXXXXXWLGYPRALLFIS-YAANQAVLAALMQKGDRILADRLSHASLLEXX
BIOF_YERPS      XXXXXXXXXXXXSQPHARLEQQLADWLGYPRALLFISGYAANQAVLTALTDADDRILADKXXXXXXXXXX
BIOF_YERPB      XXXXXXXXXXXXSQPHARLEQQLADWLGYPRALLFISGYAANQAVLTALTDADDRILADKXXXXXXXXXX
BIOF_YERPY      XXXXXXXXXXXXSQPHARLEQRLADWLGYPRALLFISGYAANQAVLTALTDADDRILADKXXXXXXXXXX
BIOF_YERP3      XXXXXXXXXXXXSQPHARLEQRLADWLGYPRALLFISGYAANQAVLTALTDADDRILADKXXXXXXXXXX
BIOF_ERWT9      VGAGGSAHVTGYRAPQAELEHQLADWLGYRRALLFISGFXXXXXXXXXXXXKNDRIFADKLCHXXXXXXX
BIOF_PHOPR      AGSGASPLVTGFHSAHKALEDQLADWLGYDRALLFNSGFSANQAVLFTIPDKHDVLIQDKLNHASLMEAG
BIOF_YERPP      XXXXXXXXXXXXSQPHARLEQQLADWLGYPRALLFISGYAANQAVLTALTDADDRILADKXXXXXXXXXX
BIOF_YERPN      XXXXXXXXXXXXSQPHARLEQQLADWLGYPRALLFISGYAANQAVLTALTDADDRILADKXXXXXXXXXX
BIOF_YERPG      XXXXXXXXXXXXSQPHARLEQQLADWLGYPRALLFISGYAANQAVLTALTDADDRILADKXXXXXXXXXX
BIOF_YERPE      XXXXXXXXXXXXSQPHARLEQQLADWLGYPRALLFISGYAANQAVLTALTDADDRILADKXXXXXXXXXX
BIOF_YERPA      XXXXXXXXXXXXSQPHARLEQQLADWLGYPRALLFISGYAANQAVLTALTDADDRILADKXXXXXXXXXX
BIOF_VIBPA      SGSGASPMVTGFSAAHSNLEAALTEWLGFERAILFGSGFSANQALLFTLLEKSDVLIQDRLNHASLMEAG
BIOF_VIBSL      AGSAASPLVTGFSPAHRNLETQLCEWLGFERAILFNSGFSANQALLFSLLEKDDFLLQDKLNHASLMEAG
BIOF_ALISL      XXXXXXXXVTGYSKPHADLESQLAEWLGFDCAVLFNSGFSANQAVLFSLLEKGDQVVQDKLNHASLMEAG
BIOF_VIBF1      XXXXXXXXVTGYSKPHANLESQLAEWLGLDCAILFNSGFSANQAVLFSLLEKGDTLLQDKLNHASLMEAG
BIOF_VIBFM      XXXXXXXXVTGYSKPHANLESQLAEWLGFDCAILFNSGFSANQAVLFSLLEKGDTLLQDKLNHASLMEAG
BIOF_BUCBP      XXXXXXXXXXXXXXXHQSLEEKLAKWLDYPKAILFISGYTANTAIISTLIQKNDRIFMDKLSHSSILEPS
BIOF_VIBHB      SGSGASPMVTGFSAAHSNLEAALTEWLGYERAILFGSGFSANQALLLTLLEKSDVLIQDRLNHASLMEAG
BIOF_VIBVU      CGSGASPLVTGYTPAHSNLAASLCDWLGYESATLFGSGFSANQALLFALLEKGDLLVQDKLNHASLIEAG
BIOF_VIBVY      CGSGASPLVTGYTPAHSNLAASLCDWLGYESATLFGSGFSANQALLFALLEKGDLLVQDKLNHASLIEAG
BIOF_VIBCH      AGSGASPMVTGFSSAHAELEHELCHWLGYERAVLFSSGFSANQAXXXXXXXXXXXXXXXXXNHASLMEAG
BIOF_AERHH      AGAGASPLVTGYSRAHQQLEETLADWLGVEAVLLFNCGFSANQAVLKALLGKDHLLWQDKLNHASLQEMG
BIOF_MARMS      VGGGSSHLVCGHLAPHQALEEALADWLGYERVMLFSTGYMANLGVISALADKNRPIVQDKLNHASLIDGA
BIOF_AERS4      TGSGASPLVTGYSRAHQQLEETLADWLGVEAVLLFNCGFSANQAVLKALLGKDHLLWQDRLNHASLQEMG
BIOF_THISH      XXXXXXHLVNGHTRAHHQLEEELAAFTNRERALLFSTGYMANLGVAQALLGRSDHVLEDRLNHASLIDAG
BIOF_MARAV      LGGAASHLVCGHHEAHHRLEQRLAAFTRRSSALFFSTGYMANMGVISALAGRGDTIFSDRLNHASIIDGC
BIOF_HERAR      XXXXXXXXXXXXFTPHEELEHKLASFVGGERALYFSTGYMANLGVVPALVGRGDAVFADKLNHASLIDAV
BIOF_HAHCH      LGGGASHLVIGHHRAHHELELDLAEFTGRDRALLFSTGYMANLGVASALLGRGDYVIEDKLNHASLLDAG
BIOF_PSEPF      VGGGASHLVIGHSGPHHELEEALADLTGRPRALLFTTGYMANLGAVTALVGQGDTVLEDRLNHXXXXXXX
BIOF_PSEE4      VGGGASHLVIGHSTPHHQVEEALAELTGRPRALLFSTGYMANLGAITALVGQGDTVLQDRLNHAXXXXXX
BIOF_SACD2      VGSGASHLVNGHSXXXXXXXXXXXXFTGRPRALLFSTGYMANMGVINGLLGRGDAVFQDKLNHASLLDGG
BIOF_NITMU      VGAGTSHLVSGHSRAHHLLEEALASFTRFPRALLFSTGYMANAGVVTALTGRGDAVFGDKLNHASLNDAA
BIOF_PSEF5      VGGGASHLVIGHSTPHHALEEALAELTGRPRALLFTTGYMANLGAVTALVGQGDTVLEDRLNHXXXXXXX
BIOF_PSE14      VGGGASHLVIGHSTPHHXXXXXXXXXTGRPRALLFSNGYMANLGAVTALVGQGDTVLEDRLNHXXXXXXX
BIOF_PSESM      VGGGASHLVIGHSTPHHXXXXXXXXXTGRPRALLFSNGYMANLGAVTALVGQGDTVLEDRLNHXXXXXXX
BIOF_ALCBS      VGSGASHLVCGHQRPHQQLEEALAAHTGRQRALLFSTGYMANLGVMTALLSKGDAVFQDRLNHAXXXXXX
BIOF_PSEU2      VGGGASHLVIGHSAPHHXXXXXXXXXTGRPRALLFSNGYMANLGAVTALVGQGDTVLEDRLNHXXXXXXX
BIOF_NITEC      VGSGASHLISGHSRXXXXXXXXXXXFVGLPRTLLFSTGYMANMAVVTALMGREDAIFADRLNHASLNDAA
BIOF_AZOSE      AGCGASHLVSGHYAVHDELEARLAAFVDCERALYFSTGYMANTGTIPALVGRGDAIFADRLNHASLVDGA
BIOF_XYLFT      IGATASHLICGHHAIHKALEYELAEWLGYPRALLFGSGFTANLAVQQALLKENDICVQDRLNHASLIDAT
BIOF_XYLFM      IGATASHLICGHHAIHKALEYELAEWLGYPRALLFGSGFTANLAVQQALLKENDICVQDRLNHASLIDAT
BIOF_XYLF2      IGATASHLICGHHAIHKALEYELAEWLGYPRALLFGSGFTANLAVQQALLKENDICVQDRLNHASLIDAT
BIOF_PSEU5      VGGGASHLVIGHSTPHHRLEEALAEFTGRPRALLFSTGYMANLAAVTALVGQGDTVLEDRLNHXXXXXXX
BIOF_DECAR      AGSGASHLVSGHLGPHELLEKEIAEFTGFPRTLTFSTGYLANLAVTPTLAGRGDAVFADKLNHASLIDAM
BIOF_THICR      YGSGAAHLVTGXXXXXXXXXXXXADWLGCERALLFSTGYMANLAVQQTLMQKGDWILADKLNHASLIDGA
BIOF_BURPP      XXXXXXXXXXXXXXXXAQLEDDLAEFAGNARALYFSTGYMXXXXXXXXXXXXXXXXFSDALNHASLIDGA
BIOF_BURXL      XXXXXXXXXXXXXXXXAQLEDDLAEFVGNARALYFSTGYMXXXXXXXXXXXXXXXXFSDALNHASLIDGA
BIOF_ALHEH      AGSGAAHLVSGHRPEHEALERALADWTGREAALLFSTGYMANLGVIDALVGRGDTVFEDRLNHASLLDGA
BIOF_GEOUR      VGSGASRLVSGTMELHEALEARIAAFKGTNSALVFNSGYAANTGIISAIAGRGDVIFSDRLNHASIVDGA
BIOF_GEOBB      XXXXXXRLVSGTMELHEKLEERIAAFKGTEKALVFNSGYAANTGIVSALVGRGDAIFSDRLNHASIIDGA
BIOF_METFK      AGTGASHLVSGHQQAHEALEHALQTFMGLPGVLLFTTGYMANLGIITALCGRQDAIFADKLNHASLNDAA
BIOF_NITOC      VGSGAAHLVTGHSRAHHTLEEALAAFVGRPRVLLFSTGYSANLGVISALIGRQDAVFEDRLNHXXXXXXX
BIOF_PSEAB      VGGGASHLVVGHSGPHHELELALAEFTGRPRALLFSTGYMANLGAVTALVGKGDTVLEDRLNHXXXXXXX
BIOF_PSEA8      VGGGASHLVVGHSGPHHELELALAEFTGRPRALLFSTGYMANLGAVTALVGKGDTVLEDRLNHXXXXXXX
BIOF_AZOSB      XXXXXXHLVSGHYAVHDALEHRLAAFVGAERALYFSTGYMANAGIVPALVGRGDAVFADRLNHASLVDGV
BIOF_GEOMG      TSSGASRLVSGTMELHALLEERIARFKGTGAALVFNSGYAANSGIIPALVGKGDVVFSDRLNHASIVDGC
BIOF_BURP8      XXXXXXXXXXXXXXXXAQLEDDLAEFAGNPRALYFSTGYMXXXXXXXXXXXXXXXXFSDSLNHASLIDGA
BIOF_PSEPG      VGGGASHLVVGHSTPHHQVEEALAELTGRPRALLFSTGYMANLGAITALVGQGDTVLQDRLNHAXXXXXX
BIOF_XYLFA      IGATASHLICGHHAIHKALEYELAEWLGYPRALLFGNGFTANLAVQQALLKENDICVQDRLNHASLIDAT
BIOF_PSEAE      VGGGASHLVVGHSGPHHELELALAEFTGRPRALLFSTGYMANLGAVAALVGKGDTVLEDRLNHXXXXXXX
BIOF_PSEPW      VGGGASHLVVGHSTPHHQVEEALAELTGRPRALLFSTGYMANLGAITALVGQGDTVLQDRLNHAXXXXXX
BIOF_BURM1      XXXXXXXXXXXXXRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAGKDATIFSDALNHASLIDGT
BIKB_GEOKA      AGAGASRLVVGNHPLYERAEAALKQWKKAEAALIFNSGYTANIGVLTALIGRDDLVFSDKLNHASLIDGI
BIOF_PSEMY      VGGGASHLVIGHSTPHHELEEALAEFTGRPRALLFSTGYMANLAVVTALLGQGDSVLQDRLNHASLLDAG
BIOF_NITEU      VGSGASHLISGHFRXXXXXXXXXXXFVGLPRTLLFSTGYMANMAVVTALAGRGDAIFADRLNHASLNDAA
BIOF_ACIF5      XXXXXXXXXXXERPAHAVLANALARWLGVEAALLFGSGYLANLGVISTLVGRGDRVYADRLNHASLVDGV
BIOF_ACIF2      XXXXXXXXXXXERPAHAVLANALARWLGVEAALLFGSGYLANLGVISTLVGRGDRVYADRLNHASLVDGV
BIOF_BURCM      XXXXXXXXXXXXXRAHATLEDELAGFAGAPRALYFSTGYMANLAAMTALTGKHATIFSDALNHASLIDGM
BIOF_RALME      AGSGASHLVSGHSLAHAQLERELARWLAQAQALYFCTGYMANLAVLTSLGATGATLFCESLNHASLIDGA
BIOF_PSEPK      VGGGASHLVVGHSTPHHQVEEALAELTGRPRALLFSTGYMANLGAITALVGQGDTVLQDRLNHAXXXXXX
BIKB_DESAP      TGSGAARLVSGHNPLLQALEEALARCKGSPRALVFPTGYTANLAVIGTLAGREDVIFCDRLCHASLLDGC
BIOF_RALEH      AGSGASHLVSGHSLAHTQLEAELARWLAIPHALYFCTGYMANMAVXXXXXXXXXXXFCESLNHASLIDGA
BIOF_CHRVO      AGSGASHLLTGHTLAHQQAEEALAGFVGREAALLFGSGYAANLAVITSLVGRGDAVFADKLNHASLNDGC
BIOF_BURA4      XXXXXXXXXXXXXRAHATLEDELAGFAGAPRALYFSTGYMANLAAMTALTGKHATIFSDALNHASLIDGI
BIOF_GEOSF      VGSGAARLVSGNMELHFRLEERIAAFKGTEAALVFNSGYAANTGIISAIAGRGDLIFSDRLNHASIVDGA
BIOF_BURCC      XXXXXXXXXXXXXRAHARLEDELAGFAGAPRALYFSTGYMANLAAMTALAGKGATIFSDALNHASLIDGM
BIOF_GEOSL      TGSGASRLVSGTMELHAALEERLARFKGTEAALVFNSGYAANSGIIPALVGRGDVVFSDRLNHASIVDGC
BIOF_CELJU      XXXXXSHLVAGHTQXXXXXXXXXXXFTGRQRALLFSTGYMANLGVISTLVGQGDGVFEDRLNHAXXXXXX
BIOF_JANMA      XXXXXXHLISGHSXXXXXXXXXVAPQIADARALYFCTGYMANIAILSALSGSGADLFSESLNHASLIDGA
BIOF_BURCH      XXXXXXXXXXXXXXXXARLEDELAGFAGAPRALYFSTGYMANLAAMTALAGKGATIFSDALNHASLIDGM
BIOF_BURCA      XXXXXXXXXXXXXXXXARLEDELAGFAGAPRALYFSTGYMANLAAMTALAGKGATIFSDALNHASLIDGM
BIOF_GEOLS      TSSAASRLVSGNQPLHAMLEAKLSAWKGTETALLFNSGYAANTGIIAALAGRGDIIFSDRLNHASIIDGA
BIKB_PELCD      TGTGASRLVSGSMALHEELESKLAQFKGTQRALLFNAGYAANTGILQGLMGADDVIFSDSLNHASIIDGC
BIOF_BACSU      XXXXXXXXXXXXXVWHEKLEKKIASFKLTEAALLFSSGYLANVGVLSSLPEKEDVILSDQLNHASMIDGC
BIOF_PSEA7      VGGGASHLVVGHSGPHHELELALAEFTGRPRALLFSTGYMANLGAVTALVGKGDTVLEDRLNHXXXXXXX
BIOF_METCA      VGSGASHLVCGHSXXXXXXXXXXXXFTGRPRALLFSTGYMANLGVVSALAGRGDTVFEDRLNHAXXXXXX
BIOF_BURPS      XXXXXXXXXXXXXRAHATLEDELAAFSGAPRALYFSTGYMXXXXXXXXXXXXXXXIFSDALNHASLIDGA
BIOF_BURP6      XXXXXXXXXXXXXRAHATLEDELAAFSGAPRALYFSTGYMXXXXXXXXXXXXXXXIFSDALNHASLIDGA
BIOF_BURP0      XXXXXXXXXXXXXRAHATLEDELAAFSGAPRALYFSTGYMXXXXXXXXXXXXXXXIFSDALNHASLIDGA
BIOF_BURMS      XXXXXXXXXXXXXRAHATLEDELAAFSGAPRALYFSTGYMXXXXXXXXXXXXXXXIFSDALNHASLIDGA
BIOF_BURMA      XXXXXXXXXXXXXRAHATLEDELAAFSGAPRALYFSTGYMXXXXXXXXXXXXXXXIFSDALNHASLIDGA
