[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF68332.1

[Show Plain Result]


## Summary of Sequence Search
    1::429
    1::429       0.0  87%  429 aa  YFAV_ECOLI RecName: Full=Inner membrane transport protein yfaV;
    1::421     7e-71  40%  433 aa  TUB4_AGRVI RecName: Full=Putative tartrate transporter;
   26::399     4e-68  43%  449 aa  TUB3_AGRVI RecName: Full=Putative tartrate transporter;
   21::326     7e-41  34%  451 aa  PHT1_PSEPU RecName: Full=Phthalate transporter;
   36::337     2e-28  26%  482 aa  YHDC_SCHPO RecName: Full=Uncharacterized transporter C1683.12;
   82::293     5e-24  29%  542 aa  YIQ6_YEAST RecName: Full=Uncharacterized transporter YIL166C;
   59::334     2e-23  27%  499 aa  YIZG_SCHPO RecName: Full=Uncharacterized transporter C1002.16c;
   74::286     2e-22  28%  523 aa  THI73_YEAST RecName: Full=Thiamine pathway transporter THI73;
   84::378     5e-21  26%  534 aa  TNA1_YEAST RecName: Full=High-affinity nicotinic acid
   84::406     1e-20  29%  568 aa  VHT1_SCHPO RecName: Full=Vitamin H transporter 1;AltName:
   77::277     1e-19  28%  522 aa  YJ7D_SCHPO RecName: Full=Uncharacterized transporter C757.13;
   57::271     3e-19  27%  508 aa  YC7A_SCHPO RecName: Full=Uncharacterized transporter C417.10;
  191::463     5e-19  28%  628 aa  YE1F_SCHPO RecName: Full=Uncharacterized transporter C1B3.15C;
    4::268     5e-19  26%  422 aa  EXUT_BACSU RecName: Full=Hexuronate transporter;
   63::349     5e-18  25%  498 aa  YAOI_SCHPO RecName: Full=Uncharacterized transporter C11D3.18C;
   75::340     3e-17  25%  507 aa  YFZ4_SCHPO RecName: Full=Uncharacterized transporter C1039.04;
   13::306     3e-17  28%  455 aa  GUDP_BACSU RecName: Full=Probable glucarate transporter;AltName:
   32::269     4e-16  24%  514 aa  LIZ1_SCHPO RecName: Full=Pantothenate transporter liz1;
   27::309     3e-15  23%  453 aa  YJJL_ECOLI RecName: Full=Inner membrane transport protein yjjL;
    9::295     4e-15  24%  430 aa  DGOT_ECOLI RecName: Full=D-galactonate transporter;
    9::295     4e-15  24%  430 aa  DGOT_ECOL6 RecName: Full=D-galactonate transporter;
  165::344     3e-14  25%  495 aa  S17A5_MOUSE RecName: Full=Sialin;AltName: Full=Solute carrier
   52::348     6e-14  21%  497 aa  YGDF_SCHPO RecName: Full=Uncharacterized transporter C1773.15;
   11::318     8e-14  26%  450 aa  GUDP_ECOLI RecName: Full=Probable glucarate transporter;AltName:
    2::234     8e-13  22%  389 aa  YO162_YEAST RecName: Full=Putative uncharacterized transporter
  113::300     8e-13  24%  495 aa  S17A5_HUMAN RecName: Full=Sialin;AltName: Full=Solute carrier
  131::393     1e-12  25%  570 aa  YQD3_SCHPO RecName: Full=Uncharacterized transporter PB1C11.03;
  139::404     1e-12  22%  535 aa  PHT42_ORYSJ RecName: Full=Probable anion transporter 2,
  119::397     2e-12  26%  529 aa  PHT41_ORYSJ RecName: Full=Probable anion transporter 1,
   25::243     2e-12  27%  512 aa  FEN2_YEAST RecName: Full=Pantothenate transporter FEN2;AltName:
   85::350     7e-12  22%  543 aa  DAL5_YEAST RecName: Full=Allantoate permease;
   98::388     2e-11  24%  512 aa  ANTR3_ARATH RecName: Full=Probable anion transporter 3,
   90::322     1e-10  25%  493 aa  YLD2_CAEEL RecName: Full=Uncharacterized transporter C38C10.2;
  105::380     2e-10  24%  512 aa  ANTR1_ARATH RecName: Full=Sodium-dependent phosphate transport
    2::196     3e-10  27%  444 aa  GARP_ECOLI RecName: Full=Probable galactarate transporter;AltName:
    2::196     3e-10  27%  444 aa  GARP_ECO57 RecName: Full=Probable galactarate transporter;AltName:
  147::366     5e-10  20%  593 aa  SEO1_YEAST RecName: Full=Probable transporter SEO1;
  157::385     7e-10  28%  519 aa  PHT43_ORYSJ RecName: Full=Probable anion transporter 3,
  158::340     9e-10  24%  593 aa  VHT1_YEAST RecName: Full=Vitamin H transporter;AltName:
  118::373     2e-09  21%  552 aa  YHJ1_SCHPO RecName: Full=Uncharacterized transporter PB10D8.01;
  115::267     2e-09  26%  529 aa  PICO_DROME RecName: Full=Putative inorganic phosphate
  108::335     2e-09  24%  479 aa  NPT3_BOVIN RecName: Full=Sodium-dependent phosphate transport
   69::222     4e-09  27%  483 aa  PICO_DROAN RecName: Full=Putative inorganic phosphate
  164::280     7e-09  26%  535 aa  YKH4_CAEEL RecName: Full=Uncharacterized transporter C02C2.4;
   35::408     1e-08  24%  435 aa  YYBO_BACSU RecName: Full=Uncharacterized transporter yybO;
  113::263     1e-08  28%  495 aa  S17A5_SHEEP RecName: Full=Sialin;AltName: Full=Solute carrier
    5::147     1e-08  28%  456 aa  GUDP_PSEPU RecName: Full=Probable glucarate transporter;AltName:
   25::261     2e-08  22%  439 aa  PHT47_ORYSJ RecName: Full=Probable anion transporter 7;AltName:
   92::316     3e-08  24%  494 aa  SPX2_DANRE RecName: Full=Sugar phosphate exchanger 2;AltName:
   39::308     5e-08  22%  439 aa  UHPC_ECOLI RecName: Full=Regulatory protein uhpC;
  126::343     6e-08  20%  497 aa  S17A4_HUMAN RecName: Full=Putative small intestine sodium-dependent
   66::274     8e-08  20%  472 aa  EXUT_ECOLI RecName: Full=Hexuronate transporter;
   66::274     8e-08  20%  472 aa  EXUT_ECO57 RecName: Full=Hexuronate transporter;
  227::409     8e-08  29%  541 aa  ANTR2_ARATH RecName: Full=Probable anion transporter 2,
  127::284     1e-07  28%  589 aa  VGLU3_HUMAN RecName: Full=Vesicular glutamate transporter 3;       
  114::283     1e-07  29%  560 aa  VGLU1_RAT RecName: Full=Vesicular glutamate transporter 1;       
  114::283     1e-07  29%  560 aa  VGLU1_MOUSE RecName: Full=Vesicular glutamate transporter 1;       
  114::283     1e-07  29%  560 aa  VGLU1_HUMAN RecName: Full=Vesicular glutamate transporter 1;       
  114::283     1e-07  29%  560 aa  VGLU1_BOVIN RecName: Full=Vesicular glutamate transporter 1;       
   58::292     2e-07  22%  544 aa  YRT3_CAEEL RecName: Full=Potential vesicular glutamate transporter
   59::289     2e-07  22%  531 aa  YL055_YEAST RecName: Full=Uncharacterized transporter YLL055W;
  127::266     2e-07  28%  588 aa  VGLU3_RAT RecName: Full=Vesicular glutamate transporter 3;       
   22::326     2e-07  22%  455 aa  UHPT_CHLPN RecName: Full=Probable hexose phosphate transport
  107::334     2e-07  23%  439 aa  NPT3_HUMAN RecName: Full=Sodium-dependent phosphate transport
  121::271     3e-07  28%  576 aa  VGLU1_XENLA RecName: Full=Vesicular glutamate transporter 1;       
   62::193     3e-07  29%  514 aa  QACA_STAAU RecName: Full=Antiseptic resistance protein;
   62::193     3e-07  29%  514 aa  QACA_STAAM RecName: Full=Antiseptic resistance protein;
  140::279     4e-07  28%  601 aa  VGLU3_MOUSE RecName: Full=Vesicular glutamate transporter 3;       
  127::285     4e-07  25%  590 aa  VGLU3_DANRE RecName: Full=Vesicular glutamate transporter 3;       
  136::224     4e-07  28%  491 aa  SPX2_BOVIN RecName: Full=Sugar phosphate exchanger 2;AltName:
   49::245     4e-07  25%  526 aa  SPNS1_XENTR RecName: Full=Protein spinster homolog 1;
  148::322     4e-07  24%  478 aa  NPT3_MOUSE RecName: Full=Sodium-dependent phosphate transport
  159::334     5e-07  21%  492 aa  S17A4_MOUSE RecName: Full=Putative small intestine sodium-dependent
  146::234     9e-07  26%  501 aa  SPX2_MOUSE RecName: Full=Sugar phosphate exchanger 2;AltName:
   81::299     2e-06  29%  492 aa  SVOPL_HUMAN RecName: Full=Putative transporter SVOPL;AltName:
   22::254     2e-06  21%  432 aa  ANTR5_ARATH RecName: Full=Probable anion transporter 5;AltName:
  121::253     2e-06  29%  576 aa  VGLU1_XENTR RecName: Full=Vesicular glutamate transporter 1;       
  122::279     3e-06  23%  584 aa  VGL2A_DANRE RecName: Full=Vesicular glutamate transporter
  107::275     3e-06  21%  420 aa  NPT4_HUMAN RecName: Full=Sodium-dependent phosphate transport
  129::261     4e-06  25%  582 aa  VGLU2_BOVIN RecName: Full=Vesicular glutamate transporter 2;       
  129::261     6e-06  24%  582 aa  VGLU2_RAT RecName: Full=Vesicular glutamate transporter 2;       
  129::261     6e-06  24%  582 aa  VGLU2_MOUSE RecName: Full=Vesicular glutamate transporter 2;       
  129::261     6e-06  24%  582 aa  VGLU2_HUMAN RecName: Full=Vesicular glutamate transporter 2;       
  130::262     6e-06  25%  587 aa  VGL2B_DANRE RecName: Full=Vesicular glutamate transporter
  277::459     8e-06  28%  591 aa  PHT44_ORYSJ RecName: Full=Probable anion transporter 4,
  146::234     1e-05  25%  501 aa  SPX2_HUMAN RecName: Full=Sugar phosphate exchanger 2;AltName:
  273::397     1e-05  26%  398 aa  Y1317_METJA RecName: Full=Uncharacterized MFS-type transporter
   49::245     1e-05  22%  526 aa  SPNS1_XENLA RecName: Full=Protein spinster homolog 1;
  203::432     1e-05  24%  616 aa  JEN1_YEAST RecName: Full=Carboxylic acid transporter protein
   79::295     2e-05  29%  443 aa  YAAU_ECOLI RecName: Full=Putative metabolite transport protein
   81::299     2e-05  29%  494 aa  SVOPL_MOUSE RecName: Full=Putative transporter SVOPL;AltName:
   57::191     3e-05  29%  396 aa  NEPI_ECO27 RecName: Full=Purine ribonucleoside efflux pump nepI;
  125::292     4e-05  26%  605 aa  SPIN_DROME RecName: Full=Protein spinster;AltName: Full=Protein
   38::278     4e-05  21%  452 aa  GLPT_ECOLI RecName: Full=Glycerol-3-phosphate transporter;       
  132::311     5e-05  20%  465 aa  NPT1_RAT RecName: Full=Sodium-dependent phosphate transport protein
   19::285     5e-05  21%  444 aa  GLPT_BACSU RecName: Full=Glycerol-3-phosphate transporter;       
  147::285     6e-05  34%  548 aa  S22A7_PONAB RecName: Full=Solute carrier family 22 member
  147::285     6e-05  34%  548 aa  S22A7_HUMAN RecName: Full=Solute carrier family 22 member
   78::293     6e-05  23%  413 aa  MUCK_ACIAD RecName: Full=Cis,cis-muconate transport protein;
   61::286     1e-04  24%  407 aa  Y1104_HAEIN RecName: Full=Putative metabolite transport protein
   39::210     1e-04  22%  442 aa  UHPC_SALTY RecName: Full=Regulatory protein uhpC;
   57::191     1e-04  28%  396 aa  NEPI_ECOUT RecName: Full=Purine ribonucleoside efflux pump nepI;
   57::191     1e-04  28%  396 aa  NEPI_ECOL6 RecName: Full=Purine ribonucleoside efflux pump nepI;
   57::191     1e-04  28%  396 aa  NEPI_ECOL5 RecName: Full=Purine ribonucleoside efflux pump nepI;
   57::191     1e-04  28%  396 aa  NEPI_ECOK1 RecName: Full=Purine ribonucleoside efflux pump nepI;
   19::328     1e-04  25%  480 aa  GLPT_HAEIN RecName: Full=Glycerol-3-phosphate transporter;       
  127::361     1e-04  22%  576 aa  EAT4_CAEEL RecName: Full=Probable vesicular glutamate transporter
  158::249     1e-04  24%  533 aa  GLPT_HUMAN RecName: Full=Glycerol-3-phosphate transporter;       
  128::324     1e-04  22%  533 aa  ANTR4_ARATH RecName: Full=Probable anion transporter 4,
   57::191     2e-04  28%  396 aa  NEPI_SHISS RecName: Full=Purine ribonucleoside efflux pump nepI;
  153::309     2e-04  22%  534 aa  YMPB_CAEEL RecName: Full=Putative transporter B0361.11;
  167::299     2e-04  34%  556 aa  S22AK_MOUSE RecName: Full=Solute carrier family 22 member
   57::191     2e-04  28%  396 aa  NEPI_ECO57 RecName: Full=Purine ribonucleoside efflux pump nepI;
   43::214     2e-04  25%  494 aa  MOT1_RAT RecName: Full=Monocarboxylate transporter 1;       
   57::191     3e-04  28%  396 aa  NEPI_SHIFL RecName: Full=Purine ribonucleoside efflux pump nepI;
   57::191     3e-04  28%  396 aa  NEPI_SHIF8 RecName: Full=Purine ribonucleoside efflux pump nepI;
   57::191     3e-04  28%  394 aa  NEPI_SHIDS RecName: Full=Purine ribonucleoside efflux pump nepI;
   57::191     3e-04  28%  396 aa  NEPI_ECOLI RecName: Full=Purine ribonucleoside efflux pump nepI;
   57::191     3e-04  28%  396 aa  NEPI_ECOBW RecName: Full=Purine ribonucleoside efflux pump nepI;
   10::178     4e-04  27%  532 aa  YHCA_BACSU RecName: Full=Uncharacterized MFS-type transporter yhcA;
   20::144     4e-04  28%  307 aa  RCEM_CHLAA RecName: Full=Reaction center protein M chain;AltName:
   57::191     4e-04  28%  396 aa  NEPI_SHIBS RecName: Full=Purine ribonucleoside efflux pump nepI;
   71::185     5e-04  29%  404 aa  YYBF_BACSU RecName: Full=Uncharacterized MFS-type transporter yybF;
  161::261     5e-04  28%  394 aa  TSGA_SERP5 RecName: Full=Protein tsgA homolog;
  196::287     5e-04  31%  404 aa  MDTG_SALAR RecName: Full=Multidrug resistance protein mdtG;
   98::231     5e-04  24%  517 aa  ANTR6_ARATH RecName: Full=Probable anion transporter 6,
  127::276     7e-04  30%  402 aa  YHJX_ECOLI RecName: Full=Inner membrane protein yhjX;
  152::324     7e-04  24%  494 aa  SPX3_HUMAN RecName: Full=Sugar phosphate exchanger 3;AltName:
   41::191     7e-04  17%  506 aa  SPNS1_DANRE RecName: Full=Protein spinster homolog 1;AltName:
  150::239     0.001  22%  503 aa  SPX3_XENLA RecName: Full=Sugar phosphate exchanger 3;AltName:
  199::287     0.001  31%  404 aa  MDTG_SALTY RecName: Full=Multidrug resistance protein mdtG;
