[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF68340.1

[Show Plain Result]


## Summary of Sequence Search
    1::172
    1::176     1e-25  41%  176 aa  FIMF_ECOLI RecName: Full=Protein fimF;Flags: Precursor;
   30::179     8e-23  39%  179 aa  FIMI_ECOLI RecName: Full=Fimbrin-like protein fimI;Flags:
   26::178     3e-21  35%  178 aa  LPFA_SALTY RecName: Full=Long polar fimbria protein A;Flags:
   22::171     4e-20  37%  171 aa  YCBV_ECOLI RecName: Full=Uncharacterized fimbrial-like protein
    5::176     3e-19  34%  176 aa  YDES_ECOLI RecName: Full=Uncharacterized fimbrial-like protein
   17::175     1e-18  31%  175 aa  SFAG_ECOL5 RecName: Full=S-fimbrial adhesin protein sfaG;Flags:
   13::185     6e-18  33%  185 aa  FIMA1_SALTY RecName: Full=Type-1 fimbrial protein, A chain;AltName:
   33::185     1e-16  33%  185 aa  FIM11_SALTY RecName: Full=Fimbrial subunit type 1;Flags: Precursor;
   28::180     1e-15  36%  180 aa  SFMA_ECOLI RecName: Full=Sfm fimbrial protein, A chain;AltName:
   28::180     1e-15  36%  180 aa  SFMA_ECO57 RecName: Full=Sfm fimbrial protein, A chain;AltName:
   16::180     2e-14  34%  180 aa  FIM1C_ECOLX RecName: Full=Type-1 fimbrial protein, C chain;AltName:
   16::180     2e-14  34%  180 aa  FIM1C_ECOL6 RecName: Full=Type-1 fimbrial protein, C chain;AltName:
   16::181     2e-14  29%  181 aa  SFAA_ECOL5 RecName: Full=S-fimbrial protein subunit;AltName:
    6::171     9e-14  28%  172 aa  FIMF_SALTY RecName: Full=Fimbrial-like protein fimF;Flags:
    9::183     4e-13  31%  183 aa  YGIL_ECOLI RecName: Full=Uncharacterized fimbrial-like protein
   13::162     4e-13  32%  184 aa  FIMA1_SALTI RecName: Full=Type-1 fimbrial protein, A chain;AltName:
   12::174     6e-13  36%  174 aa  FMA_SERMA RecName: Full=Fimbria A protein;Flags: Precursor;
   21::180     1e-12  31%  180 aa  FMF3_ECOLX RecName: Full=F17 fimbrial protein;AltName: Full=F17
   26::175     1e-11  35%  175 aa  MRPA_PROMH RecName: Full=Major MR/P fimbria protein;Flags:
   25::166     2e-11  31%  167 aa  FIMG_ECOLI RecName: Full=Protein fimG;Flags: Precursor;
   29::170     2e-11  30%  171 aa  SFMF_ECOLI RecName: Full=Fimbrial-like protein sfmF;Flags:
   19::176     3e-11  27%  177 aa  FIMI_SALTY RecName: Full=Fimbrin-like protein fimI;Flags:
   19::176     1e-10  26%  177 aa  FIMI_SALTI RecName: Full=Putative fimbrin-like protein fimI;Flags:
   15::188     3e-10  28%  188 aa  YBGD_ECOLI RecName: Full=Uncharacterized fimbrial-like protein
   22::180     5e-10  32%  180 aa  FIMA1_SERMA RecName: Full=Type-1 fimbrial protein subunit;Flags:
   17::162     6e-10  32%  163 aa  SFAS_ECOL5 RecName: Full=S-fimbrial adhesin protein sfaS;Flags:
  194::343     1e-09  31%  343 aa  F17GG_ECOLX RecName: Full=F17g-G fimbrial adhesin;AltName: Full=G
  194::343     1e-09  31%  343 aa  F17FG_ECOLX RecName: Full=F17f-G fimbrial adhesin;Flags: Precursor;
  194::343     1e-09  31%  343 aa  F17EG_ECOLX RecName: Full=F17e-G fimbrial adhesin;Flags: Precursor;
  195::344     1e-09  31%  344 aa  F17DG_ECOLX RecName: Full=F17d-G fimbrial adhesin;Flags: Precursor;
  194::343     1e-09  31%  343 aa  F17CG_ECOLX RecName: Full=F17c-G fimbrial adhesin;AltName:
  194::343     1e-09  31%  343 aa  F17BG_ECOLX RecName: Full=F17b-G fimbrial adhesin;Flags: Precursor;
  195::344     1e-09  31%  344 aa  F17AG_ECOLX RecName: Full=F17a-G fimbrial adhesin;Flags: Precursor;
   18::177     4e-09  31%  178 aa  PAPK_ECOLX RecName: Full=Fimbrial adapter papK;Flags: Precursor;
   18::177     4e-09  31%  178 aa  PAPK_ECOL6 RecName: Full=Fimbrial adapter papK;Flags: Precursor;
   10::178     5e-09  29%  179 aa  YCBQ_ECOLI RecName: Full=Uncharacterized fimbrial-like protein
   38::147     5e-09  26%  194 aa  FM98_ECOLX RecName: Full=Fimbrial protein 987P;AltName:
   60::157     7e-09  32%  205 aa  HIFD2_HAEIN RecName: Full=Minor fimbrial subunit hifD;Flags:
   31::157     9e-09  32%  180 aa  YCBU_ECOLI RecName: Full=Uncharacterized fimbrial-like protein
   18::185     1e-08  30%  185 aa  PAPA_ECOLX RecName: Full=Pap fimbrial major pilin protein;       
   14::182     1e-08  27%  182 aa  PMFF_PROMH RecName: Full=Putative minor fimbrial subunit
   31::160     4e-08  31%  182 aa  FM11_KLEPN RecName: Full=Fimbrial subunit type 1;Flags: Precursor;
   18::176     6e-08  32%  177 aa  PRSK_ECOLX RecName: Full=Protein prsK;Flags: Precursor;
    1::213     7e-08  30%  213 aa  HIFA4_HAEIN RecName: Full=Major fimbrial subunit;AltName:
    1::213     7e-08  30%  213 aa  HIFA2_HAEIN RecName: Full=Major fimbrial subunit;AltName:
   47::160     9e-08  31%  216 aa  HIFD1_HAEIN RecName: Full=Minor fimbrial subunit hifD;Flags:
   16::167     1e-07  25%  167 aa  YDER_ECOLI RecName: Full=Uncharacterized fimbrial-like protein
    1::137     1e-07  29%  211 aa  HIFA5_HAEIN RecName: Full=Major fimbrial subunit;AltName:
   12::184     5e-07  26%  184 aa  PMFA_PROMH RecName: Full=Major fimbrial subunit;Flags: Precursor;
   16::178     6e-07  27%  179 aa  YFCP_ECOLI RecName: Full=Uncharacterized fimbrial-like protein
   27::193     8e-07  31%  194 aa  YRAH_ECOLI RecName: Full=Uncharacterized fimbrial-like protein
  172::321     8e-07  27%  321 aa  MRKD_KLEPN RecName: Full=Fimbria adhesin protein;Flags: Precursor;