BIOF_BURM9      XXXXXXXXXXXXXRAHATLEDELAAFSGAPRALYFSTGYMXXXXXXXXXXXXXXXIFSDALNHASLIDGA
BIOF_BURM7      XXXXXXXXXXXXXRAHATLEDELAAFSGAPRALYFSTGYMXXXXXXXXXXXXXXXIFSDALNHASLIDGA
BIOF2_POLSJ     AGSGASHLISGHSRAHAALEGDLAAWLANAAALYFCTGYLANLALLTALGDASATIFADKLNHASLIDGA
BIOF_BURTA      XXXXXXXXXXXXXXXXAALEDELAAFSGAPRALYFSTGYMXXXXXXXXXXXXXXXIFSDALNHASLIDGT
BIOF_BURP1      XXXXXXXXXXXXXRAHATLEDQLAAFSGAPRALYFSTGYMXXXXXXXXXXXXXXXIFSDALNHASLIDGA
BIOF_PSEP1      VGGGASHLVVGHSTPHHQVEEALAELTGRPRALLFSTGYMANLGAITALVGQGDTVLQDRLNHAXXXXXX
BIOF_CUPTR      AGSGASHLVSGHSLAHAQLEAELARWIAQARTLYFCTGYMANMAVXXXXXXXXXXXFCESLNHASLIDGA
BIOF_BURCJ      XXXXXXXXXXXXXRAHARLEDELAGFAGAPRALYFSTGYMANLAAMTALAGKGATIFSDALNHASLIDGM
BIOF_BURS3      XXXXXXXXXXXXXRAHATLEDELAAFSGAPRALYFSTGYMANLAAMTALTGKAATIFSDALNHASLIDGM
BIOF_BACLD      AGSTGSRLTSGNTAWHEKLERKIAGFKQTEAALLFSSGYLANVGVLSSLPEKGDVILSDQLNHASIIDGC
BIOF_RALPJ      FGSGASHLVSGHSIAHARLEARMAALQGEADALFFCTGYMANLAVVSAMAQAGGTIFSDALNHASLIDGA
BIKB_BACHD      IGSTASRLIIGNHPLYEEAEYELTKWKKTEAALIFGSGYMANVGIISSIVGRGDAVFSDKLNHASIVDGC
BIKB_EXIS2      AGTGSVRTIAGTLEMHQAFERELATFKHTEAALVFQSGFATNLGVLSALLGPEDVVISDALNHASIIDGI
BIOF_CHRSD      XXXXXSHLVSGHLEIHERLERRLAQLTGRPRALLFSTGYMANLGVLQALCDHHTRVFQDRLNHASLIDGA
BIOF_BACSH      TGAGGSRLTTGNFDIHEQLESEIADFKKTEAAIVFSSGYLANVGVISSVMKAGDTIFSDAWNHASIIDGC
BIKB_BACCQ      TGATASRLVVGNYSLYEEVERSICDWKGTEKALVVNSGYTANIGVISSLVSRHDIVFSDKLNHASIVDGI
BIKB_BACC7      TGATASRLVVGNYSLYEEVERSICDWKGTEKALVVNSGYTANIGVISSLVSRHDIVFSDKLNHASIVDGI
BIOF1_POLSJ     VGAAASPLVSGHSXXXXXXXXXXXRFVGQPRALYFYAGYATNIGIVPALVGKGDAIFSDALNHACLIDGA
BIKB_BACC2      TGATASRLVVGNHPLYEEVERSICDWKGTERALIVNSGYTANIGAISSLASRHDIVFSDKLNHASIVDGI
BIOF_BACNA      XXXXXXXXXXXXXVWHEKLEKKIASFKRTEAALLFSSGYLANVGVLSSLPEKEDVILSDQLNHASIIDGC
BIOF_STRM5      XXXXXSHLVCGHHAMHEALEREVAEWLGYPRALLFGSGFAANLAVQQALLEENDVCVQDKLNHASLLDAT
BIOF_STRMK      XXXXXSHLVCGHHALHEALEREVAEWLGYPRALLFGSGFAANLAVQQALLEENDVCVQDKLNHASLLDAT
BIKB_BACC4      TGATASRLVVGNHLLYEEVERSICDWKGTERALIVNSGYTANIGAISSLASRHDIVFSDKLNHASIVDGI
BIKB2_BACCR     TGATASRLVVGNHLLYEEVERSICDWKGTERALIVNSGYTANIGAISSLASRHDIVFSDKLNHASIVDGI
BIOF_BACA2      AGSGGSRLTTGNTVWHEKLEHTIADFKQTEAALLFSSGYLANIGVLASLPQKGDVILSDQLNHASIVDGC
BIKB_BACC1      TGATASRLVVGNYSLYEEVERSICDWKGTEKALVVNSGYTANIGVISSLVSRHDIVFSDKLNHASIVDGI
BIKB_ANOFW      VGATASRLVVGNHPLYEQAEDALVRWKGCEAALIVNSGYTANVGILSSLAGRDAVIFSDKWNHASIVDGA
BIKB_ALKOO      VGSGAVRTIVGNMDIHEILDKKLAEFKREEAVMSFQSGFNCNAGTIQAITEKGDLIISDELNHASIIDGA
BIOF_XANC5      XXXXXSHLICGHHTAHETLEREIADWLGYPSALLFGSGFIANLAVQQALLSEEDDVVQDRLNHASLLDAT
BIKB_BACWK      TGATASRLVVGNYPLYEEVERSICDWKGTERALIVNSGYTANVGAISALACRHDMIFSDKLNHASIVDGI
BIOF_RALEJ      AGSGASHLVSGHSLAHARLEEELARWFAQARTLYFCTGYMANMAVXXXXXXXXXXXFCETLNHASLIDGA
BIKB_BACCN      VGATASRLVVGNYSLYEEVEKSICDWKHTEKAMIVNSGYTANVGAISSLMGRHDVIFSDKLNHASIVDGV
BIOF_LEPCP      AGAGASHLISGHTRAHAALEDTLAEWIPGAKALSFCTGYMANLALLTALGDAEATLFADKLNHASLVDGA
BIOF_XANAC      XXXXXSHLICGHHTAHETLEREIAEWLGYPSALLFGSGFIANLAVQQALLSEEDDVVQDRLNHASLLDAT
BIOF_METPP      VGATASPLICGHSPAHEALEQELARFVGLPRXXXXXXXXXXXXXXXXXLVERGDALISDALNHACLIDGA
BIKB_BACCZ      AGATASRLVVGNYSLYEEVERSICDWKGTEKALVVSSGYTANVGVISSLACRHDIVFSDKLNHASIVDGI
BIOF_BURVG      XXXXXXXXXXXXXRAHARLEDELAGFAGAPRALYFSTGYMANLAAMTALTGKQATIFSDALNHASLIDGI
BIKB_BACA2      AGTGSVRTIAGTFTMHNELEKKLANFKKTEAALVFQSGFTTNQGVLSSILTKEDIVISDELNHASIIDGI
BIKB_PASMU      XXXXXXXXXXXXFPIYDELESLMAQAFGRETALLFNSGYHANIGILPALADKKTLIVADKLVHASMIDGI
BIKB_BACHK      TGATASRLVVGNYSLYEEVERSICNWKGTEKALVVNSGFTANVGAISSLVCRHDIVFSDKLNHASIVDGI
BIOF_MYXXD      VGTGASRLVVGDTAAHHRLETRLAAFERAEAVRLFNSGYAANTGIIPALVGSEDAVFSDALNHASLVDGC
BIKB_DESOH      XXXXXSRLVCGNYTCFDRVEEKLARLKQTPAALVLNSGYQANTTLLPALCDRDSLILSDRLNHNSIIMGC
BIKB_BACC0      TGATASRLVVGNYSLYEEVERSICNWKGTEKALVVNSGFTANVGAISSLACRHDIVFSDKLNHASIVDGI
BIKB2_BACAN     TGATASRLVVGNYSLYEEVERSICNWKGTEKALVVNSGFTANVGAISSLACRHDIVFSDKLNHASIVDGI
BIOF_XANOR      XXXXXSHLICGHHTAHETLEREIAEWLGYPSALLFGNGFIANLAVQQALLSEEDDVVQDRLNHASLLDAT
BIOF_XANOP      XXXXXSHLICGHHTAHETLEREIAEWLGYPSALLFGNGFIANLAVQQALLSEEDDVVQDRLNHASLLDAT
BIOF_XANOM      XXXXXSHLICGHHTAHETLEREIAEWLGYPSALLFGNGFIANLAVQQALLSEEDDVVQDRLNHASLLDAT
BIKB_BACP2      AGTGSVRTIAGTMTMHERLEKKLAAFKKTEAALVFQSGFTTNQGVLSSILTKDDIVISDELNHASIIDGI
BIKB_HAEDU      FSSSSSRLLTGNFPIYARLEQLLAQRFQRETALLFNSGYHANIGILPALVDKHSLILADKLVHASLIDGT
BIKB_BACSU      AGTGSVRTIAGTFTMHQELEKKLAAFKKTEAALVFQSGFTTNQGVLSSILSKEDIVISDELNHASIIDGI
BIKB_BACAH      TGATASRLVVGNYSLYEEVERSICNWKGTEKALVVNSGFTANVGAISSLACRHDIVFSDKLNHASIVDGI
BIOF_CLOTH      VGAGGSRLTCGNFELHRELEERLAKFKDVESCIVFGSGYAANIGAISGIADKNWVIFCDRLNHASIVDGI
BIOF_XANCB      XXXXXSHLICGHHTAHETLERDIAEWLGYPSALLFGSGFIANLAVQQALLSEEDDVVQDRLNHASLLDAT
BIKB_ALKMQ      VGAGAVRTIVGNMDIHEELERVLAEFKREEAVMVFQSGFNCNAGTIQAVTEKGDLIISDQLNHASIIDGA
BIOF_XANCP      XXXXXSHLICGHHTAHETLERDIAEWLGYPSALLFGSGFIANLAVQQALLSEEDDVVQDRLNHASLLDAT
BIOF_XANC8      XXXXXSHLICGHHTAHETLERDIAEWLGYPSALLFGSGFIANLAVQQALLSEEDDVVQDRLNHASLLDAT
BIKB_SYMTH      AGSGAVRTIIGTMTIHNQLEQKLAEFKHVEAAVVFQSGFTCNSGVIPVLVGEGDAVISDELNHASIIDGC
BIOF_THIDA      VGAGAAHLISGHHRLHLEFETDFAQWVGKPAALLFSTGYLANLAVVTALISRRGEVFADKLNHASLVDAA
BIKB_HAEPS      PLTSSSSRLLTGNFPYQDFETLLAQRFQRESALLFNSGYHANIGILPAVADKQTLILADKLAHASLIDGI
BIOF_ANASK      AGSGAARLVAGDLPPHGALEARLAAWKGREAALLFGSGYHANAGVPGALVGRDDAVFSDVLNHASIVDGC
BIKB_COPPD      AGPAAVRTIAGDQLPQEKLEEMLAEFKGAEAAVLYQSGFCANLGTIPALVGEGDAIFSDELNHASIIDGC
BIOF_BORPD      XXXXXSHLISGHSHAHAQLEERLANMLAQPRALYFCTGYMANLAVLGALAGRDADIFSEALNHASLIDGA
BIKB_THEYD      XXXXXXXXXXXXTILHRKLEELLSEFKNTESCLILNSGYTANTSLIPALAGENDIIFSDELNHASIIDGC
BIKB_THEP3      VGAGAVRTIIGNMTIHEELERKLAEFKREEAVLTFQSGFTANMGVIQAVVDKGDVIISDELNHASIIDGC
BIKB_GLOVI      AGATGSRLLSGERDVHRELEQALAGWKGCDDCLVFSSGYLANLGTIPALVGKRDLVVGDEYNHACLRGGA
BIKB_THEPX      VGAGAVRTIIGNMTIHEELERKLAEFKREEAVLTFQSGFTANMGVIQAVVDKGDVIISDELNHASIIDGC
BIKB_PARL1      TGSGASRLVSGNHPLFGELERRLADWKQTEDCVVFGSGYMANMGIIPSLVREGDLIIADELSHACLLSGS
BIKB_METJA      GAGSTGSRLTSGNINHQRLEEKIAEFKETERTLVYSSGYATNVGVISALCKKGDLILSDKLNHASIIDGC
BIKB_THET8      AGSGAVRTIAGTFTYHVELEEALARFKGTESALVLQSGFTANQGVLGALLKEGDVVFSDELNHASIIDGL
BIOF_PELPD      XXXXXXXXXXXXMEPHEALETAVAAFKRTESALAFNSGYAANTGIIQALVGRGDVIFCDRLNHASIIDGA
KBL_ECOLI       FGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGV
BIKB_SHIFL      FGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGV
BIKB_ECO57      FGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGV
BIKB_SALTY      FGMASVRFICGTQDSHKALEQKLASFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGV
BIOF_ANAD2      AGSGAARLVAGDLPPHGALEARLAAWKGREAALLFGSGYHANAGVPGALVGRDDAVFSDVLNHASIVDGC
BIKB_THEM4      VGPGAVRTIAGTFSLHNELEETLAKFKKVEATIFLQSGFVANQAVIPAITNEEDAILSDELNHASIIDGV
BIKB_GLUDA      IGSGASRLVTGTSEQYRQVEARLARFKGTEAALLLASGWQANAAVLPALLRISAAVFTDRLNHASLHHGC
BIOF_POLNA      AGSGASHLISGHSEXXXXXXXXXXXXIPNAQALYFCTGYMXXXXXXXXXXXXXXXIFADKLNHASLVDGA
BIKB_OCEIH      VGAGAVRTINGTLDLHIELEKKIAQFKGTEAAIAYQSGFNCNMAAISAVMDKNDAILSDSLNHASIIDGC
BIOF_DESDA      TGAGGSRLVTGNMTPHMQLESALAAFKGSESALAFTSGYTANMGVISALCHKDTVIFSDALNHASIIDGC
BIKB_ACAM1      XXXXXXXXXXXHRMIHEQLERAIATWKQTETAIVYSSGYLANIGTITALVNKRDLILADAYNHASLKNGA
BIKB_HAEIE      SFTSSSSRLLTGNFPYTDLEELVAQRFQRESALLFNSGYHANIGILPALTTTKSLILADKLVHASMIDGI
BIOF_ANADF      XXXXXXXLVAGDLPVHGALERAIAGHAGTEAALLFGSGYHANAGVPPALVGRDDAVFSDVLNHASIVDGC
BIKB_CHLP8      MTSSSSRLLTGNFPVGGELESAIAKAYGSEAALVFNSGYHANTGILPSLSTRHDLILSDRLNHASIIDGL
BIKB_THEAB      VGPGAVRTIAGTFSLHNELEKTLAEFKKVEATIFLQSGFVANQAVIPAITNEEDAILSDELNHASIIDGV
BIKB_TREDE      AGAGAVRPIIGNMKIHDDLEKLLAEFKREEAVLAFQSGFNCNAGVIQALTDKGDLIISDQLNHASIIDGT
BIKB_HAEIG      SFTSSSSRLLTGNFPYTDLEELVAQRFQRESALLFNSGYHANIGILPALTTKS-LILADKLVHASMIDGI
BIKB_HAEI8      SFTSSSSRLLTGNFPYTDLEELVAQRFQRESALLFNSGYHANIGILPALTTKS-LILADKLVHASMIDGI
BIKB_NEIMF      SFTSSSSRLLTGNFPYTDLEELVAQRFQRESALLFNSGYHANLGILPALTTTKSLILADKFVHASMIDGI
BIKB_BEII9      VGAGASRLVTGNHPXXXXXXXXXXXXXGSEAACIFGAGYLANTGIIPTLVGKDDLILIDELAHACLFAGT
BIKB_META3      FGSTGSRLTAGD-INHQLLEHKIAEFKGTERSLIYSSGYATNVGVISALCKKGDLILSDKLNHASIIDGC
