[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF68197.1

[Show Plain Result]


## Summary of Sequence Search
    1::179
    1::178     9e-70  68%  179 aa  RIML_ECOLI RecName: Full=Ribosomal-protein-serine
    6::173     2e-14  27%  183 aa  YDAF_BACSU RecName: Full=Putative ribosomal N-acetyltransferase
   70::179     1e-07  29%  194 aa  RIMJ_SHIFL RecName: Full=Ribosomal-protein-alanine
   70::179     1e-07  29%  194 aa  RIMJ_ECOLI RecName: Full=Ribosomal-protein-alanine
   70::179     1e-07  29%  194 aa  RIMJ_ECO57 RecName: Full=Ribosomal-protein-alanine
   75::171     2e-07  27%  177 aa  YOAA_BACSU RecName: Full=Uncharacterized N-acetyltransferase yoaA; 
   41::170     3e-07  27%  178 aa  YP20_BACLI RecName: Full=Uncharacterized N-acetyltransferase p20;  
   75::173     2e-05  26%  181 aa  YJCK_BACSU RecName: Full=Putative ribosomal-protein-alanine
    1::158     3e-05  20%  186 aa  ATDA_ECOLI RecName: Full=Spermidine N(1)-acetyltransferase;        
    1::158     3e-05  20%  186 aa  ATDA_ECO57 RecName: Full=Spermidine N(1)-acetyltransferase;        
    1::179

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNMLLHQRGYAKMY
RIML_ECOLI      MTETIKVSESLELHAVAENHVKPLYQLICKNKTWLQQSLNWPQFVQSEEDTRKTVQGNVMLHQRGYAKMF
YDAF_BACSU      ------VNEHITIRLLEPKDAERLAELIIQNQQRLGKWLFFAENPSSADTYRETIIPDW---RRQYADLN
RIMJ_SHIFL      -------------------------------------------------------------HKQGSAFYF
RIMJ_ECOLI      -------------------------------------------------------------HKQGSAFYF
RIMJ_ECO57      -------------------------------------------------------------HKQGSAFYF
YOAA_BACSU      ----------------------------------------------------------------------
YP20_BACLI      ---------------------------------------------TDVSQARDMIQMINDLSLEGQANRF
YJCK_BACSU      ----------------------------------------------------------------------
ATDA_ECOLI      ----MPSAHSVKLRPLEREDLRYVHQL--DNNAWFEEPYE--AFVELSDLYDKHIHDQS-------ERRF
ATDA_ECO57      ----MPSAHSVKLRPLEREDLRYVHQL--DNNAWFEEPYE--AFVELSDLYDKHIHDQS-------ERRF


                         .         .         *         .         .         .         .:140
query           LIFCQNEMAGVLSFNAIEPVNKAAYIGYWLDESLQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQA
RIML_ECOLI      MIFKEDELIGVISFNRIEPLNKTAEIGYWLDESHQGQGIISQALQALIHHYAQSGELRRFVIKCRVDNPQ
YDAF_BACSU      GILYDGSLCGMISLHNLDQVNRKAEIGYWIAKEFEGKGIITAACRKLITYAFEELELNRVAICAAVGNEK
RIMJ_SHIFL      GLFDEKEIIGVANFNVVRGSFHACYLGYSIGQKWQGKGLMFEALTAAIRYMQRTQHIHRIMANYMPHNKR
RIMJ_ECOLI      GLFDEKEIIGVANFNVVRGSFHACYLGYSIGQKWQGKGLMFEALTAAIRYMQRTQHIHRIMANYMPHNKR
RIMJ_ECO57      GLFDEKEIIGVANFNVVRGSFHACYLGYSIGQKWQGKGLMFEALTAAIRYMQRTQHIHRIMANYMPHNKR
YOAA_BACSU      ------ELIGTIGFHALAQKHRRAEIGYEIIPEHWRNGFASEVISKVVSYGFSALGLSRIGAVVFTDNEA
YP20_BACLI      SIIVKDEVIGTCGFNMIDQENGRAEIGYDLGRNHWGKGFASEAVQKLIDYGFTSLNLNRIEAKVEPENTP
YJCK_BACSU      -----DRLIGTVSFQIIRGALQTAFIGYFLDKAHNGKGIMTEAVRLVVDYAFHELKLHRIEAGVMPRNLG
ATDA_ECOLI      VVECDGEKAGLVELVEINHVHRRAEFQIIISPEYQGKGLATRAAKLAMDYGFTVLNLYKLYLIVDKENEK
ATDA_ECO57      VVECDGEKAGLVELVEINHVHRRAEFQIIISPEYQGKGLATRAAKLAMDYGFTVLNLYKLYLIVDKENEK


                         +         .         .         .         .         *         .:210
query           SNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDAx
RIML_ECOLI      SNQVALRNGFILEGCLKQAEFLNDAYDDVNLYARIIDS-
YDAF_BACSU      SRAVPERIGFLEEGKARDGLYVNGMHHDLVYYS------
RIMJ_SHIFL      SGDLLARLGFEKEGYAKDYLLIDGQWRD-----------
RIMJ_ECOLI      SGDLLARLGFEKEGYAKDYLLIDGQWRD-----------
RIMJ_ECO57      SGDLLARLGFEKEGYAKDYLLIDGQWRD-----------
YOAA_BACSU      SNRLLLKMGFQKEGVLRQYMYQNGTPYDTNVYS------
YP20_BACLI      SIKLLNSLSFQKEGLLRDYEKAKGRLIDVYMFS------
YJCK_BACSU      SMRVLEKAGFHKEGIARKNVKINGVWEDHQVLA------
ATDA_ECOLI      AIHIYRKLGFSVEGELMHEFFINGQYRN-----------
ATDA_ECO57      AIHIYRKLGFSVEGELMHEFFINGQYRN-----------