   21::188     2e-06  31%  188 aa  FMF2_ECOLX RecName: Full=F7-2 fimbrial protein;AltName: Full=F7-2
   21::188     2e-06  31%  188 aa  FMF2_ECOL6 RecName: Full=F7-2 fimbrial protein;AltName: Full=F7-2
   12::175     3e-06  28%  175 aa  LPFE_SALTY RecName: Full=Protein lpfE;Flags: Precursor;
   21::187     5e-06  27%  187 aa  FMK1_ECOLX RecName: Full=KS71A fimbrillin;AltName: Full=P-fimbrial
    2::161     9e-06  28%  161 aa  PRSA_ECOLX RecName: Full=PRS fimbrial major pilin protein;       
   28::216     1e-05  31%  216 aa  HIFA1_HAEIN RecName: Full=Major fimbrial subunit;AltName:
   13::121     4e-05  32%  204 aa  FM3_BORPE RecName: Full=Serotype 3 fimbrial subunit;Flags:
  212::300     2e-04  36%  300 aa  FIMH_ECOLI RecName: Full=Protein fimH;Flags: Precursor;
   13::97      3e-04  29%  530 aa  GP2_RAT RecName: Full=Pancreatic secretory granule membrane major
   36::186     6e-04  25%  187 aa  YFCV_ECOLI RecName: Full=Uncharacterized fimbrial-like protein
  199::253     8e-04  35%  381 aa  NIFV_KLEPN RecName: Full=Homocitrate synthase;         EC=2.3.3.14;
    1::172

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRNDILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFA
FIMF_ECOLI      MRNKPFYLLCLWLAVSHALAADSTITIRGYVRDNGCSVAAESTNFTVDLMENAAKQFNNIGATTPVVPFR
FIMI_ECOLI      ----------------------GNMQFQGVIIAETCRIEAGDKQMTVNMGQISSNRFHAVGEDSAPVPFV
LPFA_SALTY      ------------------ESGDGTIKFTGEIVDAPCVVSTDSQNQEVVLGQVKKNIFKAIGDKSSSKPFQ
YCBV_ECOLI      -------------------AHDGTVNISGSFRRNTCVLAQDSKQINVQLGDVSLTRFSHGNYGPE-KSFI
YDES_ECOLI      --NIIFLGLCLGLTTYSALSADSVIKISGRVLDYGCTVSSDSLNFTVDLQKNSARQFPTTGSTSPAVPFQ
SFAG_ECOL5      ---------GSMFVTCHVCAAGSVVNITGNVQDNTCDVDINSRNFDVSLGSYDSRQFTAAGDTTPASVFH
FIMA1_SALTY     ----LMFVAGAAVAATPVSVSGGTIHFEGKLVNAACAVSTKSADQTVTLGQYRTASFTAIGNTTAQVPFS
FIM11_SALTY     ----------------------GTIHFEGKLVNAACAVSTKSADQTVTLGQYRTASFTAIGNTTAQVPFS
SFMA_ECOLI      ----------------------GTIHFEGELVNAACSVNTDSADQVVTLGQYRTDIFNAVGNTSALIPFT
SFMA_ECO57      ----------------------GTIHFEGELVNAACSVNTDSADQVVTLGQYRTDIFNAVGNTSALIPFT
FIM1C_ECOLX     --------LGVATNASAVTTNGGTVHFKGEVVNAACAVNTNSFDQTVNLGQVRSERLKVDGAKSNPVGFT
FIM1C_ECOL6     --------LGVATNASAVTTNGGTVHFKGEVVNAACAVNTNSFDQTVNLGQVRSERLKVDGAKSNPVGFT
SFAA_ECOL5      --------LGVATNASAVTTNGGTVHFKGEVVDAACAVNTNSANQTVLLGQVRSAKLANDGEKSSPVGFS
FIMF_SALTY      ----VFIAIGCVLFSPLSQANSSNIELRGNVVDFTCAVVAGDSNKSVNLGTWPTKQLHAAGDATQPVAFS
YGIL_ECOLI      ----LVAGVAMILS-NNVFADEGHVKFKGEVISAPCSIKPGDEDLTVNLGEVAD-TVLKSDQKSLAEPFT
FIMA1_SALTI     ----LMFVAGAAVAATPVSVSGGTIHFEGKLVYAACAVSTKSADQTVTLGQYRTASFTAIGDTTAQVPFS