BIKB_MYCS2      GGAGGSRLVTGNTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSGPGSLIVSDALSHASLVDAC
BIKB_HAEIN      SFTSSSSRLLTGNFPYTDLEELVAQRFQRESALLFNSGYHANIGILPALTTTKSLILADKLVHASMIDGI
KBL_MOUSE       AGLSSTRFICGTQSIHKNLEAKIAHFHQREDAILYPSCFDANAGLFEALLTPEDAVLSDELNHASIIDGI
BIKB_NEIMA      SFTSSSSRLLTGNFPYTDLEELVAQRFQRESALLFNSGYHANLGILPALTTTKSLILADKFVHASMIDGI
BIKB_NEIM0      SFTSSSSRLLTGNFPYTDLEELVAQRFQRESALLFNSGYHANLGILPALTTTKSLILADKFVHASMIDGI
BIKB_FERNB      VGPGAVRTIAGTMKIHEELEKALAEFKGADATIFLQSGFIANQAAITVFGDENDAIISDELNHASIIDGV
BIKB_NEIG2      SFTSSSSRLLTGNFPYTDLEELVAQRFQRESALLFNSGYHANLGILPALTTTKSLILADKFVHASMIDGI
BIKB_ACICJ      XXXXXSRLVTGDHPLYCALEARLAALKQTEDAVVFGSGFLANTGIIPALMAREDAIFVDELAHACIWAGA
BIKB_SYNY3      XXXXXXXXXXXHRQLHQDLEQAIARWKGTEAALVFSSGYLANLGTITALVGKRDLILADEYNHSSLKRGA
KBL_BOVIN       AGLSSVRFICGTQSIHKDLEAKIARFHQREDAILYPSCFDANTGLFEALLTSEDAVLSDELNHASIIDGI
BIKB_NEIMB      SFTSSSSRLLTGNFPYTDLEELVAQRFQRESALLFNSGYHANLGILPALTTTKSLILADKFVHASMIDGI
BIKB_MAGSM      TGAQASRLVCGDLEPFARIEARLVAGKGCEAALVLNAGYQANSSVIPALLDKRPLVFSDRLNHASMHHGV
KBL_HUMAN       AGLSSVRFICGTQSIHKNLEAKIARFHQREDAILYPSCYDANAGLFEALLTPEDAVLSDELNHASIIDGI
BIKB_NEIG1      SFTSSSSRLLTGNFPYTDLEELVAQRFQRESALLFNSGYHANLGILPALTTTKSLILADKFVHASMIDGI
BIKB_PETMO      VGPGAVRTIAGTMKIHXXXXXXXXXXXXXXXTLVVQSGFNANQAVIPTITNEEDGILSDELNHASIIDGV
BIKB_MAGSA      AGSGASRLVTGHLAAMEALEAKIARCKQTEAALILASGWQCNASVLPALLDKEPLVFADKLIHASLHAGL
BIOF_MARMM      XXXXXSRLVTGGHPXXXXXXXXXXXXKGTEDCLVFGSGYLANLAITPALVGSGDIIFVDTLAHACLHAGA
BIKB_METVS      AGSTGSRLTSGNFKLHEKLEGVISEFKETEKSLVYSSGYAANVGVISALAKKGDLVLSDELNHASIIDGI
BIOF_DELAS      XXXXXXXXXXXXXTANAALEEQLAHFVQLPRALYFYAGYATNAGIVPALVGAGDALFSDALNHACLIDGA
BIOF_ACIAC      XXXXXXXXXXXXXQANAALEADLARFVQLPRALYFYAGYATNTGIVPALVGAGDALFSDALNHACLIDGA
BIOF_HALHL      SGAGAAHLVTGHRPXXXXXXXXXXXFTGREAALLFSTGYMANLGVVTTLVRRGQAVAEDRLNHASLIDAV
BIKB_SYNP2      XXXXXXXXXXXHRQLHQDLEQAIANLKQTEDALVFSSGYLANFGTISAITNKKDLILGDQYNHSSLKNGA
BIKB_METPB      AGAGASRLVTGNSPPLAALEERLARHKGKEAALVFGSGYLANLGIAPALVGQGDLILIDDLGHSCLFAGA
BIKB_MICAN      XXXXXXXXXXXHRDLHRDLELAIASFKNSEDAIVFSSGYLANLGTITCLVGQKDLILGDQYNHSSLKNGA
BIKB1_BACAN     VGAGAVRTINGTLDLHIKLEETIAKFKHTEAAIAYQSGFNCNMAAISAVMDKNDAILSDELNHASIIDGS
BIKB_CYAP8      XXXXXXXXXXXHRELHQELETAIASLKQTEEALVFSSGYLANLGTITAIVGTRDLILGDQYNHSSLKNGS
BIKB1_BACCR     VGAGAVRTINGTLDLHIKLEETIAKFKHTEAAIAYQSGFNCNMAAISAVMDKNDAILSDELNHASIIDGS
BIKB_METC4      AGAGASRLVTGNSPPLAALEERLARHKGKEAALVFGSGYLANLGIAPALVGAGDLILIDELGHSCLFAGA
BIKB_METRJ      XXXXXSRLVTGDHPYLGALEDGLARHKGAEAALVFGSGYLANLGITPALAGRGDLVLLDELSHACMWAGA
BIKB_CAUSK      AGSGASRLVTGDHPXXXXXXXXXXXXKGAEACVVFGSGYLANTGLIPTFAGKGDIVLLDELAHACIWAGA
BIKB_BORPA      AGAQASRLVCGNLDLHEQVEAKLARLKGTEAALLLASGWQXXXXXXXXXXQGEPQVYTDRLNHASLHHGC
BIKB_STAAW      VGAGAVRTINGXXXXXXXXXXXXAKFKGTEAAIAYQSGFNCNMAAISAVMNKNDAILSDELNHASIIDGC
BIKB_STAAS      VGAGAVRTINGXXXXXXXXXXXXAKFKGTEAAIAYQSGFNCNMAAISAVMNKNDAILSDELNHASIIDGC
BIKB_STAAN      VGAGAVRTINGXXXXXXXXXXXXAKFKGTEAAIAYQSGFNCNMAAISAVMNKNDAILSDELNHASIIDGC
BIKB_STAAM      VGAGAVRTINGXXXXXXXXXXXXAKFKGTEAAIAYQSGFNCNMAAISAVMNKNDAILSDELNHASIIDGC
BIKB_STAAC      VGAGAVRTINGXXXXXXXXXXXXAKFKGTEAAIAYQSGFNCNMAAISAVMNKNDAILSDELNHASIIDGC
HEM1_RHIRD      AGAGGTRNISGTNHYHVLLEQELADLHGKESALIFTSGYVSNWATLGTLGQKIPGLISDALNHASMIEGI
BIKB_METEP      AGAGASRLVTGNSPPLAALEERLARHKGKEAALVFGSGYLANLGIAPALVGAGDLILIDELGHSCLFAGA
BIKB_STAAR      VGAGAVRTINGXXXXXXXXXXXXAKFKGTEAAIAYQSGFNCNMAAISAVMNKNDAILSDELNHASIIDGC
BIKB_AQUAE      LGSGASQLVSGYTKHHRELEEKLAEFKGTESCVLFGSGFLANVGTIPALVEEGDLVLSDELNHASIIDGV
HEM0_OPSTA      AGAGGTRNISGTSKYHVTLEKELAHLHQKDAALVFSSCFVANDSTLFTLAKMGCHIYSDAGNHASMIQGI
BIKB_METSB      AGSGASRLVTGNHPLLVELEERLARIKGTQAACVFGSGYLANTGIVPTLTGAKDLILIDELAHACLFAGT
BIOF_ANADE      XXXXXXXLVAGDLPPHGALEARLAAWKGREAALLFGSGYHANAGVPGALVGRDDAVFSDVLNHASIVDGC
BIKB_THEEB      TGATGSRLLSGQRHLHAQLERAIAQWKGTEAALVFSSGTAANLGTIAALVDQRDLVLGDAYNHACLKKGA
BIKB_CAUCR      XXXXXSRLVTGDHPLLSDLEKRLAHLKGTEAACVFGSGYLANTGVIPTLVGPGDVILIDALAHACIWAGA
BIKB_CAUCN      XXXXXSRLVTGDHPLLSDLEKRLAHLKGTEAACVFGSGYLANTGVIPTLVGPGDVILIDALAHACIWAGA
BIKB_ANASP      XXXXXXXXXXXHRELHGQLEKAIASWKQTEDALVFSSGYLANIGAIAALVGKRDLILSDQYNHSSLKNGA
HEM1_RHOS4      AGSGGTRNISGTTLYHKRLEAELADLHGKEAALVFSSAYIANDATLSTLPQLIPGIVSDKLNHASMIEGI
BIKB_MYCPA      AGATGSRLVTGDTELHQQFESELADYVGAASGLLFSSGYAANLGAVVGLSGRGALVVSDAYSHASLVDAC
BIKB_ANAVT      XXXXXXXXXXXHRELHGELEKAIASWKQTEDALVFSSGYLANIGAIAALVGKRDLILSDQYNHSSLKNGA
HEM1_RHOCA      AGSGGTRNISGTTAYHRRLEAEIADLHGKEAALVFSSAYIANDATLSTLRLLFPGLISDSLNHASMIEGI
HEM1_RICBR      VGSGGTRNIGGNNVAILELEQELASLHNKEASLVFTSGFVANDTTLATLAKIMPNIVSDELNHASIIAGI
BIKB_MYCLE      AGATGSRLVTGDTILHHELECELAEFVGACVGLLFSSGYAANLGAVVGLSGPGSLIVSDAYSHASLVDAC
BIKB_MYCLB      AGATGSRLVTGDTILHHELECELAEFVGACVGLLFSSGYAANLGAVVGLSGPGSLIVSDAYSHASLVDAC
BIKB_CYAP4      XXXXXXXXXXXHRELHRQLERAIAQLKQTEDALVFSSGYLANLGTIAALVGPRDLILSDQYNHSSLKKGA
HEM1_PARDP      AGSGGTRNISGTTVYHKRLEAELSDLHGKEAALVFSSAYIANDATLSTLRKLFPGLISDELNHASMIEGI
HEM0_RHOS4      AGTGGTRNISGTNRQHVALEAELADLHGKESALIFTSGWISNLAALGTLGKPECAIFSDALNHNSMIEGI
BIKB_GRABC      VGAGGSRLVTGNHPLYTALEVRLAALKGTEAAIVFGSGFLANIGIIPALIAPNDLILVDELXXXXXXXXX
BIKB_CYAP7      XXXXXXXXXXXHRPIHRELENAIASFKQTEDAIVFSSGYLANLGTITALVGQRDLILGDEYNHSSLKNGS
HEM1_RHIME      AGAGGTRNISGTNHYHVLLERELADLHGKESALLFTSGYVSNWAALGTLCSKIPGVISDAGNHASMIEGI
HEM1_BRAJA      XXXXXXXNIAGTHHPLVQLEAELADLHGKEAALLFTSGYVSNQTGIATIAKPNCLILSDELNHNSMIEGI
LCB2_SCHPO      LSTCSSNAICGTYGLHKEVEELTANFVGKPAALVFSQGFSTNATVFSTLMCPGSLIISDELNHTSIRFGA
HEM0_DANRE      AGAGGTRNISGTSNYHVALENELARLHQKDGALVFSSCFVANDSTLFTLAKMGCEIYSDMGNHASMIQGI
HEM0_PONAB      AGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKPGCEIYSDAGNHASMIQGI
BIKB_BORPE      AGAQASRLVCGNLDLHEQVEAKLARLKGTEAALLLASGWQXXXXXXXXXXQGEPQVYTDRLNHASLHHGC
HEM0_DELLE      AGAGGTRNISGTSRFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKPGCEIYSDAGNHASMIQGI
HEM1_RICCN      VGSGGTRNIGGNNIAILELEKELANLHKKQAALVFTSGFVANDTTLASLAKIMPDIVSDELNHASIIAGI
BIKB_BORBR      AGAQASRLVCGNLDLHEQVEAKLARLKGTEAALLLASGWQXXXXXXXXXXQGEPQVYTDRLNHASLHHGC
HEM1_RICFE      VGSGGTRNIGGNNIAILELEKELADLHKKQAALVFTSGFVANDTTLASLAKIMPDIVSDELNHASIIAGV
HEM0_BOVIN      AGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKPGCEIYSDAGNHASMIQGI
HEM0_HUMAN      AGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKPGCEIYSDAGNHASMIQGI
BIOF_RALSO      FGSGASHLVSGHSVAHARLEARMAA-LQAPHALCFCTGYMANMAVVSAMAQQDCTVFSDALNHASLIDGA
BIKB_TRIEI      XXXXXXXXXXXHREIHQELEREIAKLKQTESALVFSSGYLANIGVISSVVSQRDLILSDEYNHSSLKNGA
BIKB_MYCGI      AGATGSRLVTGNTELHEQFEDALASFVGADSALVFSSGYTANLGAVVALSGPGSLLVSDAYTHASLVDAC
BIKB_NOSP7      XXXXXXXXXXXHRELHRELEKAIASTKQTEDALVFSSGYLANLGAITALVGKRDLILSDQYNHSSLKNGA
BIKB_MYCVP      AGSTGSRLVTGNTELHEAFEDVLAAFVGAESALVFSSGYTANLGAVVALSGPGSLLVSDANTHASLVDAC
HEM0_RAT        AGAGGTRNISGTSKFHVELEQELAELHHKDSALLFSSCFVANDSTLFTLAKPGCEIYSDAGNHASMIQGI
HEM0_MOUSE      AGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKPGCEIYSDAGNHASMIQGI
BIKB_METNO      AGSGGSRLVTGDHPVFAELEAELARRKGHEAALVFGSGYLANLGITPALAGAGDLILIDELGHSCMWAGT
BIKB_MYCSJ      AGSTGSRLVTGNTELHEGFEQALAAFTGAESALVFSSGYTANLGAVVALSGPGSLLVSDALTHASLVDAC
SPTC3_HUMAN     TGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVFGMGFATNSMNIPALVGKGCLILSDELNHTSLVLGA
SPTC2_DICDI     VYTGSTSAEVGLSEPQRDLENLTARFVGKEDAIVFEMGFATNSGTLPALIGKGGLIISDSLNHASLATGC
BIKB_MYCSS      AGSTGSRLVTGNTELHEGFERALAAFTGAESALVFSSGYTANLGAVVALSGPGSLLVSDALTHASLVDAC
BIKB_MYCSK      AGSTGSRLVTGNTELHEGFERALAAFTGAESALVFSSGYTANLGAVVALSGPGSLLVSDALTHASLVDAC
BIKB_MYCA1      AGATGSRLVTGDTELHQQFESELADYVGAASGLLFSSGYAANLGAVVGLSGRGALVVSDAYSHASLVDAC
BIKB_MYCTU      AGATGSRLVTGDTKLHQQFEAELAEFVGAAAGLLFSSGYTANLGAVVGLSGPGSLLVSDARSHASLVDAC
BIKB_MYCTF      AGATGSRLVTGDTKLHQQFEAELAEFVGAAAGLLFSSGYTANLGAVVGLSGPGSLLVSDARSHASLVDAC
BIKB_MYCTA      AGATGSRLVTGDTKLHQQFEAELAEFVGAAAGLLFSSGYTANLGAVVGLSGPGSLLVSDARSHASLVDAC
BIKB_MYCBP      AGATGSRLVTGDTKLHQQFEAELAEFVGAAAGLLFSSGYTANLGAVVGLSGPGSLLVSDARSHASLVDAC
BIKB_MYCBO      AGATGSRLVTGDTKLHQQFEAELAEFVGAAAGLLFSSGYTANLGAVVGLSGPGSLLVSDARSHASLVDAC
HEM1_RAT        AGAGGTRNISGTSKFHVELEQELADLHGKDAALLFSSCFVANDSTLFTLAKMMPEIYSDSGNHASMIQGI