  199::287     0.001  31%  404 aa  MDTG_SALTI RecName: Full=Multidrug resistance protein mdtG;
  199::287     0.001  31%  404 aa  MDTG_SALPK RecName: Full=Multidrug resistance protein mdtG;
  199::287     0.001  31%  404 aa  MDTG_SALPB RecName: Full=Multidrug resistance protein mdtG;
  199::287     0.001  31%  404 aa  MDTG_SALPA RecName: Full=Multidrug resistance protein mdtG;
  199::287     0.001  31%  404 aa  MDTG_SALNS RecName: Full=Multidrug resistance protein mdtG;
  199::287     0.001  31%  404 aa  MDTG_SALHS RecName: Full=Multidrug resistance protein mdtG;
  199::287     0.001  31%  404 aa  MDTG_SALEP RecName: Full=Multidrug resistance protein mdtG;
  199::287     0.001  31%  404 aa  MDTG_SALDC RecName: Full=Multidrug resistance protein mdtG;
  199::287     0.001  31%  404 aa  MDTG_SALCH RecName: Full=Multidrug resistance protein mdtG;
  199::287     0.001  31%  404 aa  MDTG_SALA4 RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECOUT RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECOSE RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECOLI RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECOLC RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECOL6 RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECOL5 RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECOK1 RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECODH RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECOBW RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECO8A RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECO81 RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECO7I RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECO57 RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECO55 RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECO45 RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECO27 RecName: Full=Multidrug resistance protein mdtG;
  198::289     0.001  31%  408 aa  MDTG_ECO24 RecName: Full=Multidrug resistance protein mdtG;
  196::287     0.001  30%  406 aa  MDTG_CITK8 RecName: Full=Multidrug resistance protein mdtG;
    1::429

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSITLLDGVVKKNRARLIPFMLALYVLAFLDRSNIGFAKETYQIDTGLSNEAYALGAGIFFVVYAFLGVP
YFAV_ECOLI      MSTALLDAVVKKNRVRLIPFMLALYVLAFLDRSNIGFAKQTYQIDTGLSNEAYALGAGIFFVVYAFLGVP
TUB4_AGRVI      MNSDLETRVLRKITLRIVPFIMLLYFVAFLDRVNIGFAALTMNEDLGFSSTXXXXXXXXXXXXXXLFEVP
TUB3_AGRVI      --------VLRKITFRIVPFIMLLYFIAFLDRVNIGFAALTMNQDLGFSSTXXXXXXXXXXXXXXLFEVP
PHT1_PSEPU      -----IEKVYRKVTLRLMTFIFVAWVLNYLDRVNISFAQVYLKHDLGMSDADLRTRRKLVFHRLHRIGNT
YHDC_SCHPO      --------LVRKLDWYLMPMFSVLYFLSFLDRANIGNAAVVLKEDLKLQAYQYSAAVSVFYATYITAETP
YIQ6_YEAST      -------------------FLWVFIMFAFLDRKNIARASDNFIVDLKMNTNDYNLGQTVYLVIFLASELP
YIZG_SCHPO      ----------------LAPTIMILYLVAFLDRSNIGNAKVALPEDLKLKGDQFNIIASVFYVTFILFEMP
THI73_YEAST     --------VLRKVDLFILPFLCCTYLLMFLDKALLNYAASMGIKDHLKGNEFSNLGT-IFSAAYIFMEPV
TNA1_YEAST      --------VLRKMDIYLIPLMGMLYFLSNLDKSNIGNAEVA-----GLSKDIHLVGTQVFFATYVLFDPI
VHT1_SCHPO      ---------------RIIPCLWILYFLSCCLRFTVSFTMNTAQIQTGYSAHYLALGLALFYVGYIIFEVP
YJ7D_SCHPO      ----------------MMPVMCITYMIQYLDKTALSYAAYGMKTDTHIDGHTYSSMTTLFYAGYLVAQYP
YC7A_SCHPO      --------LVRKIDCTIFPVMCLVYCIQFLDKTSNSYAVIMLKEDLKMEGQMYSWSGTAFYLGYLVFEFP
YE1F_SCHPO      ------------------------------------------QTVSGLNYHTLSVGTGLSYVSLIIFDLP
EXUT_BACSU      -----------KDKLPVILFLFLAGVINYLDRSALSIAAPFIQDDLTLSATQMGLIFSSFSIGYAIFNFL
YAOI_SCHPO      ------------------PIIGFLYLMAFLDRSNIGNAAVAGMTEASLYGERLNVAVSIFYVLYILVETP
YFZ4_SCHPO      ------------------------------DKSNVSNAKTNMDKDLGFVGDQYNIMISIFYIPFVLCAFP
GUDP_BACSU      ----------KKTSVRFIVFMLFLVTINYADRATLSITGDSVQHDLGLDSVAMGYVFSAFGWAYVIGQLP
LIZ1_SCHPO      ----------------ILSYCCVSYFINYLDRSSINNAYLSMQEDLKMGNELQDINV-VFTCGYIIGQLP
YJJL_ECOLI      ------DGLVQRSTAMLLLFFAA--VINYLDRSSLSVANLTIREELGLSATEIGALLSVFSLAYGIAQLP
DGOT_ECOLI      ----------KPGRRRYLTLVMIFIVICYVDRANLAVASAHIQEEFGITKAEMGYVFSAFAWLYTLCQIP
DGOT_ECOL6      ----------KPGRRRYLTLVMIFIVICYVDRANLAVASAHIQEEFGITKAEMGYVFSAFAWLYTLCQIP
S17A5_MOUSE     ----------------------------------------------------------------------
YGDF_SCHPO      ----------------VMPLLCLISAFQYMDKSTSNYSSIMIRTDLNMVGNQYNWVGTSFYLGFMVFSLP
GUDP_ECOLI      --------VEKRTNARYWIVVMLFIVTSFNDRATLSIAGSEMAKDIGLDPVGMGYVFSAFSWAYVIGQIP
YO162_YEAST     ----------------------------------------------------------------------
S17A5_HUMAN     ---------------------------------------------------------GSFFYGYIITQIP
YQD3_SCHPO      --------------------------------------------DVHITSNQYNNLNTLFYVGYIVGQFP
PHT42_ORYSJ     ------------------------------DRVVMSVAVVPFAAQYGWSSSFLGIVQSSFLWGYVFSSMV
PHT41_ORYSJ     -------------RWAIVFLCFSAFLLCNMDRVNMSIAILPMSAEFGWNPQTVGLIQSSFFWGYLLTQIA
FEN2_YEAST      -------------KKRLLLFKIDLFVLSFVDR--VGFTNSGMKEDLKMVGNDLTVSNTVFMIGYIVGMVP
DAL5_YEAST      ----------------MFPLMCILYAVQFMDKSTSSAAVMGLRTDLKMHGDQYSWVTSAFYFGYLFLGPV
ANTR3_ARATH     -------------RIKVVILTACMMCLCNADRVVMSVAVVPLADKLGWSSSFLGVVQSSFLWGYIFSSVI
YLD2_CAEEL      -----------------------------------------------------------FFYGYIGSQII
ANTR1_ARATH     ----------------IVLLCFSAFLLCNMDRVNMSIAILPMSAEYGWNPATVGLIQSSFFWGYLLTQIA
GARP_ECOLI      ----ILDTVDEKKKGVHTRYLILLIIFIYADRATLSIAGTEVAKELQLSAVSMGYIFSAFGWAYLLMQIP
GARP_ECO57      ----ILDTVDEKKKGVHTRYLILLIIFIYADRATLSIAGTEVAKELQLSAVSMGYIFSAFGWAYLLMQIP
SEO1_YEAST      ------------------------YWVKYLDTVNINNAYVSMKEDLGFQGNDLVHTQVMYTVGNIIFQLP
PHT43_ORYSJ     ----------------------------------------------------------------------
VHT1_YEAST      --------------------------------------------DLNMKGNDYVYTSTIANVGAIVFQLP
YHJ1_SCHPO      --------------------------------------------DTHINSNQYNDINTLFYVGFVIGQIP
PICO_DROME      -----------------------------------------------------------FFYGYVITQIP
NPT3_BOVIN      --------------------------------------------------------------------IP
PICO_DROAN      -----------------------------------------------------------FFYGYVITQIP
YKH4_CAEEL      ----------------------------------------------------------------------
YYBO_BACSU      ----------------------------YFDRVAISVAAPAIQDSFHLTATELGIVFSIYTYSYTLMQLP
S17A5_SHEEP     ---------------------------------------------------------GSFFYGYIITQIP
GUDP_PSEPU      ----------KQTRVRYLILLMLFLVINYADRATISIAGSSIQKDFGLDAVTLGYIFSAFGWAYVLGQIP
PHT47_ORYSJ     --------------------------VCYIERVGFSIAYTVAADAIGVNQANKGMILSMFYYGYVLSQIP
SPX2_DANRE      -----------------------------------------------------------FLVAYAVGMFF
UHPC_ECOLI      ------------------------YALFYFTRKSFNAAVPEILANGVLSRSDIGLLATLFYITYGVSKFV
S17A4_HUMAN     --------------------------------------------------------------------IP
EXUT_ECOLI      -------------------------------RNTVAAAAPTLMEELNISTQQXXXXXXXXXXXXTVMQPV
EXUT_ECO57      -------------------------------RNTVAAAAPTLMEELNISTQQXXXXXXXXXXXXTVMQPV
ANTR2_ARATH     ----------------------------------------------------------------------
VGLU3_HUMAN     --------------------------------------------------ETVGLIHGSFFWGYIMTQIP
VGLU1_RAT       --------------------------------------------------ETVGLIHGSFFWGYIVTQIP
VGLU1_MOUSE     --------------------------------------------------ETVGLIHGSFFWGYIVTQIP
VGLU1_HUMAN     --------------------------------------------------ETVGLIHGSFFWGYIVTQIP
VGLU1_BOVIN     --------------------------------------------------ETVGLIHGSFFWGYIVTQIP
YRT3_CAEEL      ------------------------FAISFGIRSNFGVAKEVHEREFLWTGAEVGMMESSFFYGYAASQIP
YL055_YEAST     ----------------IFTFVSAINLLLYMDKATLSYDSILFFEDTGLTQNTYNTVNTLFYVGFAIGQFP
VGLU3_RAT       --------------------------------------------------ETVGLIHGSFFWGYIVTQIP
UHPT_CHLPN      --------VVKKKRIRIFYSMFIGYIFYYFTRKSFTFAMPTLIADLGFDKAQLGIIGSTLYFSYGISKFV
NPT3_HUMAN      --------------------------------------------------------------------IP
VGLU1_XENLA     ---------------------------------------------------------GSFFWGYIVTQIP
QACA_STAAU      ----------------------------------------------------------IYSLVLAGFIIP
QACA_STAAM      ----------------------------------------------------------IYSLVLAGFIIP
VGLU3_MOUSE     --------------------------------------------------ETVGLIHGSFFWGYIVTQIP
VGLU3_DANRE     --------------------------------------------------ETVGLIHGSFFWGYIVTQIP
SPX2_BOVIN      ----------------------------------------------------------------------
SPNS1_XENTR     ----LLTGISYRHSVTIVIILFYINLLNYMDRFTVAGVKEDYHINSGLVQTVFICSYMFLAPVFGYLGDR
NPT3_MOUSE      ----------------------------------------------------------------------
S17A4_MOUSE     ----------------------------------------------------------------------
SPX2_MOUSE      ----------------------------------------------------------------------
SVOPL_HUMAN     -----------------------------------------------LENWQVALVTTMVFFGYMVFSIL
ANTR5_ARATH     --------------------------VCYIERVGFSIAYTVAADAAGINQSSKGTILSTFFVGYACSQVP
VGLU1_XENTR     ---------------------------------------------------------GSFFWGYIVTQIP
VGL2A_DANRE     --------------------------------------------------ETVGLIHGSFFWGYIVTQIP
NPT4_HUMAN      ----------------------------------------------------------------------
VGLU2_BOVIN     ---------------------------------------------------------GSFFWGYIITQIP
VGLU2_RAT       ---------------------------------------------------------GSFFWGYIITQIP
VGLU2_MOUSE     ---------------------------------------------------------GSFFWGYIITQIP
VGLU2_HUMAN     ---------------------------------------------------------GSFFWGYIITQIP
VGL2B_DANRE     ---------------------------------------------------------GSFFWGYTVTQIP
PHT44_ORYSJ     ----------------------------------------------------------------------
SPX2_HUMAN      ----------------------------------------------------------------------
Y1317_METJA     ---------------------------------------------------------------YATFSIP
SPNS1_XENLA     ----LLTGISYKRSVIIVIILFYINLLNYMDRFTVAGVLPDIKKAFNISDSNSGLVQTVFICSYMFLAPV
JEN1_YEAST      ----------------------------------------------------------------------
YAAU_ECOLI      ----------------------------------------------------------------------
SVOPL_MOUSE     -----------------------------------------------LENWQVAFVTTMVFFGYMVSSIL
NEPI_ECO27      --------------------------------------------------------AGQSVTVTAFVAMF
SPIN_DROME      -------------------------LINYMDRFTIAGVLTDVRNDFDIGNDSAGLLQTVFVISYMVCAPI
GLPT_ECOLI      ------------------------YAAYYLVRKNFALAMP-YLVEQGFSRGDLGFALSGISIAYGFSKFI
NPT1_RAT        ----------------------------------------------------------------------
GLPT_BACSU      -----MDAAYKRLRLQVFIGIFIGYAGYYLLRKNFAFAIPYLQ-EQGFSKTELGLVLAAVSIAYGFSKFI
S22A7_PONAB     --------------------------------------------------------ASTFFFAGVLVGAV
S22A7_HUMAN     --------------------------------------------------------ASTFFFAGVLVGAV
MUCK_ACIAD      ----------------------------------------------------------------------
Y1104_HAEIN     -----------------------------------------------------------------FGGIL
UHPC_SALTY      ------------------------YALFYFTRKSFNAAAPEILASGILTRSDIGLLATLFYITYGVSKFV
NEPI_ECOUT      --------------------------------------------------------AGQSVTVTAFVAMF
NEPI_ECOL6      --------------------------------------------------------AGQSVTVTAFVAMF
NEPI_ECOL5      --------------------------------------------------------AGQSVTVTAFVAMF
NEPI_ECOK1      --------------------------------------------------------AGQSVTVTAFVAMF
GLPT_HAEIN      -----IDSTYKRLRWQVFAGIFFGYAAYYFVRANFDLAQPGL-IQAGLYSKAIGSAAGLAYGLSKF--VM
EAT4_CAEEL      -----------------------------------------------------------YFYGYLVTQIP
GLPT_HUMAN      ----------------------------------------------------------------------
ANTR4_ARATH     ------------------------------DRVVMSVAIVPLSLSRGWSKSFSGIVQSSFLWGYLISPIA
NEPI_SHISS      --------------------------------------------------------AGQSVTVTAFVAMF
YMPB_CAEEL      ------------------------------------------------------------FTIGAVIAVP
S22AK_MOUSE     ----------------------------------------------------------------------
NEPI_ECO57      --------------------------------------------------------AGQSVTVTAFVAMF
MOT1_RAT        ------------------------------------FFKEIEIIFSATTSEVSWISSIMLAVMYAG-GPI
NEPI_SHIFL      --------------------------------------------------------AGQSVTVTAFVAMF
NEPI_SHIF8      --------------------------------------------------------AGQSVTVTAFVAMF
NEPI_SHIDS      --------------------------------------------------------AGQSVTVTAFVAMF
NEPI_ECOLI      --------------------------------------------------------AGQSVTVTAFVAMF
NEPI_ECOBW      --------------------------------------------------------AGQSVTVTAFVAMF
YHCA_BACSU      -----------KNPMSLLIVLMAGLFLAILNQTLLNVAMPHLMTEFGVSTTGYMLVNGVLIPLSAFL---