FMA_SERMA       ----LAFGVSSLANAAD-QGH-GKVTFTGSIIDAPCSIAPESADQTVEMGQISNVAL-KNGGKSAPRQFD
FMF3_ECOLX      -------------------AYDGKITFNGKVVDQTCSVTTESKNLTVKLPTVSANSLASSGKVVGLTPFT
MRPA_PROMH      ------------------QGH-GTVKFVGSIIDAPCSITPDTENQTVPLGQISTAAL-KDGGRSNSRDFK
FIMG_ECOLI      ---------------------DVTITVNGKVVAKPCTVS--TTNATVDLGDLYSFSLMSAGAASAWHDVA
SFMF_ECOLI      ------------------------INLHGNVVDFSCTVNTADIDKTVDLGRWPTTQLLNAGDTTALVPFS
FIMI_SALTY      --------------AQPVMVESGRVHLRGQLVNGGCAVATESQNLRVLMGQYRTNAFTGPGSAPVSVPFS
FIMI_SALTI      --------------AQPVMVESGRVHLRGQLVNGGCAVATESQDLRVLMGQYRTNAFTGPGSAPVSVPFS
YBGD_ECOLI      -----------LLFTAPVYAADGEIHFKGEVIEAPCEIHPEDIDKNIDLGQVTTTHINREHHSNK---VA
FIMA1_SERMA     -------------------AANGTVKFTGEIKQSTCQVTSDTQNKEVYLGTYPTSAFPTVGSKSASKAFQ
SFAS_ECOL5      --------------AFSAQAVDTTITVTGNVLQRTCNV-PG--NVDVSLGNLYVSDFPNAGSGSPWVNFD
F17GG_ECOLX     -----------------------------TLNDTVTSLTPSA--VNVSLAAISAGQLPSSGDEVVAGTTS
F17FG_ECOLX     -----------------------------TLNDTVTSLTPSA--VNVSLAAISAGQLPSSGDEVVAGTTS
F17EG_ECOLX     -----------------------------TLNDTVTSLTPSA--VNVSLAAISAGQLPSSGDEVVAGTTS
F17DG_ECOLX     -----------------------------TLNDTVTSLTPSA--VNVSLAAISAGQLPSSGDEVVAGTTS
F17CG_ECOLX     -----------------------------TLNDTVTSLTPSA--VNVSLAAISAGQLPSSGDEVVAGTTS
F17BG_ECOLX     -----------------------------TLNDTVTSLTPSA--VNVSLAAISAGQLPSSGDEVVAGTTS
F17AG_ECOLX     -----------------------------TLNDTVTSLTPSA--VNVSLAAISAGQLPSSGDEVVAGTTS
PAPK_ECOLX      ------------------QAIASDVAFRGNLLDRPCHVSGDSLNKHVVFKTRASRDFWYPPGRSPTESFV
PAPK_ECOL6      ------------------QAIASDVAFRGNLLDRPCHVSGDSLNKHVVFKTRASRDFWYPPGRSPTESFV
YCBQ_ECOLI      --------ITVVCATSSVMAADDNAITDGSVTFNACTLVAATKDSVVTLPDVSATKLQTNGQVSGVQDVP
FM98_ECOLX      ---------------------------TGKVTASLCQVDTSNLSQTIDLGELSTSALKATGKGPA-KSFA
HIFD2_HAEIN     -------------------AYDGRVTFQGEISDGTCKIETDSQNRTVTLPTVGKANLSHAGQTAAPVPFS
YCBU_ECOLI      ------------------------MHIYGNVVDQGCDVATKSALQNIHIGDFNISDFQAANTVSTAADLN
PAPA_ECOLX      ---------GVNNAAPTIPQGQGKVTFNGTVVDAPCSISQKSADQSIDFGQLS-KSFLEAGGVSKPMDLD
PMFF_PROMH      ----------LLLSPSTFAATDGEMEFKGVVVAHGCTIVAGDENKVIDFKQISAKDLYSLQKSNP-VAFS
FM11_KLEPN      ----------------------GTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLKQAGANSSAVVFN
PRSK_ECOLX      ------------------QAMASDVAFRGNLLDRPCHVSGDSLNKHVVFKTRASRDFWYPPGRSPTESFV
HIFA4_HAEIN     MKKTLLGSLILLAFAGNVQADSGKVTFFGKVVENTCKVKTEHKNLSVVLNDVGKNSLSTKVNTAMPTPFT
HIFA2_HAEIN     MKKTLLGSLILLAFAGNVQADSGKVTFFGKVVENTCKVKTEHKNLSVVLNDVGKNSLSTKVNTAMPTPFT