HEM1_RICPR      VGSGGTRNIGGNNISILELEKELADLHSKETALVFTSGFVANDTTLASLAKIIPDIVSDELNHASIIAGI
SPTC2_HUMAN     EEYGAGVCSTRQEIGHEELEELVARFLGVEAAMAYGMGFATNSMNIPALVGKGCLILSDELNHASLVLGA
SPTC2_CRIGR     KEYGAGVCSTRQEIGHEELEKLVARFLGVEAAMTYGMGFATNSMNIPALVGKGCLILSDELNHASLVLGA
SPTC2_MOUSE     KEYGAGVCSTRQEIGHEELEKLVARFLGVEAAMTYGMGFATNSMNIPALVGKGCLILSDELNHASLVLGA
LCB2_YEAST      IQSGGPRAQIGTTDLHIKAEKLVARFIGKEDALVFSMGYGTNANLFNAFLDKKCLVISDELNHTSIRTGV
HEM1_RICTY      VGSGGTRNIGGNNISILELEKELADLHSKETALVFTSGFVANDTTLASLAKIIPDIVSDELNHASIIAGI
HEM1_BOVIN      TGAGGTRNISGTSKFHVDLEQELADLHGKDAALLFSSCFVANDSTLFTLAKMMPEIYSDAGNHASMIQGI
BIKB_METS4      AGSGGSRLVTGSHPIXXXXXXXXXXRKGHEAALVFGSGYLANLGVTPALVGAGDLILIDELGHSCMWAGT
HEM1_SCHPO      XXXXXTRNIAGHNQHAVRLEKSLADLHQKPAALVFGSCYVANDATLSTLGRKNCIFLSDEMNHASMINGI
HEM1_OPSTA      SGAGGTRNISGTSKFHVELEQELADLHRKDAALLFTSCFVANDSTLFTLAKMGCEIYSDAGNHASMIQGI
HEM1_DELLE      TGAGGTRNISGTSKFHVDLEQELADLHGKDAALLFSSCFVANDSTLFTLAKMMPEIYSDSGNHASMIQGI
HEM1_PONAB      AGAGGTRNISGTSKFHVDLERELADLHGKDAALLFSSCFVANDSTLFTLAKMMPEIYSDSGNHASMIQGI
HEM1_HUMAN      AGAGGTRNISGTSKFHVDLERELADLHGKDAALLFSSCFVANDSTLFTLAKMMPEIYSDSGNHASMIQGI
HEM1_MOUSE      AGAGGTRNISGTSKFHVELEQALADLHGKDAALLFSSCFVANDSTLFTLAKMMPEIYSDSGNHASMIQGI
LCB2_KLULA      VYSGGPRTRIGTTDLHVMTEKYVAQFVGKEDAILFSMGYGTNANFFNSFLDSKCLVISDSLNHTSIRTGV
CQSA_VIBCH      QSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGA
HEM1_CANAL      SGAGGTRNIAGHNSHAIKLESELAALHKHDAALVFSSCFVANDAVLSLLGQKIKDLVSDELNHASMIQGI
BIKB_PHEZH      XXXXXXRLVTGDNPXXXXXXXXXXXXKGAEAACVFGSGYLANLGIIPTFMGAGDIVLVDELAHACIWGGA
HEM1_CHICK      AGAGGTRNISGTSKFHVDLEKELADLHGKDAALLFSSCFVANDSTLFTLAKMGCEIYSDSGNHASMIQGI
HEM0_CHICK      XXXXXTRNIGGTSPLHGALERALALLHRQPRAALFSSCFAANDTALDTLARPGCQVYSDAGNHASMIQGI
HEM1_ASHGO      AGAGGTRNIAGHNRHAMRLEAELAALHKKEGALVFSSCFVANDAVLSLLGQKNMVIFSDEMNHASMIMGI
HEM1_CANGA      AGAGGTRNIAGHNIPTMRLEAELAALHKKEGALVFSSCYVANDAVISLLGQKVKDLVSDELNHASMIVGI
HEM1_EMENI      AGAGGTRNISGHNQHAVSLENTLAKLHGKEAALVFSSCFVANDATLATLGSKMPDILSDSLNHASMIQGI
HEM1_YEAST      CGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKMKDLVSDELNHASMIVGI
CQSA_VIBHB      DNVVMSAIFLQDDDSKPAFETQLAEYVGMGSCLLSQSGWAANIGLLQTICPPETPVYIDFFAHMSLWEGI
HEM1_NEUCR      AGAGGTRNISGHNKHAVELENSLAKLHATDAALVFSSCYVANDATLATLGSKDCVILSDSLNHASMIQGI
BIKB_HELPY      HSPKASMLVNGYHPLHAELEERLANLLGFESALLVGSGFLGNLALIDTLLVKNALLFMDAHYHASGIFST
HEM1_KLULA      AGAGGTRNIAGHNKHALQLEAELATLHKKEGALVFSSCFVANDAVISLLGQKIKDLVSDELNHASMIVGI
SPTC3_MOUSE     VGVASTRNEMGTLDIHKELEDLMAEFLNVEAVMSFGMGFATNAMNIPVFVGKGCLILSDEFNHTSVILGS
HEM1_AGABI      HGAGGTRNIAGNG-AMXXXXXXXXXXXXXXXXXVFSSCYVANDATLSTLGTKLPGCVSDTMNHASMIQGM
BIKB_MYCUA      AGATGSRLVTGDTXXXXXXXXXXXXYVGAAAGLLFSSGYTANLGAVVGLSGPGSLLVSDAYSHASLVDAC
BIKB_MYCMM      AGATGSRLVTGDTXXXXXXXXXXXXYVGAAAGLLFSSGYTANLGAVVGLSGPGSLLVSDAYSHASLVDAC
HEM1_DEBHA      SGAGGTRNIAGHNIHALKXXXXXXXXXXXXXXXVFSSCFVANDAVLSLFGQKIKDLVSDELNHASMIQGI
HEM1_YARLI      AGAGGTRNIAGHNRHAVELEAAIADLHKKEAALVFSSCYVANDSTLSLLGQALPNCVSDASNHASMIHGI
SPTC1_PONAB     VGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDRAACFAIQKGL
SPTC1_MACFA     VGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDRAACFAIQKGL
SPTC1_HUMAN     VGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDRAACFAIQKGL
BIKB_HELPJ      HSPKASMLVNGYHPXXXXXXXXXXXXXXXXSALLVGSGFLGNLALIDTLLVKNALLFMDAHYHASGIFST
SPTC1_MOUSE     VGTCGPRGFYGTFDVHLDLEERLAKFMKTEEAIIYSYGFSTVASAIPAYSKRGDIIFVDSAACFAIQKGL
SPTC1_CRIGR     VGTCGPRGFYGTFDVHLDLEERLAKFMRTEEAIIYSYGFSTIASAIPAYSKRGDIVFVDSAACFAIQKGL
SPTC1_DICDI     VGSCGPRGFYGTIDVHLDLEKKTASFMKTPEAVLXXXXXXXXXXXXXXFSKIGDIIIVDRGVSQPVQVGV
LCB1_YEAST      VGACGPAGFYGNQDVHYTLEYDLAQFFGTQGSVLYGQDFCAAPSVLPAFTKRGDVIVADDQVSLPVQNAL
SPTC1_BOVIN     VGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGL
LCB1_SCHPO      LGACGPPGFYGTQDKHLRLEKDIASFIGVERAIVYAQSFQTISSVIPAFSKRGDILVVDEACNFAIQKGI
CSD_CHLTR       --------------AHWQVRSKVGSWIGYDQEIIFTRGTTSSLNLLA--IAANDSVISEAEHHANLVSAC
ASTC_ECOUT      HTGNGYTNEPVLRLAKKLIDATFAD-----RVFFCNSGAEANEAALKLARKKSGIVAFKNAFHGRTLFTV
ASTC_ECOL6      HTGNGYTNEPVLRLAKKLIDATFAD-----RVFFCNSGAEANEAALKLARKKSGIVAFKNAFHGRTLFTV
ASTC_ECOL5      HTGNGYTNEPVLRLAKKLIDATFAD-----RVFFCNSGAEANEAALKLARKKSGIVAFKNAFHGRTLFTV
ASTC_ECOK1      HTGNGYTNEPVLRLAKKLIDATFAD-----RVFFCNSGAEANEAALKLARKKSGIVAFKNAFHGRTLFTV
ASTC_ECO81      HTGNGYTNEPVLRLAKKLIDATFAD-----RVFFCNSGAEANEAALKLARKKSGIVAFKNAFHGRTLFTV
ASTC_ECO45      HTGNGYTNEPVLRLAKKLIDATFAD-----RVFFCNSGAEANEAALKLARKKSGIVAFKNAFHGRTLFTV
CSD_CHLMU       --------------AYWRVRSKVAAWIGYDQEIVFTRGTTSSLNLLA--IAANDSVVSEAEHHANILSAC
SPSS_METKA      --------------------EDLAEFLGMDVVRITAGARYAKEAVMSALCEEGDVVVADSLAHYTTFVAA
YAAO_BACSU      -------------------QELASQLYGSAESFFLVNGTTVNLAMILSVCEPGDTILVQRNCHKSVFHAV
ARGD_XYLFA      ----------------------------------------------------------------------
ARGD_XYLFT      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
BIOF_SALHS      NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
BIOF_SALTY      NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
BIOF_SALTI      NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
BIOF_SALG2      NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
BIOF_SALEP      NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
BIOF_SALSV      NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
BIOF_SALCH      NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
BIOF_SALPK      NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
BIOF_SALPA      NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
BIOF_SALDC      NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
BIOF_SALA4      NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
BIOF_SALPB      NLSPAQLRRFIHNDTQHLSRLLQSPSVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
BIOF_SALNS      NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
BIOF_SALPC      NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
BIOF_SALAR      NLSPAQLRRFIHNDTQHLSRLLQSPCPGQQLVVAEGIYSMDGDSAPLAEIQQITHKHHAWLLVDDAHGIG
BIOF_CITK8      NLSPATLRRFTHNDPQHLARLLDAPCGGQQLVVTEGIFSMDGDGAPLAEIHRAARQRNAWLLVDDAHGIG
BIOF_ENT38      NLSPAQLRRFAHNDASQLNTLLEKPCDGQQLVVTEGVFSMDGDSAPLGDVQATAQRHSAWLLVDDAHGIG
BIOF_ECOLU      XXXXXQLRRFTHNDVAHLARLLASPCPGQQLVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_ESCF3      XXXXXQLRRFTHNDVAHLARLLASPCPGQQLVVTEGVFSMDGDRAPLAEIQQVTQQHNGWLVVDDAHGTG
BIOF_ECOSM      XXXXXXXRRFAHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLEEIQQVTQQHDGWLMVDDAHGTG
BIOF_ECO5E      XXXXXXXRRFVHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_ECO57      XXXXXXXRRFVHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_ECO8A      XXXXXXXRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_ECOLC      XXXXXXXRRFVHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_ECOHS      XXXXXXXRRFVHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_SHIDS      XXXXXXXRRFVHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLGEIQQVTQQHNGWLMVDDAHGTG
BIOF_ENTAG      SFSPAQLRRFAHNDVSQLAALLDKPCDGQQLAVTEGVFSMDGDSAPLAAIAEQVRRAGAWLLVDDAHGIA
BIOF_SHIBS      XXXXXXXRRFVHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_SHIB3      XXXXXXXRRFVHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_ECOLI      XXXXXXXRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_ECODH      XXXXXXXRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_ECOSE      XXXXXXXRRFAHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_ECO24      XXXXXXXRRFAHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_ECO55      XXXXXXXRRFVHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDIAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_ECO27      XXXXXXXRRFAHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLEEIQQVTQQHDGWLMVDDAHGTG
BIOF_SHIFL      XXXXXXXRRFTHNDVAHLARLLASPCPGQQLVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_SHIF8      XXXXXXXRRFTHNDVAHLARLLASPCPGQQLVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_SHISS      XXXXXXXRRFTHNDVAHLARLLASPCPGQQLVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