RCEM_CHLAA      ----------------------------------------------------------------------
NEPI_SHIBS      --------------------------------------------------------AGQSVTVTAFVAMF
YYBF_BACSU      ----------------------------------------------------------------------
TSGA_SERP5      ----------------------------------------------------------------------
MDTG_SALAR      ----------------------------------------------------------------------
ANTR6_ARATH     -------------RYKLIGATSLAFVICNMDKVNLSIAIIPMSHQFGWSSSVAGLVQSSFFWGYALSQLP
YHJX_ECOLI      ----------------------------------------------------------------------
SPX3_HUMAN      ----------------------------------------------------------------------
SPNS1_DANRE     -------GVTDRRAIMTVIVLCYINLLNYMDRFTVAGVLPDIEHFFGIGDGTSGLLQTVFICSYMFLAPL
SPX3_XENLA      ----------------------------------------------------------------------
MDTG_SALTY      ----------------------------------------------------------------------
MDTG_SALTI      ----------------------------------------------------------------------
MDTG_SALPK      ----------------------------------------------------------------------
MDTG_SALPB      ----------------------------------------------------------------------
MDTG_SALPA      ----------------------------------------------------------------------
MDTG_SALNS      ----------------------------------------------------------------------
MDTG_SALHS      ----------------------------------------------------------------------
MDTG_SALEP      ----------------------------------------------------------------------
MDTG_SALDC      ----------------------------------------------------------------------
MDTG_SALCH      ----------------------------------------------------------------------
MDTG_SALA4      ----------------------------------------------------------------------
MDTG_ECOUT      ----------------------------------------------------------------------
MDTG_ECOSE      ----------------------------------------------------------------------
MDTG_ECOLI      ----------------------------------------------------------------------
MDTG_ECOLC      ----------------------------------------------------------------------
MDTG_ECOL6      ----------------------------------------------------------------------
MDTG_ECOL5      ----------------------------------------------------------------------
MDTG_ECOK1      ----------------------------------------------------------------------
MDTG_ECODH      ----------------------------------------------------------------------
MDTG_ECOBW      ----------------------------------------------------------------------
MDTG_ECO8A      ----------------------------------------------------------------------
MDTG_ECO81      ----------------------------------------------------------------------
MDTG_ECO7I      ----------------------------------------------------------------------
MDTG_ECO57      ----------------------------------------------------------------------
MDTG_ECO55      ----------------------------------------------------------------------
MDTG_ECO45      ----------------------------------------------------------------------
MDTG_ECO27      ----------------------------------------------------------------------
MDTG_ECO24      ----------------------------------------------------------------------
MDTG_CITK8      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ANLLMRKFGARTWIGTTTLLWGFLSAAMAWADSEAKFLIIRTLLGAAEAGFFPGMIYLTSQWFPQRNRAS
YFAV_ECOLI      ANLLMRKLGARTWIGTTTLLWGFLSAAMAWADTEAKFLIVRTLLRAAEAGFFPGMIYLTSQWFPQRNRAS
TUB4_AGRVI      SNLILNKVGARIWIARVMITWGIVSGLMAFVQGTTSFYALRFLLGVAEAGFFPGIILYLSFWFPARRRAA
TUB3_AGRVI      SNLILNKVGARIWIARVMITWGIVSGLMAFVQGTTSFYILRFLLGVAEAGFFPGIILYLSFWFPARRRAA
PHT1_PSEPU      QYAYLQKIGARLTITRIMVLWGLISASMAFMTTPTEFYIARALLGAAEAGFWPGIILYLTYWYPGARRAR
YHDC_SCHPO      SVLLVKKFGPHYYLSAMIIGWSLVTIFTCFVRHYWSLVLTRLLLGICEGGFFPCLSLYISMTYKREEQGK
YIQ6_YEAST      GNLLSKRFGPERVIPVQIVLWSVICITQAGLKNRGQFIATRCLLGMVQGGFIPDNILYLSYYYTGAELTF
YIZG_SCHPO      TTLLMKKVQPKRMLAFIVISYSLTTIFTGFCHNFGGLLAARLVLGFCEAGLFPCLALYLTMIYSRVELAP
THI73_YEAST     VTYLIQKFPISKILGTFITVWGIVLACHAACKTYASLMVVRTLLGLFESSSAVGCIAISGMYYTKSEQSA
TNA1_YEAST      GTNLLKIMGPPLMMSICLTCFGAISLGTAWVKNYAQLIVVRLLLGAFEGMIYPAINMYLSVCYRREQYAL
VHT1_SCHPO      SNLMMAFIEPRIWVSRIQLTIGVVGACHAVLGTKQSYVALRFFLGVAESGLWPGLAYYMSRWYRGKHLGK
YJ7D_SCHPO      AAILMQKCRLSYFIFCNVFLWSAMVCLMAACRNGPSLLGLRFLAGIFEASITPAFINITAMWYRREEQPM
YC7A_SCHPO      ASLLLQRFPLSKTLCVFLVIWGFLLCMTSVANYPG-FIALRVLLGMMESAASPGFILLTAQWYKRSEQQL
YE1F_SCHPO      SNLLMTRADPRLWLSRIQVTTGIIGACHAVGSSASGFIALRFFNGLAIAGMWPGFAFYTSRFYRDQHLGK
EXUT_BACSU      GGVASDRYGAKLTLFVAMVVWSLFSGAVALAFGFVSLLIIRILFGMGEGPLSATINKMVNNWFPPTQRAS
YAOI_SCHPO      SVVLVKRIKASRMLAFISFAWSMTVLFSGFMSSYGGLIATRLILGLLEGCLFPALLYLTTH-YTRKEQCQ
YFZ4_SCHPO      FSYLYKRFGAARILPFFMLSFGAMSLCQAAVKNFGGMMAVRWFLGMAESAVLPGVVYYLTTFYRRTELAR
GUDP_BACSU      GGWLLDRFGSKTIIALSIFFWSFLQGAIGFFSAGTAIILLRFLVGLSEAPSFPGNGRVVASWFPSSERGT
LIZ1_SCHPO      GSYALQRVPARLWFSVMNILWGLMTIFSFAVHSVRALMILRFFMAVAEASTFAGTHYILGAWYKESELCK
YJJL_ECOLI      CGPLLDRKGPRLMLGLGMFFWSLFQAMSGMVHNFTQFVLVRIGMGIGEAPMNPCGVKVINDWFNIKERGR
DGOT_ECOLI      GGWFLDRVGSRVTYFIAIFGWSVATLFQGFATGLMSLIGLRAITGIFEAPAFPTNNRMVTSWFPEHERAS
DGOT_ECOL6      GGWFLDRVGSRVTYFIAIFGWSVATLFQGFATGLMSLIGLRAITGIFEAPAFPTNNRMVTSWFPEHERAS
S17A5_MOUSE     -------------------------------------VVLRALEGLGEGVTFPAMHAMWSSWAPPLERSK
YGDF_SCHPO      LSTLLQKFPLSKVTSAFIVAWGILMTLTCLVHSYASYIATRTLLGILESVITPAFVLFIAQWYRKEEQFF
GUDP_ECOLI      GGWLLDRFGSKRVYFWSIFIWSMFTLLQGFVDIFSGFGIIRFLVGLAEAPSFPGNSRIVAAWFPAQERGT
YO162_YEAST     ------------------IAWSLVATLQCKMTGKSSFYTCRALMGLFEGGFVADLVLWMSYFYSSSELSI
S17A5_HUMAN     GGYVASKIGGKMLLGFGILGTAVLTTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSK
YQD3_SCHPO      GHYIMQTFPLGKFVGLVTFSWSVIVFLHCCAYNYGGLIALRFFLGFTESCLLPAMEATMGMFFTHQEQAF
PHT42_ORYSJ     GGALADRYGGKKVMAGAAALWSLATFLTPWAASQSTIMLIRALFGLAEGVAFPTMSTFLPKWFPTHERAT
PHT41_ORYSJ     GGIWADTVGGKTVLGFGVIWWSIATALTPFAAKLGLLLVTRAFMGVGEGVAMPAMNNILSKWVPVSERSR
FEN2_YEAST      NNLMLLCVPPRIWLSFCTFAWGLLTLGMYKVTSFKHICAIRFFQALFESCTFSGTHFVLGSWY-KEDELP
DAL5_YEAST      QFIFQRTSHMSKMLAVFIVIWGMLLALHAAPTVKPSFIVLRVLLGCAESVVTPCFTIITAQYWKTEEQFT
ANTR3_ARATH     GGALVDRYGGKRVLAWGVALWSLATLLTPWAHSTLALLCVRAFFGLAEGVAMPSMTTLLSRWFPMDERAS
YLD2_CAEEL      GGHLASRYGGKRVVFVTILGSALLTLLVAARTSEYALAILRAAIGFLQGATFPAMHTMWSVWGPPLELSV
ANTR1_ARATH     GGIWADTVGGKRVLGFGVIWW---SIATILTPVAAKLLVVRAFMGVGEGVAMPAMNNILSKWVPVQERSR
GARP_ECOLI      GGWLLDKFGSKKVYTYSLFFWGFVDMPLAWAGISMFFM--RFMLGFSEAPSFPANARIVAAWFPTKERGT
GARP_ECO57      GGWLLDKFGSKKVYTYSLFFWGFVDMPLAWAGISMFFM--RFMLGFSEAPSFPANARIVAAWFPTKERGT
SEO1_YEAST      FLIYLNKLPLNYVLPSLDLCWSLLTVGAAYVNSVPHLKAIRFFIGAFEAPSYLAYQYLFGSFYKHDEMVR
PHT43_ORYSJ     ---LVDYYGGKRVMAYGVALWSLATFLSPWAAARSLWLFLRVLLGMAEGVALPSMNNMVLRWFPRTERSS
VHT1_YEAST      FMYLLPRFPSHIILPVMDLGWTWFTFACYRANSLAELRAYRFILSAFGAAYYPVSQYILGCWYAPDEINS
YHJ1_SCHPO      GHMLLQRFPVSKFVAASTALWTIIIFLHCAAYNFSGLMALRFFLGLVESSLLPTMEATIGMFFPHSEQAL
PICO_DROME      FGILAKKYGSLRFLGYGMLIFAFLVPVAARGGGVWGLCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSR
NPT3_BOVIN      SGYLAGIFGAKQMLGAGLLISSLLTLFTPLTADFGVILVIRTVQGMAQGMAWTGQFTIWAKWAPPLERSK
PICO_DROAN      FGILAKKYGSLRFLGYGMLIFAFLVPVAAREGGVWGLCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSR
YKH4_CAEEL      --------------------------------------LARIGMGLGEGFVFPTNNAIIGNWFPSSEKST
YYBO_BACSU      VGSLLDRFGVATRVGMT--IWSFLTIXXXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXLWFPPSERGL
S17A5_SHEEP     GGYVASRSGGKLLLGATAIFTLFTPLA---ADFGVGALVLRALEGLGEGVTYPAMHAMWSSWAPPLERSK
GUDP_PSEPU      GGWLLDRFGSKTW-SLFTLLQGYIGE-FGISTAVVLLFLLRFMVGLAEAPSFPGNARIVASWFPTKERGT
PHT47_ORYSJ     GGWAAQRIGGRRVLLLSFVLWSLICGLIPLDPKREVILVLRLFVGVAQGFIFPAIHTVLAQWVPPQERSR
SPX2_DANRE      SGIFGERLPLRYYLSTGMLLSGLFTALFGWQHSLWYYCLVQALNGLVQTTGWPAVVACVGNWFGKGKRGF
UHPC_ECOLI      SGIVSDRSNARYFMGIGLIATGIINILFGFSTSLWAFAVLWVLNAFFQGWGSPVCARLLTAWYSRTERGG
S17A4_HUMAN     SGYVAGIFGAKYVVGAGLFISSFLTLFIPLAANAALLIVLRIVQGIAQVMVLTGQYSIWVKWAPPLERSQ
EXUT_ECOLI      AGYVLDVLGTKIGYAMFAVLWAVFCGATALAGSWXXXXXXXXXXXXXXXXXXXXXLKASSEWFPAKERSI
EXUT_ECO57      AGYVLDVLGTKIGYAMFAVLWAVFCGATALAGSWXXXXXXXXXXXXXXXXXXXXXLKASSEWFPAKERSI
ANTR2_ARATH     -------------------------------------LVVRAFMGIGEGVAMPAMNNMLSKWIPVSERSR
VGLU3_HUMAN     GGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSR
VGLU1_RAT       GGFICQKFAANRVFGTSTLNMLIPSAARVHYGC---VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSR
VGLU1_MOUSE     GGFICQKFAANRVFGTSTLNMLIPSAARVHYGC---VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSR
VGLU1_HUMAN     GGFICQKFAANRVFGTSTLNMLIPSAARVHYGC---VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSR
VGLU1_BOVIN     GGFICQKFAANRVFGTSTLNMLIPSAARVHYGC---VIFVRILQGLVEGVTYPACHGIWSKWAPPLERSR
YRT3_CAEEL      AGVLAAKFAPNKIFMLGILVASFMNILSAISFNFHPYMVVQAVQGLALGVLYPAMHGVWKFWAPPLERSK
YL055_YEAST     GQYLAQXXXXXXXXXXXXATWTILIFLSCTAYNFSGVVALRFFLGLTESVVIPILITTMGMFFDASERAA
VGLU3_RAT       GGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSR
UHPT_CHLPN      SGVMSDQSNPRYFMAIGLMITGLTNIFFGMSSSIVLFALWWGLNGWFQGWGWPPCARLLTHWYAKSERGT
NPT3_HUMAN      SGYLAGIFGAKKMLGAGLLISSLLTLFTPLAADFGVILVIRTVQGMAQGMAWTGQFTIWAKWAPPLERSK
VGLU1_XENLA     GGYICQKFAANRVFGTSTLNMLIPSAARVHF---ACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSR
QACA_STAAU      LSAFADKWGRKKALLTGFALFGLVSLAIFFAESAEFVIAIRFLLGIAGALIMPTTLSMIRVIFENKERAT
QACA_STAAM      LSAFADKWGRKKALLTGFALFGLVSLAIFFAESAEFVIAIRFLLGIAGALIMPTTLSMIRVIFENKERAT
VGLU3_MOUSE     GGFISNKFAASRVFGAAIFLTSTLNMFIPSAARVHYGCVVRILQGLVEGVTYPACHGMWSKWAPPLERSR
VGLU3_DANRE     GGFISNKLAANRVFGAAIFLTSVLNMFIPSAARVGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSR
SPX2_BOVIN      ------------------------------------FVLVQIFNGLVQTTGWPAVVSCVGNWFGKGKRGL
SPNS1_XENTR     YNRLIMCIGISFW-SLVTLLSSFVSKQYFWL-----FLLTRGLVGVGEASYSTIAPTIIADLFLADQRSR
NPT3_MOUSE      -------------------------------------IVIRTVQGMAQGMAWTGQFTIWAKWAPPLERSK
S17A4_MOUSE     ----------------------------------ALLIVLRVIQGMAQVMVLTGQYSLWAKWAPPQERSQ
SPX2_MOUSE      ------------------------------------FVLIQICNGLVQTTGWPSVVTCVGNWFGKGKRGF
SVOPL_HUMAN     FGLLADRYG-RWKILLISFLWGYFSLLTSFAPSYIWFVFLRTMVGCGVSGHSQGLI-IKTEFLPTKYRGY
ANTR5_ARATH     GGWAAQKIGGRKVLLLSFVLWSSTCFLVPLDPNXXXXXXXXXXXXXXXQGFFPSIHTVLAQWVPPHERSR
VGLU1_XENTR     GGYICQKFAANRVFGTSTLNMLIPSAARVHF---ACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSR
VGL2A_DANRE     GGYISSRLAANRVFGAAILLTSTLNMFIPSAGHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSR
NPT4_HUMAN      -----------------------------------------------------GQFAIWEKWGPPQERSR
VGLU2_BOVIN     GGYIASRLAANRVFGAAILLTSTLNMLIPSAARVGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSR
VGLU2_RAT       GGYIASRLAANRVFGAAILLTSTLNMLIPSAARVGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSR
VGLU2_MOUSE     GGYIASRLAANRVFGAAILLTSTLNMLIPSAARVGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSR
VGLU2_HUMAN     GGYIASRLAANRVFGAAILLTSTLNMLIPSAARVGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSR
VGL2B_DANRE     GGYISSRLAANRVFGAAILLTSTLNMFIPSAARVGCVMFVRILQGLVEGVTYPACHGIWSKWAPPLERSR
PHT44_ORYSJ     -------------------------------------LVMRAFMGIGEGVAMPAMNNILSKWVPVSERSR
SPX2_HUMAN      ------------------------------------FVVIQVCNGLVQTTGWPSVVTCVGNWFGKGKRGF
Y1317_METJA     FGILSDKIGRKSVLTIGYIVYGIVSLGFAYFISQKSLILLFALYGIAYALFAGNQKAYVSDLSSEDIRAT
SPNS1_XENLA     FGYLGDRYNRKSFWSLVTLLSSFVSNQYFWL-----FLITRGLVGVGEASYSTIAPTIIADLFLADQRTR
JEN1_YEAST      ---------SRKWPYITCLLFVIAQLCTPWCDTYEKFLGVRWITGIAMGGIYGCASATAIEDAPVKARSF
YAAU_ECOLI      ------KVGRRKMFLIDIIAIGVISVATMFVSSPVELLVMRVLIGIVIGADYPIATSMITEFSSTRQRAF
SVOPL_MOUSE     FGLLADRYG-RWKILLLSFLWGYFSLLTSFSPSYIWFVFLRTMVGCGVSGHAQGLI-IKTEFLPTKYRGY
NEPI_ECO27      ASLFITQTIQATDRRYVVILFAVLLTLVSFANSFSLLLIGRACLGLALGGFWAISASLTMRLVPPRTVPK
SPIN_DROME      FGYLGDRY-SRPWISTTTLLGSFMKQ-FGW------FIAFRALVGIGEASYSTIAPTIISDLFVHDMRSK
GLPT_ECOLI      MGSVSDRSNPRVFLPAGLILAAAVMLFMGWATSSIAVMFVLLFL----CGWFQGMGWTMVHWWSQKERGG
NPT1_RAT        ----------------------------------ALVIVCRVLQGIAQGAVSTGQHGIWVKWAPPLERGR
GLPT_BACSU      MGMVSDRCNPRYFLATGLFLSAIVNVSMPWVTSSVTIMFIFMFIN----GWFQGMGWTMAHWFSISERGT
S22A7_PONAB     AGYLSDRFGRRRLLYVSTLVLGLASAASV---SYVMFAITRTLTGSALAGFTIIVMPLELEWLDVEHRGV
S22A7_HUMAN     AGYLSDRFGRRRLLYVSTLVLGLASAASV---SYVMFAITRTLTGSALAGFTIIVMPLELEWLDVEHRGV
MUCK_ACIAD      ------RFGRVRIVVISILTFSILTCGLGLTQSFIQFGVLRFFASLGLGSLYIACNTLMAEYVPTKYRTT
Y1104_HAEIN     FGALSDKYGRVRVLTWTILLFAVFTGLCAIAQGYWDLLIYRTXXXXXXXXXXXXXMALAAEAWPARHRAK
UHPC_SALTY      SGIVSDRSNARYFMGIGLIATGVVNILFGFSTSXXXXXXXXXXXXXXQGFGSPVCARLLTAWYSRTERGG
NEPI_ECOUT      ASLFITQTIQATDRRYVVILFAVLLTLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPK
NEPI_ECOL6      ASLFITQTIQATDRRYVVILFAVLLTLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPK
NEPI_ECOL5      ASLFITQTIQATDRRYVVILFAVLLTLVSFANSFSLLLIGRACLGVALGGFWAISASLTMRLVPPRTVPK
NEPI_ECOK1      ASLFITQTIQATDRRYVVILFAVLLTLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPK
GLPT_HAEIN      AGMSDRS-NPRVFLPFGLLLSGLCMTLMGWATSGIAIMWVMIFLN----GWFQGMGWTMVHWWSKSERGT
EAT4_CAEEL      AGFLAAKFPPNKLFGFGIGVGAFLNILLPYGKSDYLVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSK
GLPT_HUMAN      ------------------------------------YVVTQVINGLVQTTGWPSVVTCLGNWFGKGRRGL
ANTR4_ARATH     GGTLVDRYGGKVVMAWGVALWSLATTPXXXXXXXXXXXXXXXMVGVAEGVALPCMNNMVARWFPPTERSR
NEPI_SHISS      ASLFITQTIQATDRRNVVILFAVLLTLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPK
YMPB_CAEEL      MSMLADRYGRKPIIVTTAILAFLANMAASFSPNFAIFLILRAFIGACSDSYLSVASVATCEYLSEKARAW
S22AK_MOUSE     ------------------LVWSYLQAATAYVGSFSAYCVFRFLMGMTFSGIILNSLSLVVEWMPTRGRTV
NEPI_ECO57      ASLFITQTIQATDRRYVVILFAVLLTLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPK
MOT1_RAT        SSILVNKYGSRPVMIAGGCLSGCGLIAASFCNTVQELYFCIGVIGGLGLAFNPALTMIGKYFYKKRPLAN
NEPI_SHIFL      ASLFITQTIQATDRRYVVILFAVLLTLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPK
NEPI_SHIF8      ASLFITQTIQATDRRYVVILFAVLLTLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPK
NEPI_SHIDS      ASLFITQTIQATDRRYVVILFAVLLTIVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPK
NEPI_ECOLI      ASLFITQTIQATDRRYVVILFAVLLTLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPK
NEPI_ECOBW      ASLFITQTIQATDRRYVVILFAVLLTLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPK
YHCA_BACSU      ----ITRFGQRSLFLVAMFCFTLGTLVCGIAPNFSTMLIGR-LIQAVGGGILQPLVMTTILLFPPESRGK
RCEM_CHLAA      ----------------------------------------------------------------------
NEPI_SHIBS      ASLFITQTIQATDRCYVVILFAVLLTLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPK
YYBF_BACSU      ---LSEVWGRKPIMGISMLAASVLCLASAFSPSFHTLLVLRTIQGVALAGLPSAMAYLGEEIEPG-SLGS
TSGA_SERP5      ----------------------------------------------------------------------
MDTG_SALAR      ----------------------------------------------------------------------
ANTR6_ARATH     GGWLSKIFGGRKVLEIGVFTWSFATALVPLLAGFMPGLIFRILVGIGEGVSPSAATDLIARTIPVKERSR
YHJX_ECOLI      ------------------------------------------------------------KWFPERK--G
SPX3_HUMAN      --------------------------------------------GLLQSTGWPCVVAVMGNWFGKAGRGV
SPNS1_DANRE     FGYLGDRYNRKLIMCVGIFFWSVVTLASSFIGKDHALLLTRGLVGVGEASYSTIAPTIIADLFVKEKRTN
SPX3_XENLA      ------------------------------------YCLVWIVNGLLQSTGWPCVVAIMGNWFGKSGRGF
MDTG_SALTY      ----------------------------------------------------------------------
MDTG_SALTI      ----------------------------------------------------------------------
MDTG_SALPK      ----------------------------------------------------------------------
MDTG_SALPB      ----------------------------------------------------------------------
MDTG_SALPA      ----------------------------------------------------------------------
MDTG_SALNS      ----------------------------------------------------------------------
MDTG_SALHS      ----------------------------------------------------------------------
MDTG_SALEP      ----------------------------------------------------------------------
MDTG_SALDC      ----------------------------------------------------------------------
MDTG_SALCH      ----------------------------------------------------------------------
MDTG_SALA4      ----------------------------------------------------------------------
MDTG_ECOUT      ----------------------------------------------------------------------
MDTG_ECOSE      ----------------------------------------------------------------------
MDTG_ECOLI      ----------------------------------------------------------------------
MDTG_ECOLC      ----------------------------------------------------------------------
MDTG_ECOL6      ----------------------------------------------------------------------
MDTG_ECOL5      ----------------------------------------------------------------------
MDTG_ECOK1      ----------------------------------------------------------------------
MDTG_ECODH      ----------------------------------------------------------------------
MDTG_ECOBW      ----------------------------------------------------------------------
MDTG_ECO8A      ----------------------------------------------------------------------
MDTG_ECO81      ----------------------------------------------------------------------
MDTG_ECO7I      ----------------------------------------------------------------------
MDTG_ECO57      ----------------------------------------------------------------------
MDTG_ECO55      ----------------------------------------------------------------------
MDTG_ECO45      ----------------------------------------------------------------------
MDTG_ECO27      ----------------------------------------------------------------------
MDTG_ECO24      ----------------------------------------------------------------------
MDTG_CITK8      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IMGLFYMGAPLALTLGSPLSGALLEMHGFMGHPGWFWMFVIEGLLAIGAGIFTFFWLDDTPQQARFLSLE
YFAV_ECOLI      IMGLFYMGAPLALTLGSPLSGALLEMHGFMGHPGWFWMFVIEGLLAVGAGVFTFFWLDDTPEQARFLSKQ
TUB4_AGRVI      VTAIFMAAAPLSTVLGSPISGALMEMHGFLGLAGWQWMFLIEAAPAVILGVVVLFYLTDRPEKAKWLSED
TUB3_AGRVI      VTALFMAAAPLSTVLGSPISGALMEMHGLMGLAGWQWMFLIEAAPALILGVVVLFFLTDRPEKAKWLTEE
PHT1_PSEPU      ITSRFLLXXXXXXXXXXPLSGWILHFVDVMGMKNWQWMFILEGLPAAVMGVMAYFYLVDKPEQAKWLDDE
YHDC_SCHPO      RLAYLYVCSCFSGAFGGLIATGLTKIPKSSGLPNWGWLYIIEGLISAISALWILFCLPDDPSTARFLNPR
YIQ6_YEAST      RLSFFWCAIPLFQILGSLLASGIIEMRGIHNLAGWQYLFIIEGFLSLSVGVASFYLMRRGPTQTGESAFH
YIZG_SCHPO      RIAYLFASSALSGAFGGLFAYAVLHMDGVGGFAGWRWLFIIEGLIGFVCGVAVYFIIPNDITKAWFLSMM
THI73_YEAST     RIGFWATQAGTGYIVGGLISFGFLHYHG-TAFTSWQIMFLVVGLVTVAFGVLTFLYLPDNVTNAWFLNKE
TNA1_YEAST      RFAFVFSAACLSSSFGGLIAYGCSKISGSL--KDWQYIYIVEGCISLGFVPFYAFGLSKNLEDSWFFNKE
VHT1_SCHPO      RIGWYYTXXXXXXXXXXXXXXGFQKMDGARGLYGYQWMFLIWGVVAIAQALSIPWWLPASPQRIGFLTPA
YJ7D_SCHPO      RTLCWYAFNGIAQIIGSILSYGLGHIHGKVA--SWRYVFIVIGLMSLGWGV-VFVFIPSNPSKARFLSSR
YC7A_SCHPO      RTSVWVAFNGLGQILGSCMAYGLAKRTS-LPMRGWKLIFIICGVLAIFLGFVILAVVPDNPFKAWFLTEE
YE1F_SCHPO      RIGWYYTAAQISSVATSLLSAAFQKMDGLHGLYGYQWMFLIWGVVAFTQGLFLPRWLPRIPKFLGFLKAS
EXUT_BACSU      VIGVTNSGTPLGGAISGPIVGMIAVAF------SWKVSFVLIMIIGLIWAVLWFKFVKEKPQE----TIK
YAOI_SCHPO      RXXXXXXXXXXXXXXXXXXXXXXEQVHAG-NKEGWQWIYIVEGLVSFIGVPLCLFALPDKMENAWFLTRE
YFZ4_SCHPO      RLAIFYAAANVSSAFGGLLAYGVFHIKGGK-LQGWQYLFLIEGGVTFLCAIVIFLVLPVSVETANFLTDE
GUDP_BACSU      ASAFFNSAQYFAIVIFSPLMGWL--THSF----GWHSVFVVMGIAGI---LLAVIWLKTVYEEAELAYIE
LIZ1_SCHPO      RAGIFSASGLVGTMFAGYLQTAVSSLNGKGGLSGWRWLFIIDGILTIPLSLYGLFLFPDVPEKAPYFTEQ
YJJL_ECOLI      PMGFFNAASTIGVAVSPPILAAMMLV------MGWRGMFITIGVLGIFLAI-GWYMLYRNREHVELTAVE
DGOT_ECOLI      AVGFYTSGQFVGLAFLTPLLIWIQEM------LSWHWVFIVTGGIGI---IWSLIWFKQPPRLTKGISKA
DGOT_ECOL6      AVGFYTSGQFVGLAFLTPLLIWIQEM------LSWHWVFIVTGGIGI---IWSLIWFKQPPRLTKGISKA
S17A5_MOUSE     LLTISYAGAQLGTVISLPLSGIICY------YMNWTYVFYLFGIVGIVWFILWMWIVSDTPETHKTISHY
YGDF_SCHPO      RMAFLVAWNGLGGLIGGSMSYGLYELENNLTMSPWRXXXXXXXXXXXXNGVFIFIHIPDEPSKAWFLSEK
GUDP_ECOLI      AVSIFNSAQYFATVIFAPIMGWLTH------EVGWSHVFFFMGGLGI---VISFIWLKVIHEPNQHPGVN
YO162_YEAST     RLSFFWVTLSLTQIITSIVAFGVFHMRGIGGMAGWQWLFLIERIFTLVIGISAYFLMVPSVVQTKWFTER
S17A5_HUMAN     LLSISYAGAQLGTVISLPLSGIICY------YMNWTYVFYFFGTIGIFWFLLWIWLVSDTPQKHKRISHY
YQD3_SCHPO      LQPVFWISC---LSCGIPA--------GFIAYAPWKLFMIITGGITFFLSIFLFFYYPDNPSKARFLTDE
PHT42_ORYSJ     AVGISMGGFHLGNVI-SFLATPIIMSH--IGLAGTFAFFASLGYLWLSVWLFN---VESDPLDSRTISKS
PHT41_ORYSJ     SLALVYSGMYLGSVTGLAFSPLLI--HNF-GWPSVFYSF----------GSLGVFWFSTWASKAYSSPLE
FEN2_YEAST      IRSAIFTGSGL---VGSMFSGFMTHLNGRNGLAGWRWLFIIDFCITLPIAIYGFIFFPGLPDQTSAVS--
DAL5_YEAST      RVSIWFGMNGLGSILINAIAYGVYIHQDSYAIKGWRXXXXXXXXXXXXXXXXXXXWIPDDPSKARFLSKR
ANTR3_ARATH     AVGISMAGFHMGNVVGLLLTPLMLSSIGISGP---FILFASLGLLWVST------WVTNNPQDSPFITRS
YLD2_CAEEL      LTGVTYAGAQIGNVIVLPLSGFLCE-YGFDG--GWPSIFYIIGVFGVLWTAVWWYVSSDKPATHPRITPE
ANTR1_ARATH     SLALVYSGMYLGSVTGLAFSPFLIHQFGW---PSVFYSFGSLGT------VWLTLWLESSPLEDPTLLPE
GARP_ECOLI      ASAIFNSAQYFSLALFSPLLGWLTFAW------GWEHVFTVMGVIGF---VLTALWI-------------
GARP_ECO57      ASAIFNSAQYFSLALFSPLLGWLTFAW------GWEHVFTVMGVIGF---VLTALWI-------------
SEO1_YEAST      RSAFYYLGQYIGLSAGGIQSAVYSSLNGVNGLEGWRWNFIIDAIVSVVVGLIGFYSLPGDPYNCYSIFLT
PHT43_ORYSJ     AVGIAMAGFQLGNTIGLLLSPII------MSRAGIFGPFVIFGL-------FGFLWISGTPGENAQISAH
VHT1_YEAST      RVCLFFCGQQLSVTSGLLQSRIFKSLNGVHGLAGWRWMFLIDAIISLPTAIIGFFVIPGVPSKCYSLFLT
YHJ1_SCHPO      LQPFFYISCGCNIPAGFIAYGVQYAKNTI---SPWKLFMIIVGGITFFLTIGLFFYYPDNTSTARFLTKK
PICO_DROME      MGAAVYAGAQFGTIISMPLSGLLAE-YGFDG--GWPSIFYVFGIVGTVWSIAFLIFVHEDPSSHPTIDER
NPT3_BOVIN      LTSIAGSGAAIILCVGGLISQAL----------GWPFIFYIFGSIGCVCCLLWFTVIYDDPLHHPCISIR
PICO_DROAN      MGAAVYAGAQFGTIISMPLSGLLAE-YGFDG--GWPSIFYVFGIVTVWSIAFLIFVYEDPSTHPKIDERE
YKH4_CAEEL      ALSIFTLGNQIASAAGSPMVAAVC-----ASDLGWPATFYFAGIFATGWSILWFFTASSHPAKVKMMTKK
YYBO_BACSU      ANSLFDSAAKFSNVIGAPLVAFLVTTF------DWRVAFLTIGCINV---LFTFFWYYEQPERHKRISKS
S17A5_SHEEP     LLSISYAGAQLGTVVSLPLSGVICY------YMNWTYVFYFFGIVGIIWFILWICLVSDTPETHKTITPY
GUDP_PSEPU      ASAIF-----------------------------------------------------------------
PHT47_ORYSJ     SVSLTTSG----MYLGA--AGGMLFFPSLVKHMGAQSVFFVEAVLGVA---WSVIWLKFSSEPPR---TD
SPX2_DANRE      IMGVWNSHTSVGNILGSLIAGVYVS-------SAWGLSFIVPGIIIASTGVICFLFLVERPEDVNCTAPQ
UHPC_ECOLI      WWALW--------NTAHNVGGALIPMAAAALHYGWRAGMMIAGCMAIVVGIFLCWRLRDRPQALGLPAVG
S17A4_HUMAN     LTTIAGSGSMLGSFIVLLAGGLLCQTIG------WPYVFYIFGGIGCACCPLWFPLIYDDPVNHPFISAG
EXUT_ECOLI      AVGYFNVGSSIGAMIAPPLVVWAIVMH------SWQMAFIISGALSF---IWAMAWLYKHPRDQKHLTDE
EXUT_ECO57      AVGYFNVGSSIGAMIAPPLVVWAIVMH------SWQMAFIISGALSF---IWAMAWLYKHPRDQKHLTDE
ANTR2_ARATH     SLALVYSGMYLGSVTGLAFSPMLITKFGW---PSVFYSFGSLG------SIWFLLWLKSSPKDDPDLSEE
VGLU3_HUMAN     LATTSFCGSYAGAVVAMPLAGVLVQ------YIGWSSVFYIYGMFGI---IWYMFWLYECPAAHPTISNE
VGLU1_RAT       LATTAFCGSYAGAVVAMPLAGVLVQ------YSGWSSVFYVYG----SFGIFWYFWL---------LVSY
VGLU1_MOUSE     LATTAFCGSYAGAVVAMPLAGVLVQ------YSGWSSVFYVYG----SFGIFWYFWL---------LVSY
VGLU1_HUMAN     LATTAFCGSYAGAVVAMPLAGVLVQ------YSGWSSVFYVYG----SFGIFWYFWL---------LVSY
VGLU1_BOVIN     LATTAFCGSYAGAVVAMPLAGVLVQ------YSGWSSVFYVYG----SFGIFWYFWL---------LVSY
YRT3_CAEEL      LATTAFTGSSVGVMTGLPASAYL------VSHFSWSTPFYVFGVVGIIWSLIWMYVSSHSPETHGYISDD
YL055_YEAST     AQPFFF-----AACMGSPITGFIAYGVLHITNPSWKXXXXXXXXXXXXMTVVVILWFPNNPADVKFFSIQ
VGLU3_RAT       LATTSFCGSYAGAVVAMPLAGVLVQ------YIGWASVFYIYGMFGI---IWYMFWL-------------
UHPT_CHLPN      WWSVWSTSHNIGGALIPILTGFIID------YSGWRGAMYVPGILCIGMGLVLINRLRDTPQSLGLPPIE
NPT3_HUMAN      LTTIAGSGSAIILCVGGLISQAL----------SWPFIFYIFGSTGCVCCLLWFTVIYDDPMHHPCISVR
VGLU1_XENLA     LATTAFCGSYAGAVVAMPLAGVLVQ------YSGWSSVFYVYGSFGITWYMFWILVSYESPAQHPTISEE
QACA_STAAU      ALAVWSIASSIGAVFGPIIGGALLEQ--FSWHSA-FLINVPFAIIAVVAGLF------------------
QACA_STAAM      ALAVWSIASSIGAVFGPIIGGALLEQ--FSWHSA-FLINVPFAIIAVVAGLF------------------
VGLU3_MOUSE     LATTSFCGSYAGAVVAMPLAGVLVQ------YIGWASVFYIYGMFGI---IWYMFWL-------------
VGLU3_DANRE     LATTSFCGSYAGAVIAMPLAGILVQ------YVGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEE
SPX2_BOVIN      IMGIWNSHTSVGNILGSLLAGVWVDQQ-------WGLSFVVPGVITAIMGIITFFFLIEYPE--------
SPNS1_XENTR     MLSFFYFATPVGCGLGYIAGSKVTSTAG-----DWHWALRVTPGLGLVAVLLLIFVAKEPPRGA------
NPT3_MOUSE      LTSIAGSGAAIILCVGGLISQAL----------GWPFIFYIFGSIGCVCCVLWFTVIYDDPMHHPCISVR
S17A4_MOUSE     LITIAASGSMLGTFLVLIAGGLICQALG------WPYIFYIFGGIGCACCLLWFPLVYDDPQNHPFISTG
SPX2_MOUSE      IMGIWNSHTSVGNILGSLIAGVWVNQH-------WGLSFIVPGIITAIMGVITFLFLIEYPE--------
SVOPL_HUMAN     MLPLWLAGSLLIIGLASVIIPTI----------GWRWLIRVASI----PGIILIVAFKFIPESARFLATL
ANTR5_ARATH     LVSITTSGMYLGAALGMWLLPALVELRGPES------VFLAEALAGVIWSLLWIRYATDPPRSEHPKXXX
VGLU1_XENTR     LATTAFCGSYAGAVVAMPLAGVLVQ------YSGWSSVFYVYGSFGI---MWYMFWI-------------
VGL2A_DANRE     LATTSFCGSYAGAVIAMPLAGILVQ------YTGWSSVFYVYGCFGIFWYMFWILVSYESPAEHPTITAE
NPT4_HUMAN      LCSIALSGMLLGCFTAILIGGFISETLG------WPFVFYIFGGVGCVCCLLWFVVIYDDPVSYPWISTS
VGLU2_BOVIN     LATTSFCGSYAGAVIAMPLAGILVQ------YTGWSSVFYVYGSFGM---IWYMFWL-------------
VGLU2_RAT       LATTSFCGSYAGAVIAMPLAGILVQ------YTGWSSVFYVYGSFGM---VWYMFWL-------------
VGLU2_MOUSE     LATTSFCGSYAGAVIAMPLAGILVQ------YTGWSSVFYVYGSFGM---VWYMFWL-------------
VGLU2_HUMAN     LATTSFCGSYAGAVIAMPLAGILVQ------YTGWSSVFYVYGSFGM---VWYMFWL-------------
VGL2B_DANRE     LATTSFCGSYAGAVVAMPLAGILVQ------YSGWSSVFYIYGSFGI---VWYMFWI-------------
PHT44_ORYSJ     SLALVYSGMYLGSVTGLAFSPLLISRFGW---PSVFYAFGSLG------SVWFALWAHSSPSEDPELSKA
SPX2_HUMAN      IMGIWNSHTSVGNILGSLIAGIWV-------NGQWGLSFIVPGIITAVMGVITFLFLIEHPE--------
Y1317_METJA     ALGLFYTVVGLTSLPASLIAGYLWKISPEM-------TFLYGSVLAIISGLLLLF---------------
SPNS1_XENLA     MLSFFYFATPVGCGLGYIVGSEMTSAAG-----DWHWALRVTPXXXXXXXXXXIFVAEEPPRGA------