HIFD1_HAEIN     ------------IVALPAYAVDGRVTFQGEISDGTCKIETDSKNRTVTLPTVGKANLSLAGQTAAPVPFS
YDER_ECOLI      ------------LFTATLQAADVTITVNGRVVAKPCTIQTKEANVN--LGDLYTRNLQQPGSASGWHNIT
HIFA5_HAEIN     MKKTLLGSLILLAFAGNVQAADGKVTFYGKVVENTCKVKSGNRDMSVVLNDVGKAHLSQKGYTAMPTPFT
PMFA_PROMH      ----LVFGINSVATAENVSSTKGEIQLKGEIVNSACGLAASSSPVIVDFSEIALANLQKAGNIKK----D
YFCP_ECOLI      ---------GLILAMSSTLAADNNLHFSGNLLSKSCALVVDGQYLAEVRFPTVSRQDLNVAGQSARVPVV
YRAH_ECOLI      ------------------------IVFDGEILKSACEINDSDKKIEVALGHYNAEQFRNIGERSPKIPFT
MRKD_KLEPN      -----------------------------TIVSPSCTIL-GGKNMNVDIGTIKRADLKGVGTWAGGTPFD
FMF2_ECOLX      -------------AAPTIPQGQGKVTFNGTVVDAPCGIDAQSADQSIDFGQVS--KLFLENDGES-QPFD
FMF2_ECOL6      -------------AAPTIPQGQGKVTFNGTVVDAPCGIDAQSADQSIDFGQVS--KLFLENDGES-QPFD
LPFE_SALTY      ----------LLLTASAMAAPSGDIHFTITIKAATCELE--NDSIDVNMETVVLQRPVKVGKELNQKNFS
FMK1_ECOLX      -------------AAASIPQGQGEVSFKGTVVDAPCGIETQSAKQEIDFGQIS-KSFLQEGGETQPKDLN
PRSA_ECOLX      --------------ANAAPQGQGKVTFNGTVVDAPCGIDAQSADQSIEFGQVS-KVLLNNGGSSTPKNFD
HIFA1_HAEIN     ----------------------GTVTFFGKVVENTCQVKTDHKNRSVVLNDVGKNSLKDKGNTAMPTPFT
FM3_BORPE       ----------LILAASPVLANDGTIVITGSISDQTCVIEEPS-TLNVQLPKISKNALRNDGDTAGATPFD
FIMH_ECOLI      ----------------------------------------------------------------------
GP2_RAT         ----------------------------------------------------------------------
YFCV_ECOLI      ----------------------------GTIEDSVCSIVPDDHKLEVDMGDIGAEKLKNNGTTTP-KNFQ
NIFV_KLEPN      ----------------------------GMATANTAAVSAGATSVNTTVLGLGER----AGNAAAWKPSA


                         .         .         *         .         .         .         .:140
query           IDLQNCGSTASGVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQAS
FIMF_ECOLI      ILLSPCGNAVSAVKVGFTGVADSHNANLLALENTVSAASGLGIQLLNEQQNQIPLNAPSSALTLTPGKPN
FIMI_ECOLI      IHLRECSTVVSRVGVAFHGVADGKNPDVLSVGEGPGIATNIGVALFDDEGNLVPINRPANWKRLYSGSTS
LPFA_SALTY      IKLEDCDITSTKVNVSFNGVGDTDDATLVSVNTEAGAATGVGIGIYDNANKLVEMNTGKSTTTLAAGQTV
YCBV_ECOLI      INLQDCGTDVSTVDVTFSGTPDGVQSEMLSIESGTDAASGXXXXXXXXXXXXXXXNQASKDYSLHSGKVP
YDES_ECOLI      ITLSECSKGTTGVRVAFNGIEDAENNTLLKLDEGSNTASGLGIEILDANMRPVKLNDGMQWIPLVPEQNN
SFAG_ECOL5      VGLTSCGSAVRAVKLTFTGTPDNQEAGLIQINS-INGARGVGIQLLDKDKHELKINVPT-TIALMPGTQT
FIMA1_SALTY     IVLNDCDKVAANAAVAFSGQADNTNPNLLAVSSADNSTTATGVGIEILDNTSSPL--KPDGATFSAKQSL
FIM11_SALTY     IVLNDCDKVAATAAVAFSGQADNTTPNLLAVSSADNSTTATGVGIEILDNTSSPL--KPDGATFSAKQSL
SFMA_ECOLI      IQLNDCDPVAANAAVAFSGQADAINDNLLAIXXXXXXXXGVGIEILDNTSAILPDGNSSTNQNLIPGTNV
SFMA_ECO57      IQLNDCDPVAANAAVAFSGQADAINDNLLAIXXXXXXXXGVGIEILDNTSAILPDGNSSTNQNLIPGTNV