BIOF_ECOL6      XXXXXXXRRFAHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLEEIQQVTQQHDGWLMVDDAHGTG
BIOF_ECOL5      XXXXXXXRRFAHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLEEIQQVTQQHDGWLMVDDAHGTG
BIOF_ECO81      XXXXXXXRRFAHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLEEIQQVTQQHDGWLMVDDAHGTG
BIOF_ECOUT      XXXXXXXRRFAHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLEEIQQVTQQHDGWLMVDDAHGTG
BIOF_ECOK1      XXXXXXXRRFAHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLEEIQQVTQQHDGWLMVDDAHGTG
BIOF_ECO45      XXXXXXXRRFAHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLEEIQQVTQQHDGWLMVDDAHGTG
BIOF_ECO7I      XXXXXXXRRFAHNDVTHLARLLASPCPGQQLVVTEGVFSMDGDSAPLEEIQQVTQQHDGWLMVDDAHGTG
BIOF_KLEP3      XXXXXQLRRFAHNDPXXXXXXXXKPLDGLQLVVTEGIFSMDGDSAPLADIQAAARSAGALLLVDDAHGIG
BIOF_ERWCT      AQSPATLRRFKHNQADSLQALLEKPTDGQTLVVTEGVFSMDGDTAPLPALQAQCRAHDAWLMVDDAHGIG
BIOF_YERE8      THSPAQLRRFAHNQPDSLQKLLNKPCSGQTLVVTEGVFSMDGDSAPLAAIQQHTAAAGGWLLVDDAHGLG
BIOF_PHOLL      MHSPAQLRRFLHNQPESLANLLATPCVGKTLVVTEGVFSMDGDCAPLADIHQQTRISGNWLMVDDAHGIG
BIOF_ENTS8      XXXXXTLRRFAHNDSGALAALLGKPCDGLTLVFTEGVFSMDGDSAPLADIAGIAQGAQTLLMVDDAHGVG
BIOF_KLEP7      XXXXXQLRRFTHNDXXXXXXXXXXXXXGEQLAVTEGIFSMDGDSXXXXXXXXXXXXXXXVLLVDDAHGVG
BIOF_PROMH      ILSPASLWRFLHNSAPSLSQRLHKTSANKSLVVTEGVFSMDGDKAPLAAMAEISQQHQAWLMVDDAHGIG
BIOF_SERP5      XXXXXQLRRFRHNQPQALADLLAKPCDGQILAVTEGVFSMDGDSAPLAELHRLTRAAGAWLMVDDAHGIG
BIOF_SODGM      MHSPATLRRFAHNDADALQRLLRRDCAGNRLVITEGVFSMDGDRAPLPALAEITRAAGCWLMVDDAHGIG
BIOF_SERMA      XXXXXXXXXXXXQSTAGLARILAKPCDGQRLAVTEGLFSMDGDGAPLAELHRLTRAAGAWLMVDDAHGIG
BIOF_YERPS      XXXXXQLRRFQHNQPEALQNLLIKPCQGQTLVVTEGVFSMDGDSAPLAALQQQTSAAGGWLLVDDAHGIG
BIOF_YERPB      XXXXXQLRRFQHNQPEALQNLLIKPCQGQTLVVTEGVFSMDGDSAPLAALQQQTSAAGGWLLVDDAHGIG
BIOF_YERPY      XXXXXQLRRFQHNQPEALQNLLIKPCQGQTLVVTEGVFSMDGDSAPLAALQQQTSAAGGWLLVDDAHGIG
BIOF_YERP3      XXXXXQLRRFQHNQPEALQNLLIKPCQGQTLVVTEGVFSMDGDSAPLAALQQQTSAAGGWLLVDDAHGIG
BIOF_ERWT9      XXXPATLRRFGHNQPSXXXXXXXXXXXXXXXXXXXXIFSMDGDRAALKPIHQLARDRDGWLLVDDAHGVG
BIOF_PHOPR      LLSPATMRRFAHNDLSALTRLLHQPSINP-LVITEGVFSMDGDLSPLANISEQCSQHDAWLMVDDAHGCG
BIOF_YERPP      XXXXXQLRRFQHNQPEALQNLLIKPCQGQTLVVTEGVFSMDGDSAPLAALQQQTSAAGGWLLVDDAHXXX
BIOF_YERPN      XXXXXQLRRFQHNQPEALQNLLIKPCQGQTLVVTEGVFSMDGDSAPLAALQQQTSAAGGWLLVDDAHXXX
BIOF_YERPG      XXXXXQLRRFQHNQPEALQNLLIKPCQGQTLVVTEGVFSMDGDSAPLAALQQQTSAAGGWLLVDDAHXXX
BIOF_YERPE      XXXXXQLRRFQHNQPEALQNLLIKPCQGQTLVVTEGVFSMDGDSAPLAALQQQTSAAGGWLLVDDAHXXX
BIOF_YERPA      XXXXXQLRRFQHNQPEALQNLLIKPCQGQTLVVTEGVFSMDGDSAPLAALQQQTSAAGGWLLVDDAHXXX
BIOF_VIBPA      ALSTAKMKRFKHNDIKHLETLFTNE--GNHLVVTEGVFSMDGDCAPLKDIAEVARLRNAWLAVDDAHGIG
BIOF_VIBSL      MLSPATMKRFKHNDTQHLESLLQTP---QSLVVTEGVFSMDGDQAPLRQISSLTNQYDSWLAVDDAHGIG
BIOF_ALISL      ILSPASMKRFKHNDVAHLDKLLKASICNPSLVVTEGVFSMDGDLSPLSELSRVTKENNAWFMVDDAHGCG
BIOF_VIBF1      MLSPAVMKRFKHNDVDHLKSLLKRSSDEPTLVVTEGVFSMDGDLSPLADIAKLTKENDAWLMVDDAHGCG
BIOF_VIBFM      MLSPAVMKRFKHNDVGHLKSLLKRSSDEPTLVVTEGVFSMDGDLSPLADIATLTKENDAWLMVDDAHGCG
BIOF_BUCBP      YNSSGKCYRFIHNNPSSLMNKFYSSSGKNPLIITEGIFSMDGDIAPLXXXXXXXXXXXGLLMVDDAHGIG
BIOF_VIBHB      MLSPAKMKRFKHNDIAHLNSLLSSE--DNHLVVTEGVFSMDGDCAPLADIAEVTSSHDAWFAVDDAHXXX
BIOF_VIBVU      LLSPATMKRFKHNDLKALDTILRSDC--PSLVVTEGVFSMDGDCSPLAEMHALTQRHSASLMVDDAHGVG
BIOF_VIBVY      LLSPASMKRFKHNDLQALDAILRSDC--PSLVVTEGVFSMDGDCSPLAEMHALTQRYSASLMVDDAHGVG
BIOF_VIBCH      MLSPATMKRFKHNDTEHLRQLLHEQ--SNSLVVTEGVFSMDGDCAPLAQIATLVKQR-AWLMVDDAHGIG
BIOF_AERHH      SQLPCKMKRFGHNDMTALERQLEP---NRGLIVSEGVFSMDGDQGSWRELAALAAQSGNWLMIDDAHGLG
BIOF_MARMS      LLAQAPLRRYLHGDVASAQKLIARSAAGG-LLITDGVFSMDGDIAPLTELSQLANQHDWMFMVDDAHGLG
BIOF_AERS4      SQLPCKMKRFGHNDMTALERQLEP---NRGLIVSEGVFSMDGDQGPWPELARLAAQSGNWLMIDDAHGLG
BIOF_THISH      LLSGARFQRYRHATAVDLARLAGLGQTGERLVLTDGVFSMDGNLAPLPELASICTAHQAWLLVDDAHGLG
BIOF_MARAV      ILSRARVRRYAHGDVAALETML-SETSGHKLVVTDGVFSMDGDIAPLTELARVCKAHDALLVVDDAHGVG
BIOF_HERAR      QLSRADHQRYPHGDLTALERQLSASKAKRKLILTDAVFSMDGDLAPLTQLLELAERYDAWLMVDDAHGFG
BIOF_HAHCH      MLSGARLLRYRHADAEHLALRLDEVGDSRALVITDGVFSMDGDIAPLDAIAQVCHSKDAMLMVDDAHGFG
BIOF_PSEPF      XXXXXRFNRYLHNDADSLAKRLEK-ATGNTLVVTDGVFSMDGDLADLPALARETKAKGAWLMVDDAHGFG
BIOF_PSEE4      XXXXARFSRYLHNDPASLASRLEK-ATGNTLVVTDGVFSMDGDCANLPALADVARARGAWLMVDDAHXXX
BIOF_SACD2      LISGAKFHRFRHNDCEHLNTQLEKSTAARKLIVVDGVFSMDGDAANLNQLAASAKKHNAWLMVDDAHGFG
BIOF_NITMU      LLSRARLSRYPHLDLATLERQLAASPARRKLVISDAVFSMDGDIAPLPELLELCERYDAWLLLDDAHGFG
BIOF_PSEF5      XXXXXRFNRYLHNDAHSLAKRLEK-ATGNTLVVTDGVFSMDGDVADLPALARATKARGAWLMVDDAHXXX
BIOF_PSE14      XXXXXRFSRYLHNDVTSLASHLEKS-VGDTLVVTDGVFSMDGDIXXXXXXXXXXXXXXXWLMVDDAHGFG
BIOF_PSESM      XXXXXRFSRYLHNDAGSLNARLEK-AVGDTLVVTDGVFSMDGDIXXXXXXXXXXXXXXXWLMVDDAHGFG
BIOF_ALCBS      XXXXARFRRFPHNDGQALASQLARSEARRKLVVVDGVFSMDGDEAPLVDYAEACEGHDAWLMVDDAHGIG
BIOF_PSEU2      XXXXXRFSRYLHNDVSSLEARLEKS-VGDTLVVTDGVFSMDGDIADLPALARSAKAKGAWLMVDDAHGFG
BIOF_NITEC      LLSRARFIRYPHLDLVTLEKQLKTIQARRRLIVTDAVFSMDGDRAPVAELLALCQRFDAWLLLDDAHGFG
BIOF_AZOSE      LLSRAELHRYAHGDPXXXXXXXXXXXXXXKLIVTDAVFSMDGDVAPLATLLELAERFDAWLMVDDAHGFG
BIOF_XYLFT      RLAGCRLRRYPHLDVDGAAHQLKNAPEGAAMLATDGIFSMDGDIAPLRALSLVARTQQALMYVDDAHGIG
BIOF_XYLFM      RLAGCRLRRYPHLDVDGAAHQLKNAPEGAAMLATDGIFSMDGDIAPLRALSLVARTQQALMYVDDAHGIG
BIOF_XYLF2      RLAGCRLRRYPHLDVDGAAHQLKNAPEGAAMLATDGIFSMDGDIAPLRALSLVARTQQALMYVDDAHGIG
BIOF_PSEU5      XXXXXRFSRYLHNDASSLAKRLEK-ASGNTLVVTDGVFSMDGDLADLPALCAEAKRHGAWVMVDDAHGFG
BIOF_DECAR      QLAKAEVQRYPHNDVAALEKMLAASTAAHKIIVTDAVFSMDGDLAPLPLIFALAERYDAWLVIDDAHGFG
BIOF_THICR      RYSEADLKRYPHLDMQALEKRLQKAQQEQCLIVTDGVFSMDGDCAPLQTIQALAKTYQAWLFLDDAHGFG
BIOF_BURPP      RLSRADVQIYPHCDTEALSAMLEASDADVKVIVSDTVFSMDGDIAPLPRLLELAEQHGAWLIVDDAHGFG
BIOF_BURXL      RLSRADVQIYPHCDTDALSAMLEASDADVKVIVSDTVFSMDGDIAPLPRLLELAEQHGAWLIVDDAHGFG
BIOF_ALHEH      RLSGARLRRYRHGDVDHLARRLAEDGGRHRLIVTDGVFSMDGDRAPVAELARLARDHGAWLMVDDAHXXX
BIOF_GEOUR      LLSRARFVRYPHNNISVLRRLLEDTEVGRRLIVTDGVFSMDGDLAKLSELVALKKEFDALLMVDDAHGTG
BIOF_GEOBB      LLSRADLHRYPHRDMAALERLLQDKGGGRRLIVTDGVFSMDGDIAPLQDLVRLAKKYGALLMVDDAHGTG
BIOF_METFK      LLSRAELKRYAHNDLTGLERLLAQSQARRKLVVADAVFSMDGDLAPVPALLSLCERYDAYLMLDDAHGFG
BIOF_NITOC      XXXXXRFKRYRHRDYQSLEXXXXXXXXXXXXVVTDGVFSMDGXXXXXXXXXXXXXRFDAWLMVDDAHGLG
BIOF_PSEAB      XXXXXRFSRYLHNDPASLAARLDK-AEGNTLVVTDGVFSMDGNXXXXXXXXXXXXXXXXXXMVDDAHGFG
BIOF_PSEA8      XXXXXRFSRYLHNDPASLAARLDK-AEGNTLVVTDGVFSMDGNXXXXXXXXXXXXXXXXXXMVDDAHGFG
BIOF_AZOSB      LLSRADMHRYPHGDLAVLARQLAGSSAARKLIVTDAVFSMDGDVAPLADLLELAERHDAWLMVDDAHGFG
BIOF_GEOMG      LLSRATMVRYPHNDTAALRRLMEHETAGRRLLVTDGVFSMDGDMAPLRELAALKREFGALLMVDDAHGTG
BIOF_BURP8      RLSRADIQIYPHADAEALGAMLEASDAAVKLIVSDTVFSMDGDIAPLARLLELAEHHGAWLVVDDAHGFG
BIOF_PSEPG      XXXXARFNRYLHNDSASLASRLDK-AVGNTLVVTDGVFSMDGXXXXXXXXXXVARGRGAWLMVDDAHXXX
BIOF_XYLFA      RLAGCRLRRYPHLDVDGAAHQLKNAPEGAAMLATDGIFSMDGDIAPLRALSLVARTQQALMYVDDAHGIG
BIOF_PSEAE      XXXXXRFSRYLHNDPASLAARLDK-AEGNTLVVTDGVFSMDGNXXXXXXXXXXXXXXXXXXMVDDAHGFG
BIOF_PSEPW      XXXXARFNRYLHNDAVSLANRLGKAC-GNTLVVTDGVFSMDGDLADLPALAEVARARGAWLMVDDXXXXX
BIOF_BURM1      RLSRATVQVYPHADTATLGALLEACTSQTKLIVTDTVFSMDGDIXXXXXXXXXXXRHGAWLVVDDAHGFG
BIKB_GEOKA      RLSKAACFRYRHHDIDQLESLLQSPPAKRKWIVTDAVFSMDGDMAPLEELVELKRRYRAVLLVDEAHSGG
BIOF_PSEMY      LLCGARFSRYLHNDAVSLANRLRK-ASGNCLVVTDGVFSMDGDLADLPVLCAEARARDAWVMVDDAHGFG
BIOF_NITEU      LLSRARFIRYPHLDLDTLARQLETTKARRRLVVTDAVFSMDGDMAPVAELLTLCQRFDAWLLLDDAHGFG
BIOF_ACIF5      RLSGARLHRYRHGDMTHLAQWLERGGRGQAWIITDGVFSMDGDIAPLPELATLAQQYGAGIILDEAHAFG
BIOF_ACIF2      RLSGARLHRYRHGDMTHLAQWLERGGRGQAWIITDGVFSMDGDIAPLPELATLAQQYGAGIILDEAHAFG
BIOF_BURCM      RLSRANVQVYPHXXXXXXXXXXXXXXXETKLIVSDTVFSMDGDIAPLAELVALAERHGAWLVVDDAHGFG
BIOF_RALME      RLARADVQRYPHXXXXXXXXXXXXXXXXXKLIVTDSVFSMDGDIAPLAALLEVAERHDAWIIVDDAHGFG
BIOF_PSEPK      XXXXARFNRYLHNDPASLASRLDK-AVGNTLVVTDGVFSMDGDLADLPALANVARARGAWLMVDDAHXXX
BIKB_DESAP      LLSGAKLVRFSHNDADSLRRLLNQHTGRRRFIVTEGLFSMDGDIPPLPEFYTLAQEFEAILIVDDAHGTG
BIOF_RALEH      RLARADVQRYPHCDXXXXXXXXXXXXXXRKLIVTDSVFSMDGNVAPLRKLLELAERHDAWIIVDDAHGFG