JEN1_YEAST      LSGLFFS----AYAMGFIFAIIFYRAFGYFRDDGWFWFSIFLPILLI-------FWRLLWPETKYFTKVL
YAAU_ECOLI      IAAMWYVGATCADLVGY----WLYDVEG-----GWRWML---GSAAIPCLLILIFELPESPRKGRVKECE
SVOPL_MOUSE     MLPLWLAGSLLIISMASVVIPTI----------GWRWLIRIASI----PGIILIMAFKFIPESARFVSTG
NEPI_ECO27      ALSVIFGAVSIALVIAAPLGGFLGELIG--------WRNVFNAAAAM--GVLCIFWI-------------
SPIN_DROME      MLALFYFAIPVGSGLGYIVGSKTAHLAN-----DWRWALRVTPILGIVA-VFLILLIKD-----------
GLPT_ECOLI      IVSVWNCAHNVXXXXXXXXXXXXMAWFN-----DWHAALYMPAFCAILVALFAFAMMRDTPQSCGLPPIE
NPT1_RAT        LTSMTLSGFVMGPFIALLVSGFICDLLG------WPMVFYIFGIVGCVLSLFWFILLFDDPNNHPYMSSS
GLPT_BACSU      KMSIWNV----AHNIGGGILAPLVTL-GIAMFVTWKXXXXXXXXXXXXXXXXXXXXXRDTPQSCGLPPIE
S22A7_PONAB     LSSTFWTGGMMLLA----LVGYLIR--------DWRWL-LLAVTLPCAPGILSLWWV---PESARWL---
S22A7_HUMAN     LSSTFWTGGVMLLA----LVGYLIR--------DWRWL-LLAVTLPCAPGILSLWWV---PESARWL---
MUCK_ACIAD      VLGTLQAGWTVGYIVATLLAGWLIPDH------GWRVLFYVAIIPVLMAVLMHFF----VPEPAAW----
Y1104_HAEIN     AASY------VALGWQXXXXXXXXXXXXXXXHIGWRGMFLV--------GIFPAFWFLRSHLHEPEIFTQ
UHPC_SALTY      WWALW--------NTAHNVGGALLVMAAVALHYGWRVGMMVAGLLAIGVGMVLCWRLRDRPQ--------
NEPI_ECOUT      ALSVIFGAVSIALVIAAPLGSFLGELIG--------WRNVFNAAAAM--GVLCIFWI-------------
NEPI_ECOL6      ALSVIFGAVSIALVIAAPLGSFLGELIG--------WRNVFNAAAAM--GVLCIFWI-------------
NEPI_ECOL5      ALSVIFGAVSIALVIAAPLGSFLGELIG--------WRNVFNAAAAM--GVLCIFWI-------------
NEPI_ECOK1      ALSVIFGAVSIALVIAAPLGSFLGELIG--------WRNVFNAAAAM--GVLCIFWI-------------
GLPT_HAEIN      IVSIWNT----AHNIGGMVPGAMVLLHGIEAQAKDVWQLYFPGIAAMIFAIPVYFVMRDTPQSCGLPSIE
EAT4_CAEEL      LATTAFTGSYAGAVLGLPLSAFL------VSYVSWAAPFYLYGVCGVIWAILWFCVTFEKPAFHPTISQE
GLPT_HUMAN      IMGVWNSHTSVGNILGSLIA-------GYWVSTCWGLSFVVPGAIVAAMGIVCFLFLIEHPNDVR-----
ANTR4_ARATH     AVGIAMAGFQLGNVVGLMLSPILMSQGGIYG------PFVIFGLSGF---LWLLVWLSATPDRHPQITKS
NEPI_SHISS      ALSVIFGAVSIALVIAAPLGSFLGELIG--------WRNVFNA--AAVMGVLCIFWI-------------
YMPB_CAEEL      ITVVYNVAWSL---------GMVWTLLVTLMTDDWRWRYFIVSL----PGVYGFALWYFLPESPHWLITK
S22AK_MOUSE     --------AGILLGFSFTLGQLILAGVAYLIRP-WRWL-----QFAVSAPFLVFFWL---PESSRWLLLH
NEPI_ECO57      ALSVIFGAVSIALVIAAPLGCFLGELIG--------WRNVFNAAAAM--GVLCIFWI-------------
MOT1_RAT        --GLAMAGSPVFLSTLAPLNQA------FFGIFGWRGSFLILGGLLLNCCVAGSLMRPIGPQQGKVEKLK
NEPI_SHIFL      ALSVIFGAVSIALVIAAPLGSFLGELIG--------WRNVFNA--AAVMGVLCIFWI-------------
NEPI_SHIF8      ALSVIFGAVSIALVIAAPLGSFLGELIG--------WRNVFNA--AAVMGVLCIFWI-------------
NEPI_SHIDS      ALSVIFGAVSIALVIAAPLGSFLGELIG--------WRNVFNA--AAVMGVLCIFWI-------------
NEPI_ECOLI      ALSVIFGAVSIALVIAAPLGSFLGELIG--------WRNVFNA--AAVMGVLCIFWI-------------
NEPI_ECOBW      ALSVIFGAVSIALVIAAPLGSFLGELIG--------WRNVFNA--AAVMGVLCIFWI-------------
YHCA_BACSU      GMGIFGLAMMFAPAVGPTLSGWIIE--------HYTWRIMFYGLVPIG----------------------
RCEM_CHLAA      --------------IGKPIEIPLLENFGFDSQLGPFYLGFWNAVAYITGGIFTFIWLMVMFAQVNYNPVA
NEPI_SHIBS      ALSVIFGAVSIALVIAAPLGSFLGELIG--------WRNVFNA--AAVMGVLCIFWI-------------
YYBF_BACSU      AMGLYISGNAIGAVFGRIVSGLLSE------YLNWHMAMGTIGVISLIASVIFF----------------
TSGA_SERP5      ---------------------------------GWYWVYACIGLLYVGIFVLTLF--------SEFPVLG
MDTG_SALAR      ----------------------------------------------------------------------
ANTR6_ARATH     AVGFVF----------------------------------------------------------------
YHJX_ECOLI      LISAFAIGSYGLGSLGFKIDTQLLETVGLEK------TFVIWGAIALLMIVFGATLMKDAPKQ----EVK
SPX3_HUMAN      VFGLWSACASVGNILGACLASSVLQY-------GYEYAFLVTASVQFAGGIVIFFGLLVSPEEIGLSGIE
SPNS1_DANRE     MLSIFYFAIPVGSGMG------------------------------------------------------
SPX3_XENLA      VFGLWSACASVGNILGAFLASSVLKY-------GYEYAFLVTASVQFAGGIIIFFGLVTSPKE-------
MDTG_SALTY      ----------------------------------------------------------------------
MDTG_SALTI      ----------------------------------------------------------------------
MDTG_SALPK      ----------------------------------------------------------------------
MDTG_SALPB      ----------------------------------------------------------------------
MDTG_SALPA      ----------------------------------------------------------------------
MDTG_SALNS      ----------------------------------------------------------------------
MDTG_SALHS      ----------------------------------------------------------------------
MDTG_SALEP      ----------------------------------------------------------------------
MDTG_SALDC      ----------------------------------------------------------------------
MDTG_SALCH      ----------------------------------------------------------------------
MDTG_SALA4      ----------------------------------------------------------------------
MDTG_ECOUT      ----------------------------------------------------------------------
MDTG_ECOSE      ----------------------------------------------------------------------
MDTG_ECOLI      ----------------------------------------------------------------------
MDTG_ECOLC      ----------------------------------------------------------------------
MDTG_ECOL6      ----------------------------------------------------------------------
MDTG_ECOL5      ----------------------------------------------------------------------
MDTG_ECOK1      ----------------------------------------------------------------------
MDTG_ECODH      ----------------------------------------------------------------------
MDTG_ECOBW      ----------------------------------------------------------------------
MDTG_ECO8A      ----------------------------------------------------------------------
MDTG_ECO81      ----------------------------------------------------------------------
MDTG_ECO7I      ----------------------------------------------------------------------
MDTG_ECO57      ----------------------------------------------------------------------
MDTG_ECO55      ----------------------------------------------------------------------
MDTG_ECO45      ----------------------------------------------------------------------
MDTG_ECO27      ----------------------------------------------------------------------
MDTG_ECO24      ----------------------------------------------------------------------
MDTG_CITK8      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EKNALIRQLASEEEKKVTSRLADALRNGRVWQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVV
YFAV_ECOLI      EKTLLINQLASEEQQKVTSRLSDALRNGRVWQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVV
TUB4_AGRVI      ERNWLVKTMNAEQKGKASHSILAGLADIRVIALALVYFGTSAGLYTLGIWAPQIIKGLSSLQVGF----I
TUB3_AGRVI      ERNWLVKTMNAEQAGRGTASVMAGLADIRVIALALVYFGTSAGLYTLGIWAPQIIKGLSAIEVGF----I
PHT1_PSEPU      EKSIILDALAADRKKPVTDKVLAALKDPRVYVLAAGWATVPLCGTILNYWTPT-IIRNTGIQDVLHVGLL
YHDC_SCHPO      EKE-LMKIRAEQRQKYMGSQFRKAFKDPKMYMSCVIQFCQDLVLYGISTFLPSILKLELGYS-SLAAQYM
YIQ6_YEAST      KGKSLFTEY---EEKIMVNRI-------------------------------------------------
YIZG_SCHPO      RKRQLERAADLEAAHFDWKGVKSAFTDFKVYLYALSEFGQDTCLYGFSTFLPAIISGM-----GYTSLSV
THI73_YEAST     EKIQVVEHIRANQ---------------------------------------------------------
TNA1_YEAST      EKEYISERYKTPDEKFEWFQVWQAVKDVKTWASAVALFGIDLTTFGLTVFLP-----IIITSMGFTAQLM
VHT1_SCHPO      DKSLHSRYIAEMNVGKQWSDLLKSCLDLRVWPFILMYFGIVGVGNGIFNYCTLIIEEINPSFSGIDISLL
YJ7D_SCHPO      EKRIALERV-------------------------------------------------------------
YC7A_SCHPO      DRKLVVKRLRANKQ--------------------------------------------------------
YE1F_SCHPO      ENTGLTPEMAEMQVGKTLTDLADAFLDVRLWPPIFMFFGVVGISNGLVNYSSLIISEINENFSSVTVSLL
EXUT_BACSU      EAPAIKAETSPGEKIPLTFYLK---------QKTVLFTAFAFFAYNILFFFLTWFPSYLVDERGLSVSVI
YAOI_SCHPO      EREAIIRRDINAEQHFEWSEVRKAFKDPKVYVSATSQFCADMVLYGFSSFLPVIIKGL--GFVGLQTNYM
YFZ4_SCHPO      EKTLAKMRIENDSSSAISEKLS-FKQSLTVFKIAILWLALGVPLNSINNWLPQIVAAMGFSSV--NTNLM
GUDP_BACSU      QGGGLISMDDSKSKQETESKIKQLLTNRMLIGVYIAQYCITTLTYFFLTWFPVYLVQARGMSIGFVASLP
LIZ1_SCHPO      EKSFXXXXXXXXXXXXXXXXIKDIVRSWRIYGLCILWI--------------------------------
YJJL_ECOLI      QAYLNAGSVNARRDPLSFAEWRSLFRNRTMWGMMLGFSGINYTAWLYLAWLPLQTAYNLDLK---STGLM
DGOT_ECOLI      ELDYIRDGGGLVDGDAPVKKEARQPLTAKDWKLVFVYLG-QFAVASTLWFFLTWFPNYLTQEKGITAGFM
DGOT_ECOL6      ELDYIRDGGGLVDGDAPVKKEARQPLTAKDWKLVFVYLG-QFAVASTLWFFLTWFPNYLTQEKGITAGFM
S17A5_MOUSE     EKEYIVSSLKNQLSSQKVVPWGSILKSLPLWAIVVAHFSYNWSFYTLLTLLPTYMKEILRFNVGFLSALP
YGDF_SCHPO      EKDLVLKRLDTDSKKFKKYQILEACRDVRMYLYFFLQIAVAIPNGGLSNFSSIMLKNLGYVKKALLMNMP
GUDP_ECOLI      KKEAAGGALINMDQQNTKVKVPFSVKWGQIKQLLGSRMMIQYCINALTYFFITQARGMSILKAGFVASVP
YO162_YEAST     EEKIIVNKILRDDPTKGDMNNRQGMSLKMLWQGITDYYIWPIYLMGLLAYIPTNVLALVLRSIGFTTAIP
S17A5_HUMAN     EKEYILSSLRNQLSSQKSVPWVPILKSLPLWAIVVAHFS-------------------------------
YQD3_SCHPO      EKLYTIDRVRKSTRGGIENKIIEALKDPITWLFTFAAFTLNLAYQQNLIFTSLNVSDLNSTLVGVALAGY
PHT42_ORYSJ     ELQLILARSASKIQGSKFPSLREILSKIEMWAIIVANVVNNWGYFVLLSWMPVYFKTVYNVNLK-QAAWF
PHT41_ORYSJ     DPG-----ISAEEKKLITSQTTGGLSKPPVWALIVSHFCHNWGTFILLTWMPTYYNQVL--KFNLTESLF
FEN2_YEAST      -KFSMTRYIFNEQE--------------------------------------------------------
DAL5_YEAST      EKLMVVQRIRSNQQKKY--QIIEALKDVRTWLYFLFTVSSNIPNGGISSFM----SILLNSDFGYSS---
ANTR3_ARATH     ELR-LIQAGKPVQPSTISPKPNPSLRKLPTWAIIFANVTNNWGYFVLLSWMPVYFQTVFNVNLK-QAAWF
YLD2_CAEEL      EKQYIVASMGKDTGKVPSTPWIKILTSPAVWACWAGHFAGDWGAYTMLVSLPSFLKDVLGLNLS-SLGAV
ANTR1_ARATH     ERKLIADNCASKEPKSIPWRL--ILSKPPVWALISCHFCHNWGTFILLTWMPTYYHQVLKFNL-MESGLL
GARP_ECOLI      ----------------------------------------------------------------------
GARP_ECO57      ----------------------------------------------------------------------
SEO1_YEAST      DDEIRLARKRLKENQTGKSDFETKVFDIKLWK--------------------------------------
PHT43_ORYSJ     ELDYITRQSGGERLRKVPP-FSKLLSKWPTWALISANAMHSWGYFVILSWMPVYFKTIYHVNLR-EAAWF
VHT1_YEAST      DEEIRIARARNKRNQ-------------------------------------------------------
YHJ1_SCHPO      ERLYTVDRVRRSNHSGIESKVIEALKDPVTWHVFCNQLSNNLAYQQNLLFTSLNVSDLNSTLVGVASAGY
PICO_DROME      EK--------------------------------------------------------------------
NPT3_BOVIN      EKEHIVSSLAQQSSSPRRSPIKSMVRCLPLWAIFMGFFSHFWLCTIIITYLPTYISSVLHVNIR-DSGVL
PICO_DROAN      KK--------------------------------------------------------------------
YKH4_CAEEL      EKEYLLANVVKKVHKSEKTR--------------------------------------------------
YYBO_BACSU      ELNYIQKHNAITTEQKTGPLLKKLFTNRKVWGLMIGFTGYGYTFNLLLTWLPTFFKHTYGMDL-MSSGLF
S17A5_SHEEP     EK--------------------------------------------------------------------
GUDP_PSEPU      ----------------------------------------------------------------------
PHT47_ORYSJ     LPKVSMPKVASREKIKAQAGGVVAPRTVKVWAIVVNNFTFHYALYVLMNWLPT-----------------
SPX2_DANRE      EEEPLLRNSSTNEENSHTSTAVEALRIPGVVEFSLCLLFAKLVSYTFLYWLPLYIA--------------
UHPC_ECOLI      EWRHDALEIAQQQEKEILTKY--VLLNPYIWLLSFCYVLVYVVRAAINDWGNLYMSETLGVDLVTANTAV
S17A4_HUMAN     EKRYIVCSLAQQDCSPGWSPIRAMIKSLPLWAILVSYFCEYWLFYTIMAYTPTYISSVLQANLR-DSGIL
EXUT_ECOLI      ERDYIINGQEAQHQVSTAKKMSQILRNRQFWGIAL-----------------------------------
EXUT_ECO57      ERDYIINGQEAQHQVSTAKKMSQILRNRQFWGIAL-----------------------------------
ANTR2_ARATH     EKKVILGGSKPREPVTVIPWKL-ILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVL--KFNLTESLL
VGLU3_HUMAN     EK--------------------------------------------------------------------
VGLU1_RAT       ESPALHPSISEEERKYIEDAIGESAK--------------------------------------------
VGLU1_MOUSE     ESPALHPSISEEERKYIEDAIGESAK--------------------------------------------
VGLU1_HUMAN     ESPALHPSISEEERKYIEDAIGESAK--------------------------------------------
VGLU1_BOVIN     ESPALHPSISEEERKYIEDAIGESAK--------------------------------------------
YRT3_CAEEL      EKKQVTEKIGDVAVKNMTLPWRDMMTSSAVWAIII-----------------------------------
YL055_YEAST     ERVWIIRRVGSSIEQKVKSQFREAMKDYITW---------------------------------------
VGLU3_RAT       ----------------------------------------------------------------------
UHPT_CHLPN      KEGKSASEGTEEIERELSTRFTYVLTNQWLWFLAFIYI-VRMAVWSALFLIETKHYA--AVKANFCVSLF
NPT3_HUMAN      EKEHILSSLAQQPSSPGRAVPIKAMVTCPLWAIFLGFFSHFWLCTIILTYLPTYISTLLHVNIR-DSGVL
VGLU1_XENLA     ER--------------------------------------------------------------------
QACA_STAAU      ----------------------------------------------------------------------
QACA_STAAM      ----------------------------------------------------------------------
VGLU3_MOUSE     ----------------------------------------------------------------------
VGLU3_DANRE     ERN-------------------------------------------------------------------
SPX2_BOVIN      ----------------------------------------------------------------------
SPNS1_XENTR     ----------------------------------------------------------------------
NPT3_MOUSE      EKEHITSSVAQQSSSPRRSVPIKAMRCLPLWAIFMGFFSHFWLCTIIITYLPTYISTVLHVNIR-DSGVL
S17A4_MOUSE     ERRYITCSLAQEDCSLGWSLPIKAMKSLPLWAIVVSYFCEYWLLSTVMAYTPTYISSVLQANLR-DSGIL
SPX2_MOUSE      ----------------------------------------------------------------------