FIM1C_ECOLX     IELNDCDSQVSGAGIVFSGPAVTGKTDVLALSSAAGSATNVGVQITDHTGKVVPLGTASSTFTLTDG--T
FIM1C_ECOL6     IELNDCDSQVSGAGIVFSGPAVTGKTDVLALSSAAGSATNVGVQITDHTGKVVPLGTASSTFTLTDG--T
SFAA_ECOL5      IELNDCSSTAGHASIIFAGNVIATHNDVLSLNSAAGSATNVGIQILDHTGTAVQFDGVTASTQFTLTDGT
FIMF_SALTY      LKLEGCPPGSASITFSXXXXXXXXXXXXXXXXXXQK----LAIEIRDGDQRRLPLEQASKAVDID-NNGN
YGIL_ECOLI      IHLQDCGTTYSKAKVTFTTANTMTGQSDLLKNTKETEATGVGVRILDSQSGEVTLGTPV-VITFNNTNSY
FIMA1_SALTI     IVLNDCDKVAATAAVAFSGQADNTNTNLLAVSSADNSTTATGVGIEILDNTSSPL--KPDGATFSAKQAL
FMA_SERMA       IKLEQCDSTLKTVTTTFDGKASAANPDLL---XXXXXXXXXXXXXXDMASNPIKLGTATAPQTLNDGNNT
FMF3_ECOLX      ILLEGCNTPAQNVNAYFEPNANTDYTTGNLTNTASSGASNVQIQLLNADGVAIKLGQAASVDTVAINDAN
MRPA_PROMH      ISLENCTTTYKTVQTTFTG---SEATEVLEGSLGEGIAKNAAVVITDAGGKQIKLGTPSAAQNLRDGNND
FIMG_ECOLI      LELTNCPVGTSRVTASFSGAADS-----TGYYKNQGTAQNIQLELQDDSGNTLNTG-ATKTVQVDDSSQS
SFMF_ECOLI      LRLEGC--PPGSVAILFTGTPAS-DTNLLALD-DPAMAQTVAIELRNSDRSRLALGEASPTEEVD-ANGN
FIMI_SALTY      LRLISCSAEVRHVGIAFAGVTPAEDPHVFLASGEGIGNAGIGLALFDQQRQIIPNTLPLHYTPILTSEMT
FIMI_SALTI      LRLISCSAEVRHVGIAFAGVTPAEDPHVFLASGEGIGNAGIGLALFDQQRQIIPNTLPLHYAPILTSEMT
YBGD_ECOLI      VDIRNCGMPVSKVGVTFDSTAKTTGATPLLSNTSAGEATGVGVRLMDKNDGNIVLGSAAPDLDLDASSSE
FIMA1_SERMA     ISLEKCD--AGDYSLRFDGNTVAGNPDLLSVSXXXXXXXXXXIEITDNNGKPFAIGDGSNIVTIAAGKAT
SFAS_ECOL5      LSLTGC-QNMNTVRATFSGTADGQ-----TYYANTGNAGGIKIEIQDRDGSNASY-HNGMFKTLNVQNNN
F17GG_ECOLX     LKLQ-CDAGVTVWATLTDATTPSNRSDILTLT-GASTATGVGLRIYNTDSTPLKFGPDSPVKQLSTGETS
F17FG_ECOLX     LKLQ-CDAGVTVWATLTDATTPSNRSDILTLT-GASTATGVGLRIYNTDSTPLKFGPDSPVKQLSTGETS
F17EG_ECOLX     LKLQ-CDAGVTVWATLTDATTPSNRSDILTLT-GASTATGVGLRIYNTDSTPLKFGPDSPVKQLSTGETS
F17DG_ECOLX     LKLQ-CDAGVTVWATLTDATTPSNRSDILTLT-GASTATGVGLRIYNTDSTPLKFGPDSPVKQLSTGETS
F17CG_ECOLX     LKLQ-CDAGVTVWATLTDATTPSNRSDILTLT-GASTATGVGLRIYNTDSTPLKFGPDSPVKQLSTGETS
F17BG_ECOLX     LKLQ-CDAGVTVWATLTDATTPSNRSDILTLT-GASTATGVGLRIYNTDSTPLKFGPDSPVKQLSTGETS
F17AG_ECOLX     LKLQ-CDAGVTVWATLTDATTPSNRSDILTLT-GASTATGVGLRIYNTDSTPLKFGPDSPVKQLSTGETS
PAPK_ECOLX      IRLENCHATAVGVTLTFKGTEEAALPGHLKVTGVNAGRLGIALLDTDGSSLLKPGTSHNKGQGEKVTGNS
PAPK_ECOL6      IRLENCHATAVGVTLTFKGTEEAALPGHLKVTGVNAGRLGIALLDTDGSSLLKPGTSHNKGQGEKVTGNS
YCBQ_ECOLI      IELKDCDTTVTNATFTFNGTADTTQITAFANQASSDAATNVALQMYNDGTTAITPDTETGNILLQDGDQT
FM98_ECOLX      VNLINCDTTLNSIKYTIAGNNNTSDTKYLVPASNDTSASGVGVYIQDNNAQAVEIGTEKTVPVVSNG---
HIFD2_HAEIN     ITLKECNADAMKANLLFKGGDNTTGQSYLSNKAGNGKATNVGIQI-------------------------
YCBU_ECOLI      IDITGCAAGITGADVLFSGEADTLAPTLLKLTTGGSGATGIAVQILDQSQQEIPLNQVQPLTPLKAGDNT
PAPA_ECOLX      IELVNCDITAGTVKLAFTGPIVNGHSDELDTNGG----TGTAIVVQGAGKNVVFDGSEGDANTLKDGENV
PMFF_PROMH      ISLENCSQDIKSVTITLDGQAHSTMPNHIAVTSGSEDPKSIGIAFTDKAHNIIELKKPSAPQQLNNKRVQ
FM11_KLEPN      IQLNDCDTTATKAAVAFLGTAGPTHTDVLALSSAAGSATNVGVQILDRTGAGLALATFSSETTLNNGTNT
PRSK_ECOLX      IRLENCHATAVGVTLTFKGTEEAL-PGHLKVTGVNSGRLAIALLDTDGSSLLKPGASHNKGQGEKVTGNS
HIFA4_HAEIN     ITLQNCDPTTANGTANKANKVDKENNFTLKNEQTTADATNVNIQLMESNKAISVVGKESGSTQLTTGTNE
HIFA2_HAEIN     ITLQNCDPTTANGTANKANKVDKENNFTLKNEQTTADATNVNIQLMESNKAISVVGKESGSTQLTTGTNE
HIFD1_HAEIN     ITLKECNAAAKKANLLFSGAV-TKGQLYLSNAASSGKANNVGIQIVKADGTGSPI---------------
YDER_ECOLI      LSLTDCPVETSAVTAIVTG-----STDNTGYYKNEGTAENIQIELRDDQDAALKNG-DSKTVIVDEITRN
HIFA5_HAEIN     ITLEGCNANTGGVYFYSWNNADKENSYTLKSTTGTDKADNVNIQIFQENGT-------------------
PMFA_PROMH      IELQDCDTTAKTATVSYTSVVNAVNKDLASFVSGNASGAGIG--LMDAGSKAVKWNTATTPVQLINGVSK
YFCP_ECOLI      FKLKDCGPAGYNVKVTLTGVEDSEQPGFLALDT-SSTAQGVGIGMEKTDGMQVAI-NNTNGATFALTNGN
YRAH_ECOLI      IPLVNCPMTGGNVEASFRLWLETRNLAKVGSFAGIA-ATGVGIRIDDESGNIMPLGNDNTVYQISNGIVN
MRKD_KLEPN      IKLECSGGVSANINTSFSGTL-ATNTSLLNEKTGNSAAKGVGVQVIKDN-TPLEFNKKHNIGTLQSQETR
FMF2_ECOLX      IKLINCDITXXXVSLTFSGVPSGPQSDMLQ-TVG---ATNTAIVVTDPHGKRVKFATATGVSYLVDGDNT
FMF2_ECOL6      IKLINCDITXXXVSLTFSGVPSGPQSDMLQ-TVG---ATNTAIVVTDPHGKRVKFATATGVSYLVDGDNT
LPFE_SALTY      IGLKDC-AYATKASVTMDGSPDPTDPSLFALDSG--GATGVALKIKTSGEQQYPSSTDSTPVEHTVWDGT
FMK1_ECOLX      IKLVNCGAAKKGVSLTFSG-VPAENADDMLQTVGDTNTA---IVVTDSSGKRVKFATETGASNLINGDNT
PRSA_ECOLX      IKLTDCDVTAGTVSLTFSGV--QAGTDMLQ-TVG---TTGTAILVKDPHGKAVKFATATGVSSLVDGDNT
HIFA1_HAEIN     ITLQNCNLTAANSSTSWENADKENNFTLKNKTSTSNDATMVNIQLMDGTKEIKVVGKESGSTQLTGVTGD
FM3_BORPE       IKLKECPQALGALKLYFEGITTNYDTGDLIAYKQTYNASGNG----------------------------
FIMH_ECOLI      ---QNLGYYLSGTT------ADAGNS-IFTNTASFSPAQGVGVQL-TRNGTIIPA---NNTVSLGAGTSA
GP2_RAT         ----SCLLTLVFPSTTHQGYGNPRNTSNVDLDCGAPGSSSAGICFDPQNHTVLNDPSRSTENTVSSEECD
YFCV_ECOLI      IRLQDCXXXXXXXXXXXVSSANSGNYYTIFNTDTGAAFNNVSLAIGDSLGTSYKSGMGIDQTATNKGKAK
NIFV_KLEPN      LGLERCLGVETGVHFS------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AHLQFYARYLADGGAVTPGDANASATFILAYE
FIMF_ECOLI      T-LNFYARLMATQVPVTAGHINATATFTLEYQ
FIMI_ECOLI      LH--FIAKYRATGRRVTGGIANAQAWFSLTYQ
LPFA_SALTY      --LYYTANYVATKDTVTTGYGNAEVDFNLSYE
YCBV_ECOLI      --LTFYAQLRPVNSDVQSGKVNASATFVLHYD
YDES_ECOLI      I-LPYSARLKSTQKSVNPGLVRASATFTLEFQ
SFAG_ECOL5      --IAFYARLKATYLPVKAGNVDAVVNFVLDYQ
FIMA1_SALTY     VELRFTARYKXXXXXXXPGQANADATFIMKYE
FIM11_SALTY     VELRFTARYKXXXXXXXPGQANADATFIMKYE
SFMA_ECOLI      LH--FSARYKGTGTSASAGQANADATFIMRYE
SFMA_ECO57      LH--FSARYKGTGTSASAGQANADATFIMRYE
FIM1C_ECOLX     NKIPFQAVYYATGQA-TAGIANADATFKVQYQ
FIM1C_ECOL6     NKIPFQAVYYATGQA-TAGIANADATFKVQYQ
SFAA_ECOL5      NKIPFQAVYYATGKS-TPGIANADATFKVQYQ
FIMF_SALTY      ATLKFYANYIALADGVQPGLANADATFLINY-
YGIL_ECOLI      QELNFKARMESPSKDATPGNVYAQADYKIAYE
FIMA1_SALTI     VELRFTARY-----------------------
FMA_SERMA       --LRFAAYLQGDGASATPGDFTAVADFKLAYQ
FMF3_ECOLX      VTLRYNAQYYATGVA-TAGDVTSTVNYTIAYQ
MRPA_PROMH      LNFAAYLQGSASEAAV-PGDFTAIATFALTYQ
FIMG_ECOLI      AHFPLQVRALTVNGGATQGTIQAVISITYTY-
SFMF_ECOLI      VTLNFFANYRALASGVRPGVAKADAIFMINY-
FIMI_SALTY      LH--FTARYRAISENMTPGRIHSEVWFTLVY-
FIMI_SALTI      LH--FTARYRAISENMTPGRIHSEVWFTLVY-
YBGD_ECOLI      QTLNFFAEQIDNAVDVTAGEVTANATYVLDYK
FIMA1_SERMA     FNLQ--ARYRSFDSNVTAGLANATSPFTIEYK
SFAS_ECOL5      ATFNLKARAVSK-GQVTPGNISSVITVTYTY-
F17GG_ECOLX     PSVRLYVKYVNTGEGINPGTVNGISTFTFSYQ
F17FG_ECOLX     PSVRLYVKYVNTGEGINPGTVNGISTFTFSYQ
F17EG_ECOLX     PSVRLYVKYVNTGEGINPGTVNGISTFTFSYQ
F17DG_ECOLX     PSVRLYVKYVNTGEGINPGTVNGISTFTFSYQ
F17CG_ECOLX     PSVRLYVKYVNTGEGINPGTVNGISTFTFSYQ
F17BG_ECOLX     PSVRLYVKYVNTGEGINPGTVNGISTFTFSYQ
F17AG_ECOLX     PSVRLYVKYVNTGEGINPGTVNGISTFTFSYQ
PAPK_ECOLX      LELPFGAYVVATPEAVVPGDYEATATFELTY-
PAPK_ECOL6      LELPFGAYVVATPEAVVPGDYEATATFELTY-
YCBQ_ECOLI      --LTFKVDYIATGKA-TSGNVNAVTNFHINY-
FM98_ECOLX      --------------------------------
HIFD2_HAEIN     --------------------------------
YCBU_ECOLI      --LKYQLRY-----------------------
PAPA_ECOLX      LHTXXXXXXXXXXXXXTEGAFSAVANFNLTYQ
PMFF_PROMH      FNFMAYVEATSQNQTILTGPFQAQATYTLNYQ
FM11_KLEPN      --IPFQARY-----------------------
PRSK_ECOLX      LELPFGAYVVATPEAVVPGDYEATATFELTY-
HIFA4_HAEIN     LPLHFIAQYYATNKA-TAGKVQSSVDFQIAYE
HIFA2_HAEIN     LPLHFIAQYYATNKA-TAGKVQSSVDFQIAYE
HIFD1_HAEIN     --------------------------------
YDER_ECOLI      AQFPLKARAITVNGNASQGTIEALINVIYTWQ
HIFA5_HAEIN     --------------------------------
PMFA_PROMH      IPFVAYVQAESADAKVTPGEFQAVINFQVDYQ
YFCP_ECOLI      NDINFRAWLQAKSGRVTIGEFTASLTATFEY-
YRAH_ECOLI      VDLIAYYVSTVVPSEITPGEADAIVNVTLDY-
MRKD_KLEPN      ITLPLHARFYQYAPTTSTGEVESHLVFNLTYD
FMF2_ECOLX      IHFTAAVRKDGSGNPVTEGAFSAVANFNLTYQ
FMF2_ECOL6      IHFTAAVRKDGSGNPVTEGAFSAVANFNLTYQ
LPFE_SALTY      NKLNYIASYVPVKPDATVGTANATVNFSVTYE
FMK1_ECOLX      IHFTAFVKKDNSGKNVAEGAFSAVANFNLTYQ
PRSA_ECOLX      IHFTALVKKDTSGNDVAEGAFSAVANFNLIYQ
HIFA1_HAEIN     LPLHFIAQYYS-LGSTTAGKVQSSVDFQIAYE
FM3_BORPE       --------------------------------
FIMH_ECOLI      VSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
GP2_RAT         SHLRGWYRFVGDGGVKMP--------------
YFCV_ECOLI      QTLNFKAWLVGAADAPDLGNFEANTTFQITY-
NIFV_KLEPN      --------------------------------