BIOF_CHRVO      LLSRADFQRFRHNDLAHLEQLLADSGAPTKLIAVDAVYSMDGDQXXXXXXXXXXERYDAWLYVDDAHGFG
BIOF_BURA4      RLSRANVQVYPHXXXXXXXXXXXXXXXETKLIVSDTVFSMDGDIAPLAELVALAERHGAWLVVDDAHGFG
BIOF_GEOSF      LLSRAKVIRYSHNDMVALRRLLEESTSGRRIIVTDGVFSMDGDXXXXXXXXXXXXXXXXXXMVDDAHGTG
BIOF_BURCC      RLSRANVQVYPHXXXXXXXXXXXXXXXETKLIVSDTVFSMDGDIAPLTELVALAERHGAWLVVDDAHGFG
BIOF_GEOSL      LLSRARFVRYPHNDMNALERLLEHRGAGRMLIVTDGVFSMDGDLAPLPALVALKRQYGALLMVDDAHGTG
BIOF_CELJU      XXXXARFQRFLHSDINNLQARLRKTDAARKLVVVDGVFSMDGDCAPLPQLAQVCAQENAWLMVDDAHGFG
BIOF_JANMA      RLSRANVQVYPHGDLDKLAILLAASTADNKMVVTDSVFSMDGDLAALPQLLALCEQHGAWLVVDDAHGFG
BIOF_BURCH      RLSRANVQVYPHXXXXXXXXXXXXXXXXXKLIVSDTVFSMDGDIAPLAELVALAERHGAWLVIDDAHGFG
BIOF_BURCA      RLSRANVQVYPHXXXXXXXXXXXXXXXXXKLIVSDTVFSMDGDIAPLAELVALAERHGAWLVIDDAHGFG
BIOF_GEOLS      LLSGARLIRYPHNDTLALARLLQHQTDGLRLIVTDGVFSMDGDIAPLQGIADLAEQHRALLMVDDAHAGG
BIKB_PELCD      RLSRAKTVVYPHRDTHALERLMAKEAPGQWLIVTDGVFSMDGDLAPLPELVALKKRYDCLLMVDDAHGTG
BIOF_BACSU      RLSKADTVVYRHIDMNDLNKLNETQRYQRRFIVTDGVFSMDGTIAPLDQIISLAKRYHAFVVVDDAHATG
BIOF_PSEA7      XXXXXRFSRYLHNDPASLAARLDK-AEGNTLVVTDGVFSMDGNXXXXXXXXXXXXXXXXXXMVDDXXXXX
BIOF_METCA      XXXXARFRRYRHXXXXXXXXXXXXXXXXXXXVVTDGVFSMDGDLAPLPELARVARDGRAWLMVDDAHGLG
BIOF_BURPS      RLSRANVQIYPHGXXXXXXXXXXXXXXPTKLIVSDTVFSMDGDVAPLARLVALAETHGAWLVVDDAHGFG
BIOF_BURP6      RLSRANVQIYPHGXXXXXXXXXXXXXXPTKLIVSDTVFSMDGDVAPLARLVALAETHGAWLVVDDAHGFG
BIOF_BURP0      RLSRANVQIYPHGXXXXXXXXXXXXXXPTKLIVSDTVFSMDGDVAPLARLVALAETHGAWLVVDDAHGFG
BIOF_BURMS      RLSRANVQIYPHGXXXXXXXXXXXXXXPTKLIVSDTVFSMDGDVAPLARLVALAETHGAWLVVDDAHGFG
BIOF_BURMA      RLSRANVQIYPHGXXXXXXXXXXXXXXPTKLIVSDTVFSMDGDVAPLARLVALAETHGAWLVVDDAHGFG
BIOF_BURM9      RLSRANVQIYPHGXXXXXXXXXXXXXXPTKLIVSDTVFSMDGDVAPLARLVALAETHGAWLVVDDAHGFG
BIOF_BURM7      RLSRANVQIYPHGXXXXXXXXXXXXXXPTKLIVSDTVFSMDGDVAPLARLVALAETHGAWLVVDDAHGFG
BIOF2_POLSJ     LLAKATMQRYAHRNLTVLASQLESCTTPIKLIVTDAVFSMDGXXXXXXXXXXXXERFDAWLIVDDAHGFG
BIOF_BURTA      RLSRANVQVYPHGXXXXXXXXXXXXXXPTKLIVSDTVFSMDGDVAPLARLVALAEAHGAWLVVDDAHGFG
BIOF_BURP1      RLSRANVQIYPHGXXXXXXXXXXXXXXPTKLIVSDTVFSMDGDVAPLARLVALAETHGAWLVVDDAHGFG
BIOF_PSEP1      XXXXARFNRYLHNDPASLASRLDK-AVGNTLVVTDGVFSMDGXXXXXXXXXXXXXXRGAWLMVDDAHXXX
BIOF_CUPTR      RLARADVQRYPHCXXXXXXXXXXXXXXXRKLIVTDSVFSMDGNVAPXXXXXXXXXXHDAWIVVDDAHGFG
BIOF_BURCJ      RLSRANVQVYPHXXXXXXXXXXXXXXXXXKLIVSDTVFSMDGDXXXXXXXXXXXXRHGAWLVVDDAHGFG
BIOF_BURS3      RLSRANVQVYPHXXXXXXXXXXXXXXXETKLIVSDTVFSMDGDXXXXXXXXXXXXRHGAWLVVDDAHGFG
BIOF_BACLD      RLSKADTVVYRHKDMNDLEEKLRAASRARRFIVTDGVFSMDGTIAPLDEIMLLAKQYRAFVIVDDAHATG
BIOF_RALPJ      RLSRAPIKVYPHVDXXXXXXXXXXSTSRNKLIVTDGVFSMDGDIXXXXXXXXXXXRYDAWLIVDDAHGLG
BIKB_BACHD      QLSRADHLRFRHNDMDHLETLLQKSPHKQKLIVVDALFSMDGDHANLHDLVTLKERYGAILMVDEAHSXX
BIKB_EXIS2      RLTKAKRRIYNHVDLADLEAALQETQDARRLVVTDGVFSMDGNIAPLPEIVELAEKYDALVMVDDAHASG
BIOF_CHRSD      RLAGATSRRFXXXXXXXXXXXXXXPDDAPTLVVSDGVFSMDGDVAEVGALAATARRHGAWLMIDDAHGLG
BIOF_BACSH      RLSKAKTIVYEHADMVDLERKLQSHGDGLKFIVTDGVFSMDGDIAPLPKIVELAKEYKAYIMIDDAHATG
BIKB_BACCQ      ILSGAEHKRYGHNDLDHLEKLLKTASPEKRLIVTDTVFSMDGDTAYLRELVELKEKYGAILIVDEAHASG
BIKB_BACC7      ILSGAEHKRYGHNDLDHLEKLLKTASPEKRLIVTDTVFSMDGDTAYLRELVELKEKYGAILIVDEAHASG
BIOF1_POLSJ     RLSSAQIHRYPHADLAALEQELISSPARRKLIISDAVFSMDGDVADVPALLALCERHXXXXXXXXXHGFG
BIKB_BACC2      ILSGAEHKRYRHNDLDHLEKLLKSP-EKRKLIVTDTVFSMDGDTAYLRDLVQLKEKYGAIIIVDEAHASG
BIOF_BACNA      RLSKADTVVYRHIDMNDLNKLNETQRYQRRFIVTDGVFSMDGTIVPLDQIISLAKRYHAFVVVDDAHATG
BIOF_STRM5      RLAGARLRRYPHLDTEGAMRQLKHAPDGAAMLATDGVFSMDGDIAPLRALSLVARLQQA-LFYXXXXXXX
BIOF_STRMK      RLAGARLRRYPHLDAEGAMRQLKHAPDGAAMLATDGVFSMDGDIAPLRALSLVARLQQAYXXXXXXXXXX
BIKB_BACC4      ILSGAEHKRYRHNDLDHLEKLLKSP-EKRKLIVTDTVFSMDGDTAYLRDLVQLKEKYGAIIIVDEAHASG
BIKB2_BACCR     ILSGAEHKRYRHNDLDHLEKLLKSP-EKRKLIVTDTVFSMDGDTAYLRDLVQLKEKYGAIIIVDEAHASG
BIOF_BACA2      RLSKAETIVYRHIDMADLEKKLASQARNRRFIVTDGVFSMDGTIAPLDRIMALAKQYQAFVIADDAHATG
BIKB_BACC1      ILSGAEHKRYRHNDLDHLEKLLKTASPEQRLIVTDTVFSMDGDTAYVRELVELKEKYGAILIVDEAHASG
BIKB_ANOFW      MLSRAEVKRYRHADVEHLETLLKAERHKRKIIVTDTIFSMDGDVAPLRELVVLKETYGAMLVVDEAHASG
BIKB_ALKOO      RLSRADKTIFKHADMNNLEEVLKADKYRNMLIITDGVFSMDGDIAPLPDIVGLAEKYNAMTYVDDAHGSG
BIOF_XANC5      RLAGCRLRRYPHLDVEGAMRQLKGAPEGAAMLATDGVFSMDGDVAPLRALSLVARMQHALFYVDDAHGVG
BIKB_BACWK      ILSGAEHKRYRHNDLDHLEKMLQSP-EKRKLIVTDTVFSMDGDIAYLRGLVQLKEKYGAIIIVDEAHASG
BIOF_RALEJ      RLARADVQRYPHCXXXXXXXXXXXSTSPLKLIVTDSVFSMDGDVXXXXXXXXXXXRHDAWIIVDDAHGFG
BIKB_BACCN      KLSGAKQKRYRHNDLHHLEQLLQTPSEKRKLIVTDTVFSMEGDVAHLKELIALKEKYGALLMIDEAHASG
BIOF_LEPCP      LLAKAKLQRYAHRQFDVLERQLAACTTPIKLIVTDAVFSMDGDLAELDQLLSLAERFDAWLVIDDAHGFG
BIOF_XANAC      RLAGCRLRRYPHLDVEGAMRQLKGAPEGAAMLATDGVFSMDGDVAPLRALSLVARMQQALFYVDDAHGVG
BIOF_METPP      RLSRADLTVYPHNDXXXXXXXXXXXXXXXXXXXXXXXFSMDGDLAPLPEMLALCERHDAWLYVDDAHGFG
BIKB_BACCZ      ILSGAEHKRYRHNDLNHLEALLKTASPEKRLIVTDTVFSMDGDTAYLRELVQLKEKYGAIIIVDEAHASG
BIOF_BURVG      RLSRANVQIYPHADMHALGALLDASDAPTKLIVSDTVFSMDGDXXXXXXXXXXXXRHGAWLVVDDAHGFG
BIKB_BACA2      RLTKADKKVYRHVDMDDLERVLKSMNYRMRLIVTDGVFSMDGNIAPLPDIVKLAEAYDAFVMVDDAHASG
BIKB_PASMU      RLAQCEFVRFRHHDYAHLEQILQDRTFERIIVVTESVFSMDGDCADLTQLVALKQRYQVMLYVDEAHAIG
BIKB_BACHK      ILSGAEHKRYRHNDLNHLEALLKTASPEKRLIVTDTVFSMDGDTAHLRELVQLKEKYGAIIIVDEAHASG
BIOF_MYXXD      RLSRARVCVYPHADVEALTRALAETPARRKLVVTDTVFSMDGDVAPLRDIVAACRAHGAALMVDEAHATG
BIKB_DESOH      RLARCAVTLFDHNDPAHLEKLLVETAFSRRLIVTESVFSMDGDCCDMDALAGLAQAHDALLMVDEAHATG
BIKB_BACC0      ILSGAEHKRYRHNDLNHLEALLKTASPEKRLIVTDTVFSMDGDTAHLRELVQLKEKYGAIIIVDEAHASG
BIKB2_BACAN     ILSGAEHKRYRHNDLNHLEALLKTASPEKRLIVTDTVFSMDGDTAHLRELVQLKEKYGAIIIVDEAHASG
BIOF_XANOR      RLAGCRLRRYPHLDVEGAMRQLKGAPEGAAMLASDAVFSMDGDVAPLRALSLVARMQDALFYVDDAHGVG
BIOF_XANOP      RLAGCRLRRYPHLDVEGAMRQLKGAPEGAAMLASDAVFSMDGDVAPLRALSLVARMQDALFYVDDAHGVG
BIOF_XANOM      RLAGCRLRRYPHLDVEGAMRQLKGAPEGAAMLASDAVFSMDGDVAPLRALSLVARMQDALFYVDDAHGVG
BIKB_BACP2      RLTKADKKVYGHANMEELEKILKSMNYRVRLIVTDGVFSMDGDIAPLSEIVRLAEAYDAFVMVDDAHASG
BIKB_HAEDU      RLAGCDFYRYQHNNLAHLTQLLEKH-TGQYIIVTESVFSMDGDVAPLPQLVALKKQTEVMLYVDEAHAIG
BIKB_BACSU      RLTKADKKVYQHVNMSDLERVLKSMNYRMRLIVTDGVFSMDGNIAPLPDIVELAEKYDAFVMVDDAHASG
BIKB_BACAH      ILSGAEHKRYRHNDLNHLEVLLKTASPEKRLIVTDTVFSMDGDTAYLRELVQLKEKYGAIIIVDEAHASG
BIOF_CLOTH      RLSGAKLVVYKHCDMEDLESKIVRYHTGKSLIVTDGVFSMDGDVAPVDRIVKLAKKYNLMTMVDDAHATG
BIOF_XANCB      RLAGCRLRRYPHLDVEGAMRQLKGAPEGAAMLASDGVFSMDGDVAPLRALSLVARMQEALFYVDDAHGVG
BIKB_ALKMQ      RLSRADKTVFKHADMDNLEQVLKEDKYRNKLIITDGVFSMDGDIAPLPDIVELAEKYGAMTYVDDAHGSG
BIOF_XANCP      RLAGCRLRRYPHLDVEGAMRQLKGAPEGAAMLASDGVFSMDGDVAPLRALSLVARMQEALFYVDDAHGVG
BIOF_XANC8      RLAGCRLRRYPHLDVEGAMRQLKGAPEGAAMLASDGVFSMDGDVAPLRALSLVARMQEALFYVDDAHGVG
BIKB_SYMTH      RLSKAKIHRYKHADMDDLARVLKETQYRRRLIITDGVFSMDGDIAPLPDIVELAEKHGCMTYVDDAHSSG
BIOF_THIDA      KLSGARFSRYRHGDLAQLESRLAASTARDRMIVSDLVFSMDGDVAPVDALLDLAERYDAWLYLDDAHXXX
BIKB_HAEPS      RLSGADFFRYKHNDYLHLEQLLQSERYQQVIIVTESVFSMDGDIADLQQLVALKKRYNVLLYVDEAHAIG
BIOF_ANASK      LLSRAELVRYRHCDVEEXXXXXXXXXXXXXXVVTDAIFSMDGDAAPLRELAELCDRHGAMLYVDEAHAAG
BIKB_COPPD      RLSRAKIIRYPHLNVQTLEELLKQERQNKAMIITDGVFSMDGDIAPMDKLADLADKYQCILYVDDAHGEG
BIOF_BORPD      RLSRARVQVYPHXXXXXXXXXXXXSRAQTRLIVSDGVFSMDGDIAPLRDLLALAERHGAWLVVDDAHGFG
BIKB_THEYD      RLSRAEKIIYKHADIEDLKKLIRNSCKGKKVIITDTVFSMDGDIAPIRELYELCKAEGALLYIDDAHGTG
BIKB_THEP3      RLSRADVVIYKHSDMEDLERVLKKDKYRVKMIITDGVFSMDGDIAKLPEIVKLAEKYSAITYVDDAHASG
BIKB_GLOVI      ELSGAVHRLYPHGDCSALESLLQRERHRRCLICTDSVFSMDGDLIDLARIADLARRYGCMLLVDEAHATG
BIKB_THEPX      RLSRADVVIYKHSDMEDLERVLKKDKYRVKMIITDGVFSMDGDIAKLPEIVKLAEKYSAITYVDDAHASG
BIKB_PARL1      KLSGARVAIFRHNDIAHLEELLGAHRGGAKLILTDGIFSMXXXXXXXXXXXXXXXXXXXXXMTDDAHGIG
BIKB_METJA      KLSKADVLIYNHCDVEHLTNLIEENWYNNLFIVTDGVFSMDGDIAPLRDLKKIADEFNAILIIDDAHGTG
BIKB_THET8      RLTKATRLVFRHADVAHLEELLKADTDGLKLIVTDGVFSMDGDIAPLDKIVPLAKKYKAVVYVDDAHGSG
BIOF_PELPD      LLSGARLVRYPHNDAVALAGLMEKQRTGRCLIVSDGVFSMDGXXXXXXXXXXXXXXXXXXXMVDDAHGCG
KBL_ECOLI       RLCKAKRYRYANNDMQXXXXXXXXXXXXXXLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVG
BIKB_SHIFL      RLCKAKRYRYANNDMQXXXXXXXXXXXXXXLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVG
BIKB_ECO57      RLCKAKRYRYANNDMQXXXXXXXXXXXXXXLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVG
BIKB_SALTY      RLCKAKRYRYANNDMXXXXXXXXXXXXXXXLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVG
BIOF_ANAD2      LLSRAELVRYRHCDVEEXXXXXXXXXXXXXXVVTDAIFSMDGDAAPLRELAELCDRHGAMLYVDEAHAAG
BIKB_THEM4      RLSKA--KRFVWKHXXXXXXXXXXXXXXXXXIITDGVFSMDGDLAPLPEIVELAEKYNAMVMVDDAHGEG
BIKB_GLUDA      QAAGVRQIRFAHNDLGHLEHLLAQRQAGLRFIVTESVFSMDGDRADVAGLRTLADRYGAFLYLDEAHATG
BIOF_POLNA      LLAKATLQRYAHKSLAVLARQLAACDTPIKLIVTDAVFSMDGDVADLPELLALAERFDAWLVVDDAHGFG
BIKB_OCEIH      RLSKAKIIRFEHSDRQKAKEAVESGQYNKIMVITDGVFSMDGDIAKLPEIVDIAEEFDLITYVDDAHGSG
BIOF_DESDA      RLARGRTVVYAHNDMDDLLEKIRQLRPRQGFIITDGVFSMDGDLARLPELAHIARSYGLTLMVDDAHATG
BIKB_ACAM1      RLSGATIHEFGHANVTELQTLLETHRSHHRLLVTDSVFSMDGDLCPLPELIALAEQYDCMLLIDEAHGTG
BIKB_HAEIE      RLSQCEFFRYRHNDYEHLKSLLEKNAFDRTFIVTESVFSMDGDVADLKQLVQLKKQSNTYLYVDEAHAVG
BIOF_ANADF      LLSRAKLVRYRHADVQELADLLAGTPARRKLVVTDAIFSMDGDAAPLREIAGLCDRHGAMLYVDEAHATG
BIKB_CHLP8      RIAEAEYRRYRHADYDHLEELLASAAYRQVFIVTESVFSMDGDLADLRRLVDLKKRYGAMLIVDEAHGVG
BIKB_THEAB      RLSKAKRYVWKHXXXXXXXXXXXXXXXXXXXIITDGVFSMDGDLAPLPEIVELAEKYNAMVMVDDAHGEG
BIKB_TREDE      RLSKADKAVFQHSDMADLERVLKEKNYNNVLIITDGVFSMDGDIAKLPEIVALAEKYNCLTYVDDAHSSG
BIKB_HAEIG      RLSQCEFFRYRHNDYEHLKNLLEKNVFDRTFIVTESVFSMDGDVADLKQLVQLKKQFNTYLYVDEAHAIG
BIKB_HAEI8      RLSQCEFFRYRHNDYEHLKNLLEKNVFDRTFIVTESVFSMDGDVADLKQLVQLKKQFNTYLYVDEAHAIG
BIKB_NEIMF      RLSRCAFSRYRHNDYEHLKNLLEKNVFDRTFIVTESVFSMDGDVADLKQLVQLKKQFNTYLYVDEAHAIG
BIKB_BEII9      QLSPATVRIFRHNDIAEVESLLATNRAHYRLLLTDGVFSMDGDLAPLPALAEICTHHDCWLMADDAHGLG
BIKB_META3      KLSKSAVLIYNHCDMDNLIDLIEKSSYNNLFIITDGVFSMDGDIAPLDKLKKIADEYNGILIIDDAHGTG
BIKB_MYCS2      RLSRARVVVSPHRXXXXXXXXXXXRTEERAVVVTESVFSADGDLAPLRDLHAVCRRHGALLLVDEAHGLG
BIKB_HAEIN      RLSQCEFFRYRHNDYEHLKNLLEKNVFDRTFIVTESVFSMDGDVADLKQLVQLKKQFNTYLYVDEAHAVG
KBL_MOUSE       RLCKAHKYRYRHLDMADLAKLKEAQKHRLRLVATDGAFSMDGDIAPLQDICRLAAQYGALVFVDECHATG
BIKB_NEIMA      RLSRCAFFRYRHNDYEHLKNLLEKNVFDRTFIVTESVFSMDGDVADLKQLVQLKKQFNTYLYVDEAHAIG
BIKB_NEIM0      RLSRCAFFRYRHNDYEHLKNLLEKNVFDRTFIVTESVFSMDGDVADLKQLVQLKKQFNTYLYVDEAHAIG
BIKB_FERNB      RLSKAKRYVYKHNDMNELEARLKEARDVQKLIITDGVFSMDGDIAPLPEIVELAEKYEAAVMVDDAHXXX
BIKB_NEIG2      RLSRCAFFRYRHNDYEHLKNLLEKNVFDRTFIVTESVFSMDGDVADLKQLVQLKKQFNTYLYVDEAHAIG
BIKB_ACICJ      RLSGAALHVFRHNDXXXXXXXXXXXXXXXXMVVTDGVFSMDGDLAPVGEMLALAKAHDAWLMTDDAHGIG
BIKB_SYNY3      QLSGAKVINYDHGCPEVLTDLLMKHRDNHRLILSDGVFSMDGDLCPLPQLVAIAEEFQSMLLVDDAHXXX
KBL_BOVIN       RLCKAHKYRYRHLDMADLEAKLQEAQKHRRLVATDGAFSMDGDIAPLQEICRLASQYGALVFVDESHATG
BIKB_NEIMB      RLSRCAFFRYRHNDYEHLKNLLEKNVFDRTFIVTESVFSMDGDVADLKQLVQLKKQFNTYLYVDEAHAIG
BIKB_MAGSM      QLAGVRQLRYRHGDLDHLERLLKRHAGEKKFILSETVFSMDGDRIDVGGLIALKQRYGAFLYLDEAHATG
KBL_HUMAN       RLCKAHKYRYRHLDMADLEAKLQEAQKHRRLVATDGAFSMDGDIAPLQEICCLASRYGALVFMDECHATG
BIKB_NEIG1      RLSRCAFFRYRHNDYEHLKNLLEKNVFDRTFIVTESVFSMDGDVADLKQLVQLKKQFNTYLYVDEAHAIG
BIKB_PETMO      RLSKAKRYIWKHKDLNSLEEQLQRDNCRRKLIITDGVFSMDGDIAPLPGIVELAKKYDALVMVDDAHGEG
BIKB_MAGSA      ELSGAXXXXXXXXXXXXXESLLKAHAEGPRFIVTETVFSMDGDVTDMXXXXXXXSRWDAFLYVDEAHATG
BIOF_MARMM      RLSGARVEVFPHNDMAALEAMLKTPVHRHAMILTDGVFSMDGDLAPLPDMMALAQTHDAWTLIDDAXXXX
BIKB_METVS      RLSRADKLIYRHSDVQNLIEILEKNKYYENIVVTDSVFSMDGDVSPIDKIAKIIDEYNAVLIIDDAHGTG
BIOF_DELAS      RLSRAHVHRYXXXXXXXXXXXXXXSTARRKLVISDAVFSMDGNVADIRGXXXXXXXXXXXXXXXXXHGFG
BIOF_ACIAC      RLSRATIHRYPHGDXXXXXXXXXXSPARRKLVVSDAVFSMDGDVADIRTLHALCERHXXXXXXXXXHGFG
BIOF_HALHL      RLAGGRPRRYRHADPTHLAQRLDDRA---QLVVTDGVFSMDGDXXXXXXXXXXXXXXXXXXXXDDAHGLG
BIKB_SYNP2      KLSGATVLEYDHNDLDALRQLLETHRQNYRLITTDSVFSMDGDLCLLPELLAIAKEFSTMLLVDEAHGTG
BIKB_METPB      RMSGALTLRFTHNDVAQLRALLQRGAARRALILTERVFSMDGDRAPLAEILALAGAYDAWTLVDDAHGLG
BIKB_MICAN      KLSGATVKEYRHNSLEDLENLAHRHHYRHCLLLTDTVFSMDGDICPLAGILALAEIYNCMVLVDEAHATG
BIKB1_BACAN     RLSKAKIIVYKHSDMEDLRQAKESGLYNKLMVITDGVFSMDGDVAKLPEIVEIAEELDLMTYVDDAHGSG
BIKB_CYAP8      KLSSATVLEYDHCNSEDLQEKLQQHQYRRCLIITDSIFSMDGNACPLQKLLSLAADFDCMLLVDEAHATG
BIKB1_BACCR     RLSKAKIIVYKHSDMEDLRQAKESGLYNKLMVITDGVFSMDGDVAKLPEIVEIAEELDLMTYVDDAHGSG
BIKB_METC4      AMSRAQTVRFAHNDVAQLRALLHRGTARRALILTERVFSMDGDRAPLPEILALAGEYDAWTLVDDAHGLG
BIKB_METRJ      RLSGAQVMTFRHNDPGDLAARLAEPHHGRALVLTERVFSMDGDRAPLGDILGIAESYDAWTLVDDAHGIG
BIKB_CAUSK      QLSGARIIPFAHNDTDHLAALLAESSARHAIVATDGVFSMDGDIAPLDWLSAVCEANDAWLLSDDAHGVG
BIKB_BORPA      QAAGVRQIRFRHNDXXXXXXXXRAGAPGARFIVTESVFSMDGDRADVPXXXXXXXRHHTFLYLDEAHATG
BIKB_STAAW      RLSKAKIIRVNHSDMDDLKEAVESGQYNKVMYITDGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSG
BIKB_STAAS      RLSKAKIIRVNHSDMDDLKEAVESGQYNKVMYITDGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSG
BIKB_STAAN      RLSKAKIIRVNHSDMDDLKEAVESGQYNKVMYITDGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSG
BIKB_STAAM      RLSKAKIIRVNHSDMDDLKEAVESGQYNKVMYITDGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSG
BIKB_STAAC      RLSKAKIIRVNHSDMDDLKEAVESGQYNKVMYITDGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSG
HEM1_RHIRD      RYGRCERVIWKHNDLEDLAKLKAADPNAPKLIAFESVYSMDGDIAPIKEICDLADRYGAMTYLDEVHAVG
BIKB_METEP      AMSRAQTVRFAHNDVAQLRTLLHRGTARRALILTERVFSMDGDRAPLPEILALAGEYDAWTLVDDAHGLG
BIKB_STAAR      RLSKAKIIRVNHSDMDDLKEAVESGQYNKVMYITDGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSG
BIKB_AQUAE      RLSKAQKRVFKHKDYEELEEFLKKKKFRRVLIITDTVFSMDGDVADLKRLTQICEEYDCMLYIDEAH---
HEM0_OPSTA      RNSGAKRFIFRHNDSRHLEELLQSDPKTPKIVAFETVHSMDGAICPLEELCDVAHRHGALTFVDEVHAVG
BIKB_METSB      QLSPAKTMVFRHNDVAHAEAILAASRAQYRLLLTDGVFSMDGDRAPLATLSALCAAHDAWLMSDDXXXXX
BIOF_ANADE      LLSRAELVRYRHCDVEEXXXXXXXXXXXXXXVVTDAIFSMDGDAAPLRELADLCDRHGAMLYVDEXXXXX
BIKB_THEEB      RLSHATFYEYPHNNVAALAQLLETSQYRRCLILTDGVFSMDGDVAPLAKILALAEAYTAMVLVDDAHXXX
BIKB_CAUCR      QLSGAKVVKFAHNDPXXXXXXXXXXXXXXXXVATDGVFSMDGDIAPLDALSELCQRHDAWLLSDDAHGVG
BIKB_CAUCN      QLSGAKVVKFAHNDPXXXXXXXXXXXXXXXXVATDGVFSMDGDIAPLDALSELCQRHDAWLLSDDAHGVG
BIKB_ANASP      ILSGATVREYSHCQVGELKTQLQRQNYRRCLILTDSVFSMXXXXXXXXXXXXXAEEFSCMLLVDEAHATG
HEM1_RHOS4      RRSGTEKHIFKHNDLDDLRRILTS--IGKDLVAFESVYSMDGDFGRIEEICDIADEFGALKYIDEVHAVG
BIKB_MYCPA      RLSRARVVVTPHRDVDAVRAALQDRDEERAVVITESVFSTDGALAPLRELHEVCRRHRALLIVDEAHXXX
BIKB_ANAVT      ILSGATVREYSHCEVGELKTQLQRQNYRRCLILTDSVFSMDGXXXXXXXXXXXXEQFSCMLLVDEAHATG
HEM1_RHOCA      KRNAGPKRIFRHNDVAHLRELIAADDAAPKLIAFESVYSMDGDFGPIKEICDIADEFGALTYIDEVHAVG
HEM1_RICBR      TGSKAEKHIYRHLDVKHLEELLQSVDINRKIIVFESAYSMDGFFSPVKDIINLAKKYNALTFIDEVHTVG
BIKB_MYCLE      RLSRARVVVTPHCDVDAVDTALRSCHEERAVVVTESVFSADGVLAPVSELHDVCRRHGALLLVDEAHXXX
BIKB_MYCLB      RLSRARVVVTPHCDVDAVDTALRSCHEERAVVVTESVFSADGVLAPVSELHDVCRRHGALLLVDEAHXXX
BIKB_CYAP4      SLSGAKVLDYPHLDMGGLAELLQTHRSNYRLILTDTVFSMEGDVCPLPQLLAITTAHNAMVLVDEAHXXX
HEM1_PARDP      KRFDGAKRIFRHNDVAHLRELLAADDPAPKLIAFESIYSMDGDFGPIKAICDLADEFNALTYLDEVHAVG
HEM0_RHOS4      RRSGAERFIFHHNDPVHLDRLLSSVDPARKIVAFESVYSMDGDIAPIAEICDVAERHGALTYLDEVHAVG
BIKB_GRABC      XXXXXRTIRFPHNDMQALAGLLEQPQHDHVLIVTDGVFSMDGDLAPMSALVELSARYNAWLMTDDAHGIG
BIKB_CYAP7      KLSGATVLDYEHGNLEDLNTKLVNRSYRRCLILTDTVFSMDGDICPLPQLLDLAEDFNCMVLVDEAHATG
HEM1_RHIME      RHSKCERVIFKHNSVADLAKLAAADPRAPKIIAFESVYSMDGDIAPIREFCDLADKYGAMTYLDEVHAVG
HEM1_BRAJA      RQSGCERQVFRHNDXXXXXXXXXXXXXNRKLIACESLYSMDGDVAPLAKICDLAEKYNAMTYVDEVHAVG
LCB2_SCHPO      RLSGANIRVYKHNDMTDLERVLREVISQGQLVVIEGLYSMEGNFCDLPKVVELKNRYKFYLFIDEAHSIG
HEM0_DANRE      RNSGAKRFIFRHNDASHLEELLRSDPLTPKIVAFETVHSMDGAICPLEELCDVAHKYGALTFVDEVHAVG
HEM0_PONAB      RNSGAAKFVFRHNDPDHLKKLLENPKI-PKIVAFEAVHSMDGAICPLEELCDVSHQYGALTFVDEVHAVG
BIKB_BORPE      QAAGVRQIRFRHNDXXXXXXXXRAGAPGARFIVTESVFSMDGXXXXXXXXXXXXXXXXXFLYLDEAHATG
HEM0_DELLE      RNSGAAKFVFRHNDPDHLKKLLKSNPETPKIVAFETVHSMDGAICPLEELCDVAHQYGALTFVDEVHAVG
HEM1_RICCN      TSSRAEKYIYRHLDVKHLEELLQSVDINRKIVVFESAYSMDGFFSPIKDIINLAKKYNALTFIDEVHTVG
BIKB_BORBR      QAAGVRQIRFRHNDXXXXXXXXRAGAPGARFIVTESVFSMDGXXXXXXXXXXXXXXXXXFLYLDEAHATG
HEM1_RICFE      TSSRAEKYIYRHLDVKHLEELLQSVDINRKIIVFESAYSMDGFFSPIKDIINLAKKYNALTFIDEVHTVG
HEM0_BOVIN      RNSGAAKFVFRHNDPDHLKKLLKSNPETPKIVAFETVHSMDGAICPLEELCDVAHQYGALTFVDEVHAVG
HEM0_HUMAN      RNSGAAKFVFRHNDPDHLKKLLENPKI-PKIVAFETVHSMDGAICPLEELCDVSHQYGALTFVDEVHAVG