SVOPL_HUMAN     ERVAKMNRSVMPEGKLVEADLLDAKYLRTTLQIWVIWLGISFAYYGVI----------------------
ANTR5_ARATH     XXXXXXLLPTNVNHHKVTHPWKKIMLSLPVWAIVVNNFTFHYALYVLMNWLPT-----------------
VGLU1_XENTR     ----------------------------------------------------------------------
VGL2A_DANRE     ER--------------------------------------------------------------------
NPT4_HUMAN      EKEYIISSLKQQGSSKQPLPIKAMLRSLPIWSICLGCFSHQWLVSTMVVYIPTYISSVYHVNIGLLSALP
VGLU2_BOVIN     ----------------------------------------------------------------------
VGLU2_RAT       ----------------------------------------------------------------------
VGLU2_MOUSE     ----------------------------------------------------------------------
VGLU2_HUMAN     ----------------------------------------------------------------------
VGL2B_DANRE     ----------------------------------------------------------------------
PHT44_ORYSJ     EKRYILG--GSTLKEPVTSPWKLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYNQVL--KFNLTESLL
SPX2_HUMAN      ----------------------------------------------------------------------
Y1317_METJA     ----------------------------------------------------------------------
SPNS1_XENLA     ----------------------------------------------------------------------
JEN1_YEAST      KARKLILSDAVKPKANFKQKMVSMKRTVQKYWLLFAYLVVLLVTHASQDLLPTMLRAQLGLSKD-AVTVI
YAAU_ECOLI      EMMIKLEPVAFDEEQPQQTRFRD-LFNRRHFPFVLFVAAIQVIPMFAIYTFGPQIVGLLGLGVGKNAALG
SVOPL_MOUSE     NTQAALNTLESEPILEKRGRFADLLDSRTTLQIWIIWLGISFAYYGVI----------------------
NEPI_ECO27      ----------------------------------------------------------------------
SPIN_DROME      ----------------------------------------------------------------------
GLPT_ECOLI      EKNDYPDDYNEKAEQELTAKMQYVLPNKLLWYIAIANVFVYLLRYGILDWSPT-----------------
NPT1_RAT        EKDYITSSLMQQHSGRQSLPIKAMLKSLPLWAIILNSFAFIWSNNLLVTYTPTFISTTLHVNVR-ENGLL
GLPT_BACSU      ERNDYPKHAFKNQEKELTTKFQYVLNNKFLWYIAFANVFVYFVRYGVVDWAPTYLTEAKG----------
S22A7_PONAB     ----------------------------------------------------------------------
S22A7_HUMAN     ----------------------------------------------------------------------
MUCK_ACIAD      QQSRLAPSKQTETVKTSAFKLIFQDKRNRLWALTAGFL--QFGYYGVNNWMPSYLESELGMKFEMTAYMV
Y1104_HAEIN     KQTALSTQSSFTDKLRSFQLLIKDKATSKI-SLGIVVLTSNFGYYGIMIWLPNFLSKQLGFSLT-KSGLW
UHPC_SALTY      ----------------------------------------------------------------------
NEPI_ECOUT      ----------------------------------------------------------------------
NEPI_ECOL6      ----------------------------------------------------------------------
NEPI_ECOL5      ----------------------------------------------------------------------
NEPI_ECOK1      ----------------------------------------------------------------------
GLPT_HAEIN      KWRNDYPDDYNEKENDLTAKVTYVLKNKLLWYIAIANVFVYLIRYGVLKWSPVYLSEVKHFNIKGTAWAY
EAT4_CAEEL      EKIFIEDAIGHVSNTHPTIRSIPIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIGLLAAIP
GLPT_HUMAN      ----------------------------------------------------------------------
ANTR4_ARATH     ELEYIKKQISTMENKRIST---------------------------------------------------
NEPI_SHISS      ----------------------------------------------------------------------
YMPB_CAEEL      NKTEKLKKYIKTANRMVIS---------------------------------------------------
S22AK_MOUSE     GK----AQQAVQNLQKV------AMMNGR-----------------------------------------
NEPI_ECO57      ----------------------------------------------------------------------
MOT1_RAT        SKESL-----------------------------------------------------------------
NEPI_SHIFL      ----------------------------------------------------------------------
NEPI_SHIF8      ----------------------------------------------------------------------
NEPI_SHIDS      ----------------------------------------------------------------------
NEPI_ECOLI      ----------------------------------------------------------------------
NEPI_ECOBW      ----------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
RCEM_CHLAA      AKYFVVLQIDPPSSRYGLS--FPPLNEGGWWLIATFFLTVSIFAWYMHIYTR---AKALGIKYGFTGAI-
NEPI_SHIBS      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
TSGA_SERP5      NKGADAGQPVVKEK----------------WGIGVLFLSIAALCYGFIQWVPEYATKSFGMDISQAGKLV
MDTG_SALAR      -------QPVSKKEMLHVREVVASLKNPRVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNIAFISGMI
ANTR6_ARATH     ----------------------------------------------------------------------
YHJX_ECOLI      TSNGVV-------EKDYT--LAESMRKPQYWMLAVMFLTACMSGLYVIGVAKDIAQSLAHLDVVSAANAV
SPX3_HUMAN      EENPLINGGENEDEYEPNYSIQDDSSVAQVKAISLAYACLKLVNYSFFFWLPFYLSNNFGWK--------
SPNS1_DANRE     ----------------------------------------------------------------------
SPX3_XENLA      ----------------------------------------------------------------------
MDTG_SALTY      ----------SKKEMLHVREVVASLKNPRVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNIAFISGMI
MDTG_SALTI      ----------SKKEMLHVREVVASLKNPRVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNIAFISGMI
MDTG_SALPK      ----------SKKEMLHVREVVASLKNPRVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNIAFISGMI
MDTG_SALPB      ----------SKKEMLHVREVVASLKNPRVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNIAFISGMI
MDTG_SALPA      ----------SKKEMLHVREVVASLKNPRVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNIAFISGMI
MDTG_SALNS      ----------SKKEMLHVREVVASLKNPRVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNIAFISGMI
MDTG_SALHS      ----------SKKEMLHVREVVASLKNPRVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNIAFISGMI
MDTG_SALEP      ----------SKKEMLHVREVVASLKNPRVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNIAFISGMI
MDTG_SALDC      ----------SKKEMLHVREVVASLKNPRVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNIAFISGMI
MDTG_SALCH      ----------SKKEMLHVREVVASLKNPRVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNIAFISGMI
MDTG_SALA4      ----------SKKEMLHVREVVASLKNPRVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNIAFISGMI
MDTG_ECOUT      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECOSE      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECOLI      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECOLC      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECOL6      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECOL5      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECOK1      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECODH      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECOBW      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECO8A      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECO81      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECO7I      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECO57      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECO55      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECO45      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECO27      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_ECO24      -------QPVSKKEMLHMREVVTSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNVAFISGMI
MDTG_CITK8      -------QPVSKKEMLHVREVVGSLKNPKVLSLFVTTLIIQVATGSIAPILTLYVRELAGSNIAFISGMI


                         .         *         .         .         .         .         +:350
query           TAVPWVAALLGTWLIPRYSDRTGDRRNXXXXXXXXXXXXXXXXXXXXPXXXXXXXXXXXXGFIAVQPVFW
YFAV_ECOLI      TAIPWVAALFGTWLIPRYSDKTGERRNVXXXXXXXXXXXXXXXXXXXPVMAIVALCVAAIGFIAVQPVFW
TUB4_AGRVI      NAVPGIFAVAAMVLWARHSDKTGERTHXXXXXXXXXXXXXXXTGATSVFTVLIALTLVNIGISCSKPPLW
TUB3_AGRVI      NAVPGIFAVVAMVLWARHSDRTGERTHVVXXXXXXXXXXXXXXXXTSVFMVLIALTIVNVGISCSKPPLW
PHT1_PSEPU      STVPYIVGAIAMILIARSSDIRLERR--------------------------------------------
YHDC_SCHPO      SVPVYALGGISVYVICLLSDRTNIR---------------------------------------------
YIQ6_YEAST      ----------------------------------------------------------------------
YIZG_SCHPO      QYMTIPVYILG-----------------------------------------------------------
THI73_YEAST     ----------------------------------------------------------------------
TNA1_YEAST      TVPIYFLTAIVFFICAVWSDR-------------------------------------------------
VHT1_SCHPO      NAPIWLADALGIVTVMPLYDR-------------------------------------------------
YJ7D_SCHPO      ----------------------------------------------------------------------
YC7A_SCHPO      ----------------------------------------------------------------------
YE1F_SCHPO      VAPIWV----------------------------------------------------------------
EXUT_BACSU      TVIPWILGFIG-----------------------------------------------------------
YAOI_SCHPO      TIPVYIAGVISFLFVAWLSDRT------------------------------------------------
YFZ4_SCHPO      TVAPAISGAI--WLL-------------------------------------------------------
GUDP_BACSU      ALCGFAGGVLG-----------------------------------------------------------
LIZ1_SCHPO      ----------------------------------------------------------------------
YJJL_ECOLI      AAIPFLFGAAG-----------------------------------------------------------
DGOT_ECOLI      TTVPFLAAFVGVLL--------------------------------------------------------
DGOT_ECOL6      TTVPFLAAFVGVLL--------------------------------------------------------
S17A5_MOUSE     YFGCWLCMIL------------------------------------------------------------
YGDF_SCHPO      TSSISFAALTLFGLIPEFTNRRMD----------------------------------------------
GUDP_ECOLI      AVCGFIGGVLGDWLMRR-----------------------------------------------------
YO162_YEAST     NFVLHILLLFGTWSTEKCNNRLG-----------------------------------------------
S17A5_HUMAN     ----------------------------------------------------------------------
YQD3_SCHPO      NTVSAIIATFAMYLIPNQS---------------------------------------------------
PHT42_ORYSJ     SAIPWAVMALSGYVAGASAD--------------------------------------------------
PHT41_ORYSJ     CVLPWVSANFGGWI--------------------------------------------------------
FEN2_YEAST      ----------------------------------------------------------------------
DAL5_YEAST      ----------------------------------------------------------------------
ANTR3_ARATH     SALPWATMAISGYYAGAASDRTG-----------------------------------------------
YLD2_CAEEL      ASIPYIAYFL------------------------------------------------------------
ANTR1_ARATH     SVFPWISANAGGWI--------------------------------------------------------
GARP_ECOLI      ----------------------------------------------------------------------
GARP_ECO57      ----------------------------------------------------------------------
SEO1_YEAST      ----------------------------------------------------------------------
PHT43_ORYSJ     SALPWVMMAVLGYVAGVVSDR-------------------------------------------------
VHT1_YEAST      ----------------------------------------------------------------------
YHJ1_SCHPO      NC---VSAIIATYMM-------------------------------------------------------
PICO_DROME      ----------------------------------------------------------------------
NPT3_BOVIN      SSLPFIAAASCTILGGQLAD--------------------------------------------------
PICO_DROAN      ----------------------------------------------------------------------
YKH4_CAEEL      ----------------------------------------------------------------------
YYBO_BACSU      TAVPWLISTIGGWLVDYFIKKTKVYRTVIIVGMSFGFFFLGSILTNNITVAIICISIGLAGISATAPVGW
S17A5_SHEEP     ----------------------------------------------------------------------
GUDP_PSEPU      ----------------------------------------------------------------------
PHT47_ORYSJ     ----------------------------------------------------------------------
SPX2_DANRE      ----------------------------------------------------------------------
UHPC_ECOLI      TMFEFIGALVAGW---------------------------------------------------------
S17A4_HUMAN     SALPFVVGCI------------------------------------------------------------
EXUT_ECOLI      ----------------------------------------------------------------------
EXUT_ECO57      ----------------------------------------------------------------------
ANTR2_ARATH     CVLPWVFANIGGWI--------------------------------------------------------
VGLU3_HUMAN     ----------------------------------------------------------------------
VGLU1_RAT       ----------------------------------------------------------------------
VGLU1_MOUSE     ----------------------------------------------------------------------
VGLU1_HUMAN     ----------------------------------------------------------------------
VGLU1_BOVIN     ----------------------------------------------------------------------
YRT3_CAEEL      ----------------------------------------------------------------------
YL055_YEAST     ----------------------------------------------------------------------
VGLU3_RAT       ----------------------------------------------------------------------
UHPT_CHLPN      EIGGLFGMLVAGWLSDKIS---------------------------------------------------
NPT3_HUMAN      SSLPFIAAASCTILGGQLAD--------------------------------------------------
VGLU1_XENLA     ----------------------------------------------------------------------
QACA_STAAU      ----------------------------------------------------------------------
QACA_STAAM      ----------------------------------------------------------------------
VGLU3_MOUSE     ----------------------------------------------------------------------
VGLU3_DANRE     ----------------------------------------------------------------------
SPX2_BOVIN      ----------------------------------------------------------------------
SPNS1_XENTR     ----------------------------------------------------------------------
NPT3_MOUSE      SSLPFIAA--------------------------------------------------------------
S17A4_MOUSE     SALPFM----------------------------------------------------------------
SPX2_MOUSE      ----------------------------------------------------------------------
SVOPL_HUMAN     ----------------------------------------------------------------------
ANTR5_ARATH     ----------------------------------------------------------------------
VGLU1_XENTR     ----------------------------------------------------------------------
VGL2A_DANRE     ----------------------------------------------------------------------
NPT4_HUMAN      FIVAWVIGMVGGYL--------------------------------------------------------
VGLU2_BOVIN     ----------------------------------------------------------------------
VGLU2_RAT       ----------------------------------------------------------------------
VGLU2_MOUSE     ----------------------------------------------------------------------
VGLU2_HUMAN     ----------------------------------------------------------------------
VGL2B_DANRE     ----------------------------------------------------------------------
PHT44_ORYSJ     CVLPWIFANIGGWI--------------------------------------------------------
SPX2_HUMAN      ----------------------------------------------------------------------
Y1317_METJA     ----------------------------------------------------------------------
SPNS1_XENLA     ----------------------------------------------------------------------
JEN1_YEAST      VVVTNIGAICGGMIFGQFMEVTGRR---------------------------------------------
YAAU_ECOLI      NVVISLFFMLG-----------------------------------------------------------
SVOPL_MOUSE     ----------------------------------------------------------------------
NEPI_ECO27      ----------------------------------------------------------------------
SPIN_DROME      ----------------------------------------------------------------------
GLPT_ECOLI      ----------------------------------------------------------------------
NPT1_RAT        SSLPYLLAYI------------------------------------------------------------
GLPT_BACSU      ----------------------------------------------------------------------
S22A7_PONAB     ----------------------------------------------------------------------
S22A7_HUMAN     ----------------------------------------------------------------------
MUCK_ACIAD      GT--YTAMILGKILAGFMADKLGRR---------------------------------------------
Y1104_HAEIN     TAVTVCGMMAGIWIFGQLADRIG-----------------------------------------------
UHPC_SALTY      ----------------------------------------------------------------------
NEPI_ECOUT      ----------------------------------------------------------------------
NEPI_ECOL6      ----------------------------------------------------------------------
NEPI_ECOL5      ----------------------------------------------------------------------
NEPI_ECOK1      ----------------------------------------------------------------------
GLPT_HAEIN      T-IYELAAVPGTLLCGWVSDK-------------------------------------------------
EAT4_CAEEL      HLVMGCVVLMG-----------------------------------------------------------
GLPT_HUMAN      ----------------------------------------------------------------------
ANTR4_ARATH     ----------------------------------------------------------------------
NEPI_SHISS      ----------------------------------------------------------------------
YMPB_CAEEL      ----------------------------------------------------------------------
S22AK_MOUSE     ----------------------------------------------------------------------
NEPI_ECO57      ----------------------------------------------------------------------
MOT1_RAT        ----------------------------------------------------------------------
NEPI_SHIFL      ----------------------------------------------------------------------
NEPI_SHIF8      ----------------------------------------------------------------------
NEPI_SHIDS      ----------------------------------------------------------------------
NEPI_ECOLI      ----------------------------------------------------------------------
NEPI_ECOBW      ----------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
RCEM_CHLAA      ----------------------------------------------------------------------
NEPI_SHIBS      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
TSGA_SERP5      SDF-WTSYMIGMWV--------------------------------------------------------
MDTG_SALAR      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
ANTR6_ARATH     ----------------------------------------------------------------------
YHJX_ECOLI      TVIS-IANLSGRLVLGILSDK-------------------------------------------------
SPX3_HUMAN      ----------------------------------------------------------------------
SPNS1_DANRE     ----------------------------------------------------------------------
SPX3_XENLA      ----------------------------------------------------------------------
MDTG_SALTY      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_SALTI      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_SALPK      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_SALPB      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_SALPA      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_SALNS      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_SALHS      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_SALEP      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_SALDC      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_SALCH      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_SALA4      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECOUT      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECOSE      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECOLI      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECOLC      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECOL6      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECOL5      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECOK1      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECODH      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECOBW      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECO8A      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECO81      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECO7I      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECO57      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECO55      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECO45      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECO27      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_ECO24      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------
MDTG_CITK8      ASVPGVAALLSAPRLGKLGDRIGPEK--------------------------------------------


                         .         .         .         .         *         .         .:420
query           TMPTQLLSGTALAAGIGFVNLFGAVGGFIAPILRVKAETLFASDAAGLLTLSGVAIIGSLIIFTLSVNRP
YFAV_ECOLI      TMPTQLLSGTALAAGIGFVNLFGAVGGFIAPILRVKAETLFASDXXXXXXXXXXXXIGSLIIFTLRVNRT
TUB4_AGRVI      SMPTLFLSGPAAAAGIATINSIGNLGGFVGPSMIGWIKDTTGSFAGGLYFVAGLLVVSAIVTLVLSRTAP
TUB3_AGRVI      SMPTMFLSGPAAAAGIATINSIGNLGGFVGP---------------------------------------
PHT1_PSEPU      ----------------------------------------------------------------------
YHDC_SCHPO      ----------------------------------------------------------------------
YIQ6_YEAST      ----------------------------------------------------------------------
YIZG_SCHPO      ----------------------------------------------------------------------
THI73_YEAST     ----------------------------------------------------------------------
TNA1_YEAST      ----------------------------------------------------------------------
VHT1_SCHPO      ----------------------------------------------------------------------
YJ7D_SCHPO      ----------------------------------------------------------------------
YC7A_SCHPO      ----------------------------------------------------------------------
YE1F_SCHPO      ----------------------------------------------------------------------
EXUT_BACSU      ----------------------------------------------------------------------
YAOI_SCHPO      ----------------------------------------------------------------------
YFZ4_SCHPO      ----------------------------------------------------------------------
GUDP_BACSU      ----------------------------------------------------------------------
LIZ1_SCHPO      ----------------------------------------------------------------------
YJJL_ECOLI      ----------------------------------------------------------------------
DGOT_ECOLI      ----------------------------------------------------------------------
DGOT_ECOL6      ----------------------------------------------------------------------
S17A5_MOUSE     ----------------------------------------------------------------------
YGDF_SCHPO      ----------------------------------------------------------------------
GUDP_ECOLI      ----------------------------------------------------------------------
YO162_YEAST     ----------------------------------------------------------------------
S17A5_HUMAN     ----------------------------------------------------------------------
YQD3_SCHPO      ----------------------------------------------------------------------
PHT42_ORYSJ     ----------------------------------------------------------------------
PHT41_ORYSJ     ----------------------------------------------------------------------
FEN2_YEAST      ----------------------------------------------------------------------
DAL5_YEAST      ----------------------------------------------------------------------
ANTR3_ARATH     ----------------------------------------------------------------------
YLD2_CAEEL      ----------------------------------------------------------------------
ANTR1_ARATH     ----------------------------------------------------------------------
GARP_ECOLI      ----------------------------------------------------------------------
GARP_ECO57      ----------------------------------------------------------------------
SEO1_YEAST      ----------------------------------------------------------------------
PHT43_ORYSJ     ----------------------------------------------------------------------
VHT1_YEAST      ----------------------------------------------------------------------
YHJ1_SCHPO      ----------------------------------------------------------------------
PICO_DROME      ----------------------------------------------------------------------
NPT3_BOVIN      ----------------------------------------------------------------------
PICO_DROAN      ----------------------------------------------------------------------
YKH4_CAEEL      ----------------------------------------------------------------------
YYBO_BACSU      SISAELAPIGSVSMLSSMVNLANNLGGIIAASL-----TGYLFDVTGSFTLS------------------
S17A5_SHEEP     ----------------------------------------------------------------------
GUDP_PSEPU      ----------------------------------------------------------------------
PHT47_ORYSJ     ----------------------------------------------------------------------
SPX2_DANRE      ----------------------------------------------------------------------
UHPC_ECOLI      ----------------------------------------------------------------------
S17A4_HUMAN     ----------------------------------------------------------------------
EXUT_ECOLI      ----------------------------------------------------------------------
EXUT_ECO57      ----------------------------------------------------------------------
ANTR2_ARATH     ----------------------------------------------------------------------
VGLU3_HUMAN     ----------------------------------------------------------------------
VGLU1_RAT       ----------------------------------------------------------------------
VGLU1_MOUSE     ----------------------------------------------------------------------
VGLU1_HUMAN     ----------------------------------------------------------------------
VGLU1_BOVIN     ----------------------------------------------------------------------
YRT3_CAEEL      ----------------------------------------------------------------------
YL055_YEAST     ----------------------------------------------------------------------
VGLU3_RAT       ----------------------------------------------------------------------
UHPT_CHLPN      ----------------------------------------------------------------------
NPT3_HUMAN      ----------------------------------------------------------------------
VGLU1_XENLA     ----------------------------------------------------------------------
QACA_STAAU      ----------------------------------------------------------------------
QACA_STAAM      ----------------------------------------------------------------------
VGLU3_MOUSE     ----------------------------------------------------------------------
VGLU3_DANRE     ----------------------------------------------------------------------
SPX2_BOVIN      ----------------------------------------------------------------------
SPNS1_XENTR     ----------------------------------------------------------------------
NPT3_MOUSE      ----------------------------------------------------------------------
S17A4_MOUSE     ----------------------------------------------------------------------
SPX2_MOUSE      ----------------------------------------------------------------------
SVOPL_HUMAN     ----------------------------------------------------------------------
ANTR5_ARATH     ----------------------------------------------------------------------
VGLU1_XENTR     ----------------------------------------------------------------------
VGL2A_DANRE     ----------------------------------------------------------------------
NPT4_HUMAN      ----------------------------------------------------------------------
VGLU2_BOVIN     ----------------------------------------------------------------------
VGLU2_RAT       ----------------------------------------------------------------------
VGLU2_MOUSE     ----------------------------------------------------------------------
VGLU2_HUMAN     ----------------------------------------------------------------------
VGL2B_DANRE     ----------------------------------------------------------------------
PHT44_ORYSJ     ----------------------------------------------------------------------
SPX2_HUMAN      ----------------------------------------------------------------------
Y1317_METJA     ----------------------------------------------------------------------
SPNS1_XENLA     ----------------------------------------------------------------------
JEN1_YEAST      ----------------------------------------------------------------------
YAAU_ECOLI      ----------------------------------------------------------------------
SVOPL_MOUSE     ----------------------------------------------------------------------
NEPI_ECO27      ----------------------------------------------------------------------
SPIN_DROME      ----------------------------------------------------------------------
GLPT_ECOLI      ----------------------------------------------------------------------
NPT1_RAT        ----------------------------------------------------------------------
GLPT_BACSU      ----------------------------------------------------------------------
S22A7_PONAB     ----------------------------------------------------------------------
S22A7_HUMAN     ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
Y1104_HAEIN     ----------------------------------------------------------------------
UHPC_SALTY      ----------------------------------------------------------------------
NEPI_ECOUT      ----------------------------------------------------------------------
NEPI_ECOL6      ----------------------------------------------------------------------
NEPI_ECOL5      ----------------------------------------------------------------------
NEPI_ECOK1      ----------------------------------------------------------------------
GLPT_HAEIN      ----------------------------------------------------------------------
EAT4_CAEEL      ----------------------------------------------------------------------
GLPT_HUMAN      ----------------------------------------------------------------------
ANTR4_ARATH     ----------------------------------------------------------------------
NEPI_SHISS      ----------------------------------------------------------------------
YMPB_CAEEL      ----------------------------------------------------------------------
S22AK_MOUSE     ----------------------------------------------------------------------
NEPI_ECO57      ----------------------------------------------------------------------
MOT1_RAT        ----------------------------------------------------------------------
NEPI_SHIFL      ----------------------------------------------------------------------
NEPI_SHIF8      ----------------------------------------------------------------------
NEPI_SHIDS      ----------------------------------------------------------------------
NEPI_ECOLI      ----------------------------------------------------------------------
NEPI_ECOBW      ----------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
RCEM_CHLAA      ----------------------------------------------------------------------
NEPI_SHIBS      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
TSGA_SERP5      ----------------------------------------------------------------------
MDTG_SALAR      ----------------------------------------------------------------------
ANTR6_ARATH     ----------------------------------------------------------------------
YHJX_ECOLI      ----------------------------------------------------------------------
SPX3_HUMAN      ----------------------------------------------------------------------
SPNS1_DANRE     ----------------------------------------------------------------------
SPX3_XENLA      ----------------------------------------------------------------------
MDTG_SALTY      ----------------------------------------------------------------------
MDTG_SALTI      ----------------------------------------------------------------------
MDTG_SALPK      ----------------------------------------------------------------------
MDTG_SALPB      ----------------------------------------------------------------------
MDTG_SALPA      ----------------------------------------------------------------------
MDTG_SALNS      ----------------------------------------------------------------------
MDTG_SALHS      ----------------------------------------------------------------------
MDTG_SALEP      ----------------------------------------------------------------------
MDTG_SALDC      ----------------------------------------------------------------------
MDTG_SALCH      ----------------------------------------------------------------------
MDTG_SALA4      ----------------------------------------------------------------------
MDTG_ECOUT      ----------------------------------------------------------------------
MDTG_ECOSE      ----------------------------------------------------------------------
MDTG_ECOLI      ----------------------------------------------------------------------
MDTG_ECOLC      ----------------------------------------------------------------------
MDTG_ECOL6      ----------------------------------------------------------------------
MDTG_ECOL5      ----------------------------------------------------------------------
MDTG_ECOK1      ----------------------------------------------------------------------
MDTG_ECODH      ----------------------------------------------------------------------
MDTG_ECOBW      ----------------------------------------------------------------------
MDTG_ECO8A      ----------------------------------------------------------------------
MDTG_ECO81      ----------------------------------------------------------------------
MDTG_ECO7I      ----------------------------------------------------------------------
MDTG_ECO57      ----------------------------------------------------------------------
MDTG_ECO55      ----------------------------------------------------------------------
MDTG_ECO45      ----------------------------------------------------------------------
MDTG_ECO27      ----------------------------------------------------------------------
MDTG_ECO24      ----------------------------------------------------------------------
MDTG_CITK8      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VAQSGAAHH
YFAV_ECOLI      VAQTDVAHH
TUB4_AGRVI      ---------
TUB3_AGRVI      ---------
PHT1_PSEPU      ---------
YHDC_SCHPO      ---------
YIQ6_YEAST      ---------
YIZG_SCHPO      ---------
THI73_YEAST     ---------
TNA1_YEAST      ---------
VHT1_SCHPO      ---------
YJ7D_SCHPO      ---------
YC7A_SCHPO      ---------
YE1F_SCHPO      ---------
EXUT_BACSU      ---------
YAOI_SCHPO      ---------
YFZ4_SCHPO      ---------
GUDP_BACSU      ---------
LIZ1_SCHPO      ---------
YJJL_ECOLI      ---------
DGOT_ECOLI      ---------
DGOT_ECOL6      ---------
S17A5_MOUSE     ---------
YGDF_SCHPO      ---------
GUDP_ECOLI      ---------
YO162_YEAST     ---------
S17A5_HUMAN     ---------
YQD3_SCHPO      ---------
PHT42_ORYSJ     ---------
PHT41_ORYSJ     ---------
FEN2_YEAST      ---------
DAL5_YEAST      ---------
ANTR3_ARATH     ---------
YLD2_CAEEL      ---------
ANTR1_ARATH     ---------
GARP_ECOLI      ---------
GARP_ECO57      ---------
SEO1_YEAST      ---------
PHT43_ORYSJ     ---------
VHT1_YEAST      ---------
YHJ1_SCHPO      ---------
PICO_DROME      ---------
NPT3_BOVIN      ---------
PICO_DROAN      ---------
YKH4_CAEEL      ---------
YYBO_BACSU      ---------
S17A5_SHEEP     ---------
GUDP_PSEPU      ---------
PHT47_ORYSJ     ---------
SPX2_DANRE      ---------
UHPC_ECOLI      ---------
S17A4_HUMAN     ---------
EXUT_ECOLI      ---------
EXUT_ECO57      ---------
ANTR2_ARATH     ---------
VGLU3_HUMAN     ---------
VGLU1_RAT       ---------
VGLU1_MOUSE     ---------
VGLU1_HUMAN     ---------
VGLU1_BOVIN     ---------
YRT3_CAEEL      ---------
YL055_YEAST     ---------
VGLU3_RAT       ---------
UHPT_CHLPN      ---------
NPT3_HUMAN      ---------
VGLU1_XENLA     ---------
QACA_STAAU      ---------
QACA_STAAM      ---------
VGLU3_MOUSE     ---------
VGLU3_DANRE     ---------
SPX2_BOVIN      ---------
SPNS1_XENTR     ---------
NPT3_MOUSE      ---------
S17A4_MOUSE     ---------
SPX2_MOUSE      ---------
SVOPL_HUMAN     ---------
ANTR5_ARATH     ---------
VGLU1_XENTR     ---------
VGL2A_DANRE     ---------
NPT4_HUMAN      ---------
VGLU2_BOVIN     ---------
VGLU2_RAT       ---------
VGLU2_MOUSE     ---------
VGLU2_HUMAN     ---------
VGL2B_DANRE     ---------
PHT44_ORYSJ     ---------
SPX2_HUMAN      ---------
Y1317_METJA     ---------
SPNS1_XENLA     ---------
JEN1_YEAST      ---------
YAAU_ECOLI      ---------
SVOPL_MOUSE     ---------
NEPI_ECO27      ---------
SPIN_DROME      ---------
GLPT_ECOLI      ---------
NPT1_RAT        ---------
GLPT_BACSU      ---------
S22A7_PONAB     ---------
S22A7_HUMAN     ---------
MUCK_ACIAD      ---------
Y1104_HAEIN     ---------
UHPC_SALTY      ---------
NEPI_ECOUT      ---------
NEPI_ECOL6      ---------
NEPI_ECOL5      ---------
NEPI_ECOK1      ---------
GLPT_HAEIN      ---------
EAT4_CAEEL      ---------
GLPT_HUMAN      ---------
ANTR4_ARATH     ---------
NEPI_SHISS      ---------
YMPB_CAEEL      ---------
S22AK_MOUSE     ---------
NEPI_ECO57      ---------
MOT1_RAT        ---------
NEPI_SHIFL      ---------
NEPI_SHIF8      ---------
NEPI_SHIDS      ---------
NEPI_ECOLI      ---------
NEPI_ECOBW      ---------
YHCA_BACSU      ---------
RCEM_CHLAA      ---------
NEPI_SHIBS      ---------
YYBF_BACSU      ---------
TSGA_SERP5      ---------
MDTG_SALAR      ---------
ANTR6_ARATH     ---------
YHJX_ECOLI      ---------
SPX3_HUMAN      ---------
SPNS1_DANRE     ---------
SPX3_XENLA      ---------
MDTG_SALTY      ---------
MDTG_SALTI      ---------
MDTG_SALPK      ---------
MDTG_SALPB      ---------
MDTG_SALPA      ---------
MDTG_SALNS      ---------
MDTG_SALHS      ---------
MDTG_SALEP      ---------
MDTG_SALDC      ---------
MDTG_SALCH      ---------
MDTG_SALA4      ---------
MDTG_ECOUT      ---------
MDTG_ECOSE      ---------
MDTG_ECOLI      ---------
MDTG_ECOLC      ---------
MDTG_ECOL6      ---------
MDTG_ECOL5      ---------
MDTG_ECOK1      ---------
MDTG_ECODH      ---------
MDTG_ECOBW      ---------
MDTG_ECO8A      ---------
MDTG_ECO81      ---------
MDTG_ECO7I      ---------
MDTG_ECO57      ---------
MDTG_ECO55      ---------
MDTG_ECO45      ---------
MDTG_ECO27      ---------
MDTG_ECO24      ---------
MDTG_CITK8      ---------