BIOF_RALSO      RLSRAAVKVYPHVDLAALEAQLAACGSRNKLIVTDGVFSMDGDIXXXXXXXXXXXRFDAWLIVXXXXXXX
BIKB_TRIEI      ILSGAKIIEYSHNNIEYLKNKLEQKRENRSLIITDSVFSMXXXXXXXXXXXXXAEKYNSMLLVDEAHATG
BIKB_MYCGI      RLSRARVVVTPHNDVAAVARALATRDEERAVVVTDSVFSADGDLAPLRELHDACRRHGALMIVDEAHXXX
BIKB_NOSP7      ILSGAAVVEYPHCDVAVLKTQLQRQNYRRCLILTDTVFSMDGDLCPLPALFDLADEFSCMLLVDEAHATG
BIKB_MYCVP      RLSRARVVVTPHNDTAAVEQALATRSEARAVVVTDSVFSADGDLAPLRALHTACRKHGALLIVDEAHXXX
HEM0_RAT        RNSGAVKFVFRHNDPGHLKKLLESDPKTPKIVAFETVHSMDGAICPLEELCDVAHQYGALTFVDEVHAVG
HEM0_MOUSE      RNSGAAKFVFRHNDPGHLKKLLESDPKTPKIVAFETVHSMDGAICPLEELCDVAHQYGALTFVDEVHAVG
BIKB_METNO      RLSGARTLPFRHNDLKHLEALLERGEARHALILTERVFSMDGDRAPVADILDLARSFDAWTLVDDAHGLG
BIKB_MYCSJ      RLSRARVVVTPHRDVTAIETALATRDEQRAVVVTDSVFSADGVLAPLRDIHDVCRRHGALLIVDEAHXXX
SPTC3_HUMAN     RLSGATIRIFKHNNTQSLEKLLRDAVIYGQLILVEGVYSMEGSIVHLPQXXXXXXXXXXXXXXDEAHSIG
SPTC2_DICDI     KNTGCKVKVFRHNDSKHLEEVIRESIIQGQLIIIEGIYSMEGEVANLPEILAIKKKYKCYLYIDEAHSIG
BIKB_MYCSS      RLSRARVVVTPHRDVTAIETALATRDEQRAIVVTDSVFSADGVLAPLRDMHDVCRRHGALLIVDEAHXXX
BIKB_MYCSK      RLSRARVVVTPHRDVTAIETALATRDEQRAIVVTDSVFSADGVLAPLRDMHDVCRRHGALLIVDEAHXXX
BIKB_MYCA1      RLSRARVVVTPHXXXXXXXXXXXXXXEERAVVITESVFSTDGALAPLRELHEVCRRHRALLIVDEAHXXX
BIKB_MYCTU      RLSRARVVVTPHRDVDAVDAALRSRDEQRAVVVTDSVFSADGSLAPVRELLEVCRRHGALLLVDEAHXXX
BIKB_MYCTF      RLSRARVVVTPHRDVDAVDAALRSRDEQRAVVVTDSVFSADGSLAPVRELLEVCRRHGALLLVDEAHXXX
BIKB_MYCTA      RLSRARVVVTPHRDVDAVDAALRSRDEQRAVVVTDSVFSADGSLAPVRELLEVCRRHGALLLVDEAHXXX
BIKB_MYCBP      RLSRARVVVTPHRDVDAVDAALRSRDEQRAVVVTDSVFSADGSLAPVRELLEVCRRHGALLLVDEAHXXX
BIKB_MYCBO      RLSRARVVVTPHRDVDAVDAALRSRDEQRAVVVTDSVFSADGSLAPVRELLEVCRRHGALLLVDEAHXXX
HEM1_RAT        RNSRVPKYIFRHNDVNHLRELLQDPSV-PKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHAVG
HEM1_RICPR      KSSRAEKYVYRHLDVQHLEKLLQSVDINKKIIVFESAYSMDGFFSPIKDIINLAKKYNALTFIDEVHTVG
SPTC2_HUMAN     RLSGATIRIFKHNNMQSLEKLLKDAIVYGQLILVEGIYSMEGSIVRLPEVIXXXXXXXXXXXXDEAHSIG
SPTC2_CRIGR     RLSGATIRIFKHNNMQSLEKLLKDAIVYGQLILVEGIYSMEGSIVRLPEVIXXXXXXXXXXXXDEAHSIG
SPTC2_MOUSE     RLSGATIRIFKHNNMQSLEKLLKDAIVYGQLILVEGIYSMEGSIVRLPEVIXXXXXXXXXXXXDEAHSIG
LCB2_YEAST      RLSGAAVRTFKHGDMVGLEKLIREQIVLGQLICAEGLFSMEGTLCNLPKLVELKKKYKCYLFIDEAHSIG
HEM1_RICTY      TSSRAEKYVYRHLDVQHLEKLLQSVDINKKIIVFESAYSMDGFFSPIKDIINLAKKYNALTFIDEVHTVG
HEM1_BOVIN      RNSGVPKYIFRHNDVSHLRELLQDPAV-PKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHAVX
BIKB_METS4      RLAGARALPFRHNDLGHXXXXXXXXXXXXXXXXXXXVFSMDGDRAPVAEILGLARAFDAWTLVDDAHGLG
HEM1_SCHPO      RNSRCEKIIFKHNDLVDLEAKLASPLNRPKIIAFESVYSMSGNVAPISEICDLAKKYGAITFLDEVHAVG
HEM1_OPSTA      RNSGAKKFIFRHNDVAHLRELLEKDPTKPKIVAFETVHSMDGAVCPLEEMCDLAHEFGAITFVDEVHAVG
HEM1_DELLE      WNSRVPKYIYRHNDVDHLRELLQDPAV-PKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHAVG
HEM1_PONAB      RNSRVPKYIFRHNDVSHLRELLQDPSV-PKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHXXX
HEM1_HUMAN      RNSRVPKYIFRHNDVSHLRELLQDPSV-PKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHXXX
HEM1_MOUSE      RNSRVPKYIFRHNDVNHLRELLQDPSV-PKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHXXX
LCB2_KLULA      RLSGAAVKTFKHNDMRALEKLIREQIVQGQIICVEGLYSMEGTMANLPKLVELKKKYKCYLFVDEAHSIG
CQSA_VIBCH      RYANAQAHPFMHNNCDHLRMLIQRH--GPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLG
HEM1_CANAL      RNSRARKHIFKHNNLADLSKLAQYPKSTPKLIAFESVYSMCGSIAPIEAICDLAEKYGALTFLDEVHAVG
BIKB_PHEZH      RLSGAQVISFRHNDVDDLTGKLXXXXXXXXXXXTDGVFSMDGDIAPLDDISRTAQAWDAWXXXXXXXXXX
HEM1_CHICK      RNSRVPKHIFRHNDVNHLRELLKSDPSTPKIVAFETVHSMDGAVCPLEELCDVAHEHGAITFVDEVHXXX
HEM0_CHICK      RRRGVPKFIFRHNDPHHLEQLLRSPPGVPKIVAFESLHSMDGSIAPLEELCDVAHAYGALTFVDEVHAVG
HEM1_ASHGO      KHANVQKHIFRHNDLQHLEELLAMPKSQPKLIAFESVYSMSGSVADIRKICDLAEKYGALTFLDEVHSVG
HEM1_CANGA      KHANRPKHIFRHNDLAQLEEMLQMPKSTPKLIAFESVYSMAGSVADINKICDLAEKYGALTFLDEVHAVG
HEM1_EMENI      RHSGAKKMVFKHNDLVDLETKLASPLHVPKIIAFESVYSMCGSIAPIEAICDLADKYGAITFLDEVHAVG
HEM1_YEAST      KHANVKKHIFKHNDLNELEQLLQSPKSVPKLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVG
CQSA_VIBHB      RAAGAQAHPFMHNNMNHLRKQIQRN--GSGVIVVDSVYSTIGTIAPLRDIYEMAREFDCALVVDESHSLG
HEM1_NEUCR      RHSGAKKIIFKHNDVEDLEKKLAAPLHIPKIIAFESVYSMCGSIGPIEKFCDLAEKYGAITFNDEVHAVG
BIKB_HELPY      KIKPNQVIFFSHNDIKDLQKLFNAPKNKIKFIAIEGVYSMDASVAPYDFYAIIQEIPNAFLIVDEAHSFG
HEM1_KLULA      KHASTKKHIFKHNNLDQLEELLAMPKSTPKLIAFESVYSMSGSVADIDKICDLAEKYGALTFLDEVHAVG
SPTC3_MOUSE     RLSGAVIRPFKHNNAENLEKLLREAIIRGQLIVVEGVYSMEGSIVNLAQIVXXXXXXXXXXXIDEAHSIG
HEM1_AGABI      RHSTPKRVIFKHNDLEDLTKLQQYPKETPKIIAFESVYSMCGSIGPVKEICDLAEQYGAITFLDEVHAVG
BIKB_MYCUA      RLSRARVVVTPHRDVAAVDAALASRDEQRAMVITDSVFSADGTLAPXXXXXXXXXXXXXXXVIDXXXXXX
BIKB_MYCMM      RLSRARVVVTPHRDVAAVDAALASRDEQRAMVITDSVFSADGTLAPXXXXXXXXXXXXXXXVIDXXXXXX
HEM1_DEBHA      RNSRAKKQVFKHNDLADLEKLAQYPKSTPKLIAFESVYSMCGSIAPIEAICDLAEKYGALTFLDEVHAVG
HEM1_YARLI      RHGGSEKVVWKHNDLADLAKLARYPKSTPKVIAFESVYSMCGSIGPIEEICDLADKYGAITFLDEVHAVG
SPTC1_PONAB     QASRSDIKLFKHNDMADLERLLKEQEIEDQFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFG
SPTC1_MACFA     QASRSDIKLFKHNDMADLERLLKEQEIEDQFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFG
SPTC1_HUMAN     QASRSDIKLFKHNDMADLERLLKEQEIEDQFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFG
BIKB_HELPJ      KIKPNQVIFFSHNDIKDLQKLFNAPKNKLKFIAIEGVYSMDASIAPYDFYEIIQETPNAFLIVDEAHSFG
SPTC1_MOUSE     QASRSDIKLFKHNDVADLERLLKEQEIEDQFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFG
SPTC1_CRIGR     QASRSDIKLFKHNDVADLERLLKEQEIEDQFIVVEGLYMNTGTVCPLPELVKLKYKYKARIFLEESLSFG
SPTC1_DICDI     SLSRSRIYYFNHNDMDDLQRVLEQTQIVRKFVVIEGLYYNSGTIAPLPQILKFKEQYKFRLIMDESHSVG
LCB1_YEAST      QLSRSTVYYFNHNDMNSLECLLNEPAIPRKFIVTEGIFHNSGDLAPLPELTKLKNKYKFRLFVDETFSIG
SPTC1_BOVIN     QASRSDIKVFNHNDMDDLERLLKEQEIEDQFIIVEGLYMNTGTVCPLPELVKLKYKYKARIFLEESLSFG
LCB1_SCHPO      QISRTTIRYFKHNNMKDLERILQNRPLTRRFIITEGISENYGDMVDLTKIVALKKKYKYRLILDETWSFG
CSD_CHLTR       QRSGATIKKVRVDDESHLEQLLKQ---GVQLVSLAHVSNVSGAVLPLPEIAHLVHRYEALFAVDGAQGVG
ASTC_ECOUT      SAGPPDIRHAAYNDINSASALIDDATCA---VIVEPIQGEGGSNAFLQGLRELCDRHNALLIFDEVQGVG
ASTC_ECOL6      SAGPPDIRHAAYNDINSASALIDDATCA---VIVEPIQGEGGSNAFLQGLRELCDRHNALLIFDEVQGVG
ASTC_ECOL5      SAGPPDIRHAAYNDINSASALIDDATCA---VIVEPIQGEGGSNAFLQGLRELCDRHNALLIFDEVQGVG
ASTC_ECOK1      SAGPPDIRHAAYNDINSASALIDDATCA---VIVEPIQGEGGSNAFLQGLRELCDRHNALLIFDEVQGVG
ASTC_ECO81      SAGPPDIRHAAYNDINSASALIDDATCA---VIVEPIQGEGGSNAFLQGLRELCDRHNALLIFDEVQGVG
ASTC_ECO45      SAGPPDIRHAAYNDINSASALIDDATCA---VIVEPIQGEGGSNAFLQGLRELCDRHNALLIFDEVQGVG
CSD_CHLMU       RRSGATVKKVRVNDESHLEKLLKQ---GVQLVSLAHVSNVSGAVLPVQEVAFLVHRYGALLAIDGAQGVG
SPSS_METKA      EKAGATVREV--PNTGHPEYKVK---VDEYARVIDEVEDERGDPPALALLTH----------VDSEYGNL
YAAO_BACSU      DLSGAEMHVPTHVPLGTIKEALEAYPDAKGLVLTNPTYY--GHSADLTEIITEAHHYGIPVLVDEAHG--
ARGD_XYLFA      -------------------------------------------SGYLAQVRALCDRYGALLVLDEIQGMG
ARGD_XYLFT      ----------------------------------------------LAQVRALCDRYGALLVLDEIQGMG


                         .         .         .         +         .         .         .:280
query           VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
BIOF_SALHS      VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
BIOF_SALTY      VTGDEGRGTCWLRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
BIOF_SALTI      VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
BIOF_SALG2      VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
BIOF_SALEP      VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
BIOF_SALSV      VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
BIOF_SALCH      VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
BIOF_SALPK      VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
BIOF_SALPA      VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
BIOF_SALDC      VTGDEGRGTCWQRGGKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
BIOF_SALA4      VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
BIOF_SALPB      VTGDEGRGTCWLRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
BIOF_SALNS      VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXX