[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF68451.1

[Show Plain Result]


## Summary of Sequence Search
    1::368
    1::368       0.0 100%  368 aa  MNMA_SALTI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0 100%  368 aa  MNMA_SALPB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0 100%  368 aa  MNMA_SALPA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0 100%  368 aa  MNMA_SALCH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0 100%  368 aa  MNMA_SALTY RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  99%  368 aa  MNMA_SALAR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  96%  368 aa  MNMA_CITK8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  96%  368 aa  MNMA_ECOSM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  95%  368 aa  MNMA_ECOLI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  95%  368 aa  MNMA_ECOLC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  95%  368 aa  MNMA_ECOHS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  95%  368 aa  MNMA_ECODH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  95%  368 aa  MNMA_ECO57 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  95%  368 aa  MNMA_ECO24 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  96%  368 aa  MNMA_ECOUT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  96%  368 aa  MNMA_ECOL5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  96%  368 aa  MNMA_ECOK1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  95%  368 aa  MNMA_SHISS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  95%  368 aa  MNMA_SHIFL RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  95%  368 aa  MNMA_SHIF8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  95%  368 aa  MNMA_SHIDS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  95%  368 aa  MNMA_SHIBS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  95%  368 aa  MNMA_SHIB3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::368       0.0  95%  368 aa  MNMA_ECOL6 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::366       0.0  93%  369 aa  MNMA_ENT38 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::366       0.0  94%  368 aa  MNMA_KLEP3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::366       0.0  93%  368 aa  MNMA_KLEP7 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::369     e-179  86%  369 aa  MNMA_ENTS8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::365     e-177  85%  367 aa  MNMA_SERP5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::367     e-174  83%  373 aa  MNMA_YERE8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::365     e-171  82%  367 aa  MNMA_PHOLL RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::365     e-171  82%  367 aa  MNMA_PROMH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::369     e-171  81%  371 aa  MNMA_YERP3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::368     e-170  81%  371 aa  MNMA_YERPY RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::368     e-170  81%  371 aa  MNMA_YERPS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::368     e-170  81%  371 aa  MNMA_YERPP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::368     e-170  81%  371 aa  MNMA_YERPN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::368     e-170  81%  371 aa  MNMA_YERPG RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::368     e-170  81%  371 aa  MNMA_YERPE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::368     e-170  81%  371 aa  MNMA_YERPB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::368     e-170  81%  371 aa  MNMA_YERPA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::366     e-166  82%  368 aa  MNMA_PECCP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::368     e-165  79%  369 aa  MNMA_SODGM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::366     e-165  81%  368 aa  MNMA_ERWCT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::365     e-163  79%  367 aa  MNMA_EDWI9 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   33::372     e-154  75%  377 aa  MNMA_SHEAM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   41::383     e-154  79%  383 aa  MNMA_HAEI8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   41::383     e-154  79%  383 aa  MNMA_HAEIN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::366     e-154  75%  371 aa  MNMA_SHELP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   40::382     e-153  75%  383 aa  MNMA_HAES1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   41::385     e-153  79%  385 aa  MNMA_HAEIG RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   40::382     e-153  74%  383 aa  MNMA_HAES2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::365     e-152  74%  367 aa  MNMA_PSYIN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::377     e-152  76%  377 aa  MNMA_PHOPR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::368     e-150  74%  372 aa  MNMA_SHEON RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::366     e-150  74%  371 aa  MNMA_SHEHH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::363     e-150  75%  368 aa  MNMA_AERS4 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::366     e-150  73%  371 aa  MNMA_SHEPW RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::363     e-150  75%  368 aa  MNMA_AERHH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   46::388     e-150  76%  389 aa  MNMA_ACTPJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::368     e-149  73%  372 aa  MNMA_SHESW RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::368     e-149  73%  372 aa  MNMA_SHEB9 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::368     e-149  73%  372 aa  MNMA_SHEPC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::368     e-149  73%  372 aa  MNMA_SHEB8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::366     e-149  72%  371 aa  MNMA_SHEPA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   46::388     e-149  76%  389 aa  MNMA_ACTP2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::368     e-149  73%  372 aa  MNMA_SHEB5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::368     e-149  73%  372 aa  MNMA_SHEB2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   28::367     e-149  73%  372 aa  MNMA_SHESH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::369     e-148  73%  374 aa  MNMA_VIBPA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   46::388     e-148  76%  389 aa  MNMA_MANSM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   28::357     e-148  77%  372 aa  MNMA_VIBCH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   28::357     e-148  77%  372 aa  MNMA_VIBC3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::372     e-147  72%  374 aa  MNMA_VIBVY RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   33::372     e-147  71%  377 aa  MNMA_SHEWM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::350     e-147  77%  369 aa  MNMA_TOLAT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::367     e-147  73%  372 aa  MNMA_SHEDO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::372     e-146  72%  374 aa  MNMA_VIBVU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::374     e-146  74%  374 aa  MNMA_VIBFM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::374     e-146  74%  374 aa  MNMA_VIBF1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   41::383     e-146  75%  384 aa  MNMA_HAEDU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::369     e-146  72%  374 aa  MNMA_VIBHB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::362     e-145  72%  366 aa  MNMA_PSEHT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::364     e-145  72%  371 aa  MNMA_IDILO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::366     e-143  70%  368 aa  MNMA_BAUCH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::368     e-141  69%  372 aa  MNMA_SHESM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::368     e-140  69%  372 aa  MNMA_SHESR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   40::382     e-140  72%  383 aa  MNMA_PASMU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::371     e-140  68%  375 aa  MNMA_COLP3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::368     e-140  69%  372 aa  MNMA_SHESA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::355     e-139  73%  372 aa  MNMA_SHEFN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   33::392     e-138  69%  396 aa  MNMA_PSEA6 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   46::388     e-135  70%  389 aa  MNMA_ACTSZ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-131  64%  367 aa  MNMA_BLOPB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::371     e-130  65%  376 aa  MNMA_PSEU2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::371     e-129  64%  376 aa  MNMA_PSE14 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::365     e-129  65%  374 aa  MNMA_PSEFS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::371     e-128  64%  376 aa  MNMA_PSESM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   47::384     e-128  66%  390 aa  MNMA_MARMS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   28::369     e-128  64%  375 aa  MNMA_PSEU5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   46::395     e-127  67%  398 aa  MNMA_PSYWF RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::360     e-127  65%  370 aa  MNMA_PSEMY RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   28::369     e-127  63%  374 aa  MNMA_PSEPF RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   28::369     e-126  64%  377 aa  MNMA_PSEF5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::364     e-126  64%  375 aa  MNMA_PSEA7 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   28::369     e-126  63%  374 aa  MNMA_PSEPW RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   28::369     e-125  63%  374 aa  MNMA_PSEE4 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   28::369     e-125  63%  374 aa  MNMA_PSEPG RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   35::375     e-125  64%  380 aa  MNMA_SACD2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   28::369     e-125  63%  374 aa  MNMA_PSEPK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   28::369     e-125  63%  374 aa  MNMA_PSEP1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::364     e-125  63%  375 aa  MNMA_PSEA8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::364     e-124  63%  375 aa  MNMA_PSEAE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::364     e-124  63%  375 aa  MNMA_PSEAB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::359     e-124  62%  371 aa  MNMA_METCA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::370     e-123  62%  392 aa  MNMA_MARAV RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   51::399     e-123  66%  408 aa  MNMA_PSYA2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   51::399     e-121  65%  408 aa  MNMA_PSYCK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::358     e-120  60%  359 aa  MNMA_FRAP2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::358     e-118  59%  359 aa  MNMA_FRATT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::358     e-118  59%  359 aa  MNMA_FRATM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::358     e-118  59%  359 aa  MNMA_FRAT1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::366     e-118  57%  367 aa  MNMA_BUCAP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::366     e-118  64%  377 aa  MNMA_ACIBS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::366     e-117  64%  377 aa  MNMA_ACIBY RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::366     e-117  64%  377 aa  MNMA_ACIBT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::366     e-117  64%  377 aa  MNMA_ACIB5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::366     e-117  64%  377 aa  MNMA_ACIB3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::358     e-117  59%  359 aa  MNMA_FRATN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::366     e-117  64%  377 aa  MNMA_ACIBC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::358     e-117  59%  359 aa  MNMA_FRATW RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::358     e-117  59%  359 aa  MNMA_FRATO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::358     e-117  59%  359 aa  MNMA_FRATH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::358     e-117  59%  359 aa  MNMA_FRATF RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::362     e-117  56%  369 aa  MNMA_BLOFL RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::363     e-116  57%  364 aa  MNMA_ALKOO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::366     e-116  63%  377 aa  MNMA_ACIAD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   32::369     e-115  60%  384 aa  MNMA_CHRSD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::360     e-113  58%  364 aa  MNMA_HAHCH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::365     e-113  58%  377 aa  MNMA_LACC3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::361     e-113  58%  361 aa  MNMA_CUPTR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::361     e-112  57%  374 aa  MNMA_EXIS2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   26::362     e-112  57%  374 aa  MNMA_LYSSC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::361     e-112  57%  361 aa  MNMA_RALEH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::360     e-111  56%  360 aa  MNMA_METFK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::357     e-111  56%  362 aa  MNMA_NITEU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::363     e-110  55%  369 aa  MNMA_ALKMQ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   47::384     e-110  55%  384 aa  MNMA_CHRVO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::359     e-110  58%  371 aa  MNMA2_GEOKA RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   24::359     e-109  57%  371 aa  MNMA_GEOTN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::360     e-109  56%  372 aa  MNMA_BACLD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::359     e-109  54%  371 aa  MNMA_BACCN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::368     e-109  58%  370 aa  MNMA_POLSQ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::359     e-109  56%  362 aa  MNMA_RALEJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::368     e-109  56%  391 aa  MNMA_BURCC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::357     e-108  56%  370 aa  MNMA_STACT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::369     e-108  58%  370 aa  MNMA_BORA1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::359     e-108  53%  371 aa  MNMA_BACHK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::359     e-108  53%  371 aa  MNMA_BACCZ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::359     e-108  53%  371 aa  MNMA_BACCQ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::359     e-108  53%  371 aa  MNMA_BACAN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::359     e-108  53%  371 aa  MNMA_BACAH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::375     e-108  59%  376 aa  MNMA_BORPD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   26::373     e-108  60%  374 aa  MNMA_AZOSE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::358     e-108  56%  371 aa  MNMA_LISMO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::359     e-108  53%  371 aa  MNMA_BACCR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::359     e-108  53%  371 aa  MNMA_BACC1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::364     e-108  60%  365 aa  MNMA_AZOSB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::362     e-108  58%  364 aa  MNMA_ALCBS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::356     e-108  57%  378 aa  MNMA_XANCP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::356     e-108  57%  378 aa  MNMA_XANCB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::356     e-108  57%  378 aa  MNMA_XANC8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::358     e-108  56%  371 aa  MNMA_LISIN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::361     e-108  56%  383 aa  MNMA_BURPS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::361     e-108  56%  383 aa  MNMA_BURP6 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::368     e-107  57%  379 aa  MNMA_THICR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::361     e-107  56%  383 aa  MNMA_BURMS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::361     e-107  56%  383 aa  MNMA_BURMA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::361     e-107  56%  383 aa  MNMA_BURM9 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::361     e-107  56%  383 aa  MNMA_BURM7 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::359     e-107  53%  371 aa  MNMA_BACWK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::359     e-107  56%  359 aa  MNMA_RALME RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::358     e-107  55%  371 aa  MNMA_LISMF RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::358     e-107  55%  371 aa  MNMA_LISMC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::358     e-107  55%  371 aa  MNMA_LISW6 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::361     e-107  55%  383 aa  MNMA_BURP1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::361     e-107  55%  383 aa  MNMA_BURP0 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-107  55%  373 aa  MNMA_STRZP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-107  55%  373 aa  MNMA_STRPJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::358     e-107  55%  371 aa  MNMA_LISMH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::362     e-107  54%  374 aa  MNMA_STRSY RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::362     e-107  54%  374 aa  MNMA_STRS2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-107  55%  373 aa  MNMA_STRPS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-107  55%  373 aa  MNMA_STRR6 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-107  55%  373 aa  MNMA_STRP2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::357     e-106  55%  370 aa  MNMA_STAS1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::364     e-106  56%  386 aa  MNMA_BURTA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-106  55%  373 aa  MNMA_STRP7 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-106  56%  372 aa  MNMA_STAAB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::367     e-106  52%  368 aa  MNMA_BUCAI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-106  54%  373 aa  MNMA_STRZT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-106  54%  373 aa  MNMA_STRPN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-106  54%  373 aa  MNMA_STRPI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::358     e-106  55%  384 aa  MNMA_BURCM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::357     e-106  58%  367 aa  MNMA_NEIM0 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::364     e-106  56%  376 aa  MNMA_LACLA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::356     e-106  56%  378 aa  MNMA_XANC5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::357     e-106  58%  367 aa  MNMA_NEIMB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::360     e-106  56%  381 aa  MNMA_BURXL RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-106  56%  372 aa  MNMA_STAAT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-106  56%  372 aa  MNMA_STAAR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-106  56%  372 aa  MNMA_STAAN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-106  56%  372 aa  MNMA_STAAM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-106  56%  372 aa  MNMA_STAAE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-106  56%  372 aa  MNMA_STAAC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-106  56%  372 aa  MNMA_STAA9 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-106  56%  372 aa  MNMA_STAA8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-106  56%  372 aa  MNMA_STAA3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-106  56%  372 aa  MNMA_STAA2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-106  56%  372 aa  MNMA_STAA1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::356     e-106  56%  378 aa  MNMA_XANAC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-106  54%  373 aa  MNMA_STRP4 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::357     e-106  55%  361 aa  MNMA_NITEC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::357     e-106  58%  367 aa  MNMA_NEIMF RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-106  56%  372 aa  MNMA_STAAW RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-106  56%  372 aa  MNMA_STAAS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-105  54%  373 aa  MNMA_STRGC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::363     e-105  56%  375 aa  MNMA_LACS1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::366     e-105  53%  377 aa  MNMA_LACRJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::366     e-105  53%  377 aa  MNMA_LACRD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-105  54%  373 aa  MNMA_STRZJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-105  54%  373 aa  MNMA_STRMU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::365     e-105  56%  370 aa  MNMA_RALPJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::364     e-105  55%  376 aa  MNMA_LACLM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::363     e-105  55%  375 aa  MNMA_LACAC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::356     e-105  55%  378 aa  MNMA_XANOR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::356     e-105  55%  378 aa  MNMA_XANOP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::357     e-105  56%  358 aa  MNMA_THIDA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::365     e-105  59%  372 aa  MNMA_HERAR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::358     e-105  54%  381 aa  MNMA_BURM1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::357     e-105  55%  370 aa  MNMA_STAHJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::364     e-105  55%  376 aa  MNMA_LACLS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::368     e-105  52%  370 aa  MNMA_BUCBP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::357     e-105  54%  370 aa  MNMA_RALSO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::357     e-105  58%  367 aa  MNMA_NEIG1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::362     e-105  56%  383 aa  MNMA_BURPP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::363     e-105  55%  389 aa  MNMA_BURA4 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-104  55%  372 aa  MNMA_STAES RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::359     e-104  55%  372 aa  MNMA_STAEQ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::356     e-104  55%  378 aa  MNMA_XANOM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::371     e-104  56%  380 aa  MNMA_STRMK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::362     e-104  53%  373 aa  MNMA_STRA5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::362     e-104  53%  373 aa  MNMA_STRA3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::371     e-104  56%  380 aa  MNMA_STRM5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::362     e-104  53%  373 aa  MNMA_STRSV RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::365     e-104  58%  372 aa  MNMA_JANMA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::364     e-104  54%  375 aa  MNMA_LACGA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::363     e-104  54%  383 aa  MNMA_BURS3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::362     e-103  53%  373 aa  MNMA_STRA1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::364     e-103  54%  375 aa  MNMA_LACJO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   26::363     e-103  54%  375 aa  MNMA_LACBA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::365     e-103  57%  370 aa  MNMA_DIAST RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::362     e-103  53%  371 aa  MNMA_BACHD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-103  54%  373 aa  MNMA_STRU0 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::364     e-103  56%  365 aa  MNMA_DECAR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::362     e-102  53%  373 aa  MNMA_STRT2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::362     e-102  53%  373 aa  MNMA_STRT1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-102  53%  373 aa  MNMA_STRPZ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::357     e-102  56%  367 aa  MNMA_NITOC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-102  52%  379 aa  MNMA_LACSS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::368     e-102  54%  391 aa  MNMA_BURCJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::358     e-102  51%  361 aa  MNMA_LEGPL RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::359     e-102  54%  371 aa  MNMA_BACSU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::365     e-102  54%  366 aa  MNMA_ALHEH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::374     e-102  58%  378 aa  MNMA_ACIAC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::362     e-102  55%  362 aa  MNMA_VESOH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-102  53%  373 aa  MNMA_STRPD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::358     e-102  51%  361 aa  MNMA_LEGPH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::363     e-102  54%  375 aa  MNMA_LACH4 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::366     e-102  58%  372 aa  MNMA_DELAS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-102  53%  373 aa  MNMA_STRPG RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-102  53%  373 aa  MNMA_STRPF RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-102  53%  373 aa  MNMA_STRP6 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::358     e-102  51%  361 aa  MNMA_LEGPC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   33::370     e-102  53%  371 aa  MNMA_COXB1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-102  53%  373 aa  MNMA_STRPC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-102  53%  373 aa  MNMA_STRPB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::378     e-102  58%  401 aa  MNMA_POLSJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::358     e-102  51%  361 aa  MNMA_LEGPA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::361     e-102  53%  362 aa  MNMA_COXBU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::361     e-102  53%  362 aa  MNMA_COXBN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   33::370     e-102  53%  371 aa  MNMA_COXB2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-102  53%  373 aa  MNMA_STRP1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::362     e-101  53%  373 aa  MNMA_STRTD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-101  53%  373 aa  MNMA_STRP8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::362     e-101  53%  374 aa  MNMA_STREM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::361     e-101  53%  362 aa  MNMA_COXBR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::359     e-101  53%  371 aa  MNMA_BACA2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-101  52%  373 aa  MNMA_STRPM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::362     e-101  53%  374 aa  MNMA_LACPL RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::368     e-101  54%  391 aa  MNMA_BURCH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::368     e-101  54%  391 aa  MNMA_BURCA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::361     e-101  52%  373 aa  MNMA_STRP3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::357     e-101  54%  363 aa  MNMA_NITMU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::362     e-101  52%  374 aa  MNMA_STRE4 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::357     e-100  53%  370 aa  MNMA1_GEOKA RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   20::363     e-100  55%  384 aa  MNMA_BURP8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::392     1e-99  58%  396 aa  MNMA_METPP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::362     1e-99  49%  368 aa  MNMA_WIGBR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::366     1e-99  52%  377 aa  MNMA_LACF3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::378     4e-99  57%  394 aa  MNMA_POLNA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::356     5e-99  53%  379 aa  MNMA_XYLFA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::370     5e-99  54%  371 aa  MNMA_BORPA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::370     7e-99  54%  371 aa  MNMA_BORPE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::370     7e-99  54%  371 aa  MNMA_BORBR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::363     9e-99  53%  384 aa  MNMA_BURVG RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::357     1e-98  54%  367 aa  MNMA_NEIMA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::363     1e-98  50%  374 aa  MNMA_ENTFA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::356     4e-98  53%  379 aa  MNMA_XYLFT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::356     4e-98  53%  379 aa  MNMA_XYLFM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::356     4e-98  53%  379 aa  MNMA_XYLF2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::362     7e-98  51%  374 aa  MNMA_STRS7 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::358     7e-98  52%  371 aa  MNMA_OCEIH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::374     2e-97  56%  379 aa  MNMA_ACISJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::359     6e-97  53%  376 aa  MNMA_PARUW RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::358     6e-97  49%  364 aa  MNMA_BACSK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::363     8e-97  52%  375 aa  MNMA_LACDB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   28::368     8e-97  52%  376 aa  MNMA_DICNV RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::363     1e-96  52%  375 aa  MNMA_LACDA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::356     5e-96  54%  366 aa  MNMA_FINM2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::357     9e-96  51%  377 aa  MNMA_PEDPA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   26::363     5e-94  51%  363 aa  MNMA_RUTMC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::373     5e-94  54%  380 aa  MNMA_LEPCP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::360     5e-94  51%  372 aa  MNMA_BACP2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::382     8e-94  57%  384 aa  MNMA_RHOFD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::371     1e-91  50%  374 aa  MNMA_MESFL RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::368     9e-91  55%  370 aa  MNMA_VEREI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::363     1e-88  51%  374 aa  MNMA_MYCAP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::350     3e-88  49%  358 aa  MNMA_CHLMU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::370     1e-87  46%  373 aa  MNMA_BUCCC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::372     2e-86  47%  375 aa  MNMA_MYCCT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::351     2e-86  49%  358 aa  MNMA_CHLTR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::351     2e-86  49%  358 aa  MNMA_CHLTA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::351     4e-86  49%  358 aa  MNMA_CHLTB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::351     4e-86  49%  358 aa  MNMA_CHLT2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::372     6e-86  47%  375 aa  MNMA_MYCMS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   28::353     1e-85  49%  361 aa  MNMA_CHLPN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   28::354     4e-85  49%  360 aa  MNMA_CHLCV RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::366     5e-85  48%  383 aa  MNMA_HALHL RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::354     2e-84  49%  362 aa  MNMA_CHLAB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::353     4e-84  48%  361 aa  MNMA_CHLFF RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::363     4e-82  48%  367 aa  MNMA2_ARCB4 RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   23::370     1e-81  47%  380 aa  MNMA_UREU1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::358     3e-81  48%  371 aa  MNMA_MYCPU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::364     2e-79  46%  375 aa  MNMA_PHYAS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::362     2e-79  46%  375 aa  MNMA_ACHLI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::367     4e-79  45%  378 aa  MNMA_ONYPE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::367     5e-78  44%  378 aa  MNMA_AYWBP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::359     2e-77  49%  370 aa  MNMA_MYCA5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::394     3e-76  48%  395 aa  MNMA_GRAFK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::394     7e-75  47%  395 aa  MNMA_FLAPJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::392     1e-73  44%  424 aa  MTU1_CHICK RecName: Full=Mitochondrial tRNA-specific
   21::359     1e-73  45%  370 aa  MNMA_MYCMO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::361     2e-73  46%  372 aa  MNMA_MYCS5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::358     7e-72  45%  372 aa  MNMA_MYCHJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::358     7e-72  45%  372 aa  MNMA_MYCH2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::358     2e-71  45%  372 aa  MNMA_MYCH7 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::383     3e-71  43%  421 aa  MTU1_HUMAN RecName: Full=Mitochondrial tRNA-specific
   21::372     5e-70  40%  389 aa  MTU1_DROME RecName: Full=Mitochondrial tRNA-specific
   18::394     5e-70  45%  395 aa  MNMA_FLAJ1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::383     8e-70  42%  417 aa  MTU1_MOUSE RecName: Full=Mitochondrial tRNA-specific
   44::389     8e-70  44%  390 aa  MNMA_SYMTH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::357     1e-69  42%  357 aa  MNMA_AKKM8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::368     3e-69  43%  370 aa  MNMA_MYCPE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::384     7e-69  43%  422 aa  MTU1_PONAB RecName: Full=Mitochondrial tRNA-specific
   23::365     4e-68  44%  365 aa  MNMA_CARHZ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::383     2e-67  42%  416 aa  MTU1_DANRE RecName: Full=Mitochondrial tRNA-specific
   21::376     9e-67  43%  378 aa  MNMA_OPITP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::361     3e-66  42%  368 aa  MNMA_NATTJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::370     4e-66  43%  385 aa  MNMA_UREPA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::370     4e-66  43%  385 aa  MNMA_UREP2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::407     6e-66  43%  441 aa  MTU1_RAT RecName: Full=Mitochondrial tRNA-specific 2-thiouridylase
   23::365     2e-65  43%  365 aa  MNMA_GEOSL RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::349     4e-65  40%  351 aa  MNMA_NOSP7 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
  303::649     8e-65  42%  657 aa  MNMA_MYCGA RecName: Full=Trifunctional protein ribF/mnmA;Includes: 
   18::349     1e-63  40%  352 aa  MNMA_ANAVT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::359     2e-63  37%  359 aa  MNMA_CLOPE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::359     2e-63  37%  359 aa  MNMA_CLOP1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::349     4e-63  39%  352 aa  MNMA_ANASP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::355     6e-63  39%  357 aa  MNMA_CLOPH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::357     6e-63  40%  359 aa  MNMA_CHLCH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::363     8e-63  43%  375 aa  MNMA_GEOUR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::362     8e-63  43%  368 aa  MNMA_GEOMG RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   34::368     1e-62  42%  368 aa  MNMA_SYNJB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::363     1e-62  39%  364 aa  MNMA1_THEPX RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   21::363     1e-62  39%  364 aa  MNMA1_THEP3 RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   20::371     2e-62  42%  371 aa  MNMA_SOLUE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::359     5e-62  39%  359 aa  MNMA_CLOPS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::356     6e-62  38%  356 aa  MNMA1_CLOBM RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   24::352     1e-61  39%  352 aa  MNMA_MICAN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::356     1e-61  38%  356 aa  MNMA2_CLOBK RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   21::363     1e-61  40%  364 aa  MNMA1_THETN RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   19::356     3e-61  38%  356 aa  MNMA1_CLOBH RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   19::356     3e-61  38%  356 aa  MNMA1_CLOB1 RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   21::346     4e-61  38%  361 aa  MNMA_CLOD6 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::356     4e-61  38%  356 aa  MNMA1_CLOBL RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   18::368     9e-61  41%  375 aa  MTU1_CAEEL RecName: Full=Probable mitochondrial tRNA-specific
   19::363     9e-61  40%  385 aa  MNMA_HELMI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::346     2e-60  41%  367 aa  MNMA_PELLD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::358     2e-60  38%  358 aa  MNMA2_CLOTE RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   36::370     2e-60  41%  370 aa  MNMA_SYNJA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::346     2e-60  41%  350 aa  MNMA_CLONN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::355     5e-60  38%  355 aa  MNMA_CLOAB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::363     8e-60  39%  367 aa  MNMA_DESRM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::348     1e-59  40%  358 aa  MNMA_SYNY3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::363     1e-59  40%  364 aa  MNMA2_THEPX RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   21::363     1e-59  40%  364 aa  MNMA2_THEP3 RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   20::358     3e-59  40%  365 aa  MNMA_PELTS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::347     4e-59  37%  361 aa  MNMA_CLOBA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::349     7e-59  38%  349 aa  MNMA_CYAP7 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::348     1e-58  39%  364 aa  MNMA2_THETN RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   20::349     3e-58  41%  352 aa  MNMA_ACIF5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::349     3e-58  41%  352 aa  MNMA_ACIF2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::341     6e-58  44%  342 aa  MNMA2_SYNAS RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   22::351     7e-58  43%  352 aa  MNMA_PELCD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::351     7e-58  40%  357 aa  MNMA_HERA2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::350     7e-58  36%  353 aa  MNMA2_CLOBL RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   21::355     1e-57  38%  356 aa  MNMA_CLOK5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::349     3e-57  39%  355 aa  MNMA_CYAA5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::343     5e-57  37%  358 aa  MNMA_CLOB8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::353     6e-57  38%  358 aa  MNMA_PARD8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   36::369     8e-57  40%  380 aa  MNMA_DEIRA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::348     1e-56  38%  353 aa  MNMA_SYNP2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::347     1e-56  40%  359 aa  MNMA_CLOTH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::336     2e-56  38%  357 aa  MNMA_SYNP6 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::336     2e-56  38%  357 aa  MNMA_SYNE7 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::366     2e-56  42%  383 aa  MNMA_SALRD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::352     3e-56  37%  357 aa  MNMA_PROVI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   14::352     3e-56  41%  357 aa  MNMA_MOOTA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::358     3e-56  40%  381 aa  MNMA_DEIGD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::336     3e-56  38%  349 aa  MNMA_CYAP8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::356     3e-56  41%  362 aa  MNMA1_CLOTE RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   40::362     5e-56  42%  362 aa  MNMA1_FUSNN RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   22::342     9e-56  37%  361 aa  MNMA_CLOBB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::342     9e-56  40%  359 aa  MNMA_CHLPB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::367     2e-55  38%  367 aa  MNMA_MYCGE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::346     3e-55  39%  354 aa  MNMA_GEOLS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::345     3e-55  37%  362 aa  MNMA3_BACFN RecName: Full=tRNA-specific 2-thiouridylase mnmA 3;    
   22::352     8e-55  37%  355 aa  MNMA_ACAM1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::349     1e-54  41%  366 aa  MNMA_TREDE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::353     1e-54  39%  359 aa  MNMA_CHLAD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    1::345     1e-54  37%  362 aa  MNMA3_BACFR RecName: Full=tRNA-specific 2-thiouridylase mnmA 3;    
   23::350     1e-54  35%  355 aa  MNMA_BORGA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   41::382     2e-54  39%  389 aa  MNMA_SYNS9 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::386     2e-54  40%  389 aa  MNMA_SYNPW RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::368     2e-54  36%  368 aa  MNMA_RICCK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::343     2e-54  38%  358 aa  MNMA_HALOH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::352     2e-54  39%  369 aa  MNMA_THEEB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   41::382     2e-54  38%  383 aa  MNMA_SYNSC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::370     4e-54  40%  373 aa  MNMA_ROSS1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::350     4e-54  34%  355 aa  MNMA_BORAP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::347     5e-54  39%  359 aa  MNMA_TRIEI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   86::403     5e-54  41%  409 aa  MNMA_PROMM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::345     5e-54  39%  362 aa  MNMA3_BACTN RecName: Full=tRNA-specific 2-thiouridylase mnmA 3;    
   18::357     6e-54  37%  358 aa  MNMA_RICTY RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::360     6e-54  37%  365 aa  MNMA_RICFE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::360     6e-54  37%  361 aa  MNMA_CALS8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::357     1e-53  38%  358 aa  MNMA_RICPR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::364     1e-53  37%  365 aa  MNMA_RICM5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::369     1e-53  37%  370 aa  MNMA_RICCN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::353     1e-53  35%  355 aa  MNMA1_BACTN RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   18::352     2e-53  40%  367 aa  MNMA_THET8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::352     2e-53  40%  367 aa  MNMA_THET2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   37::368     2e-53  38%  372 aa  MNMA1_SYNAS RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   48::406     2e-53  37%  415 aa  MTU1_SCHPO RecName: Full=Mitochondrial tRNA-specific
   46::387     3e-53  38%  396 aa  MNMA_SYNPX RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::364     3e-53  37%  365 aa  MNMA_RICRS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::364     3e-53  37%  365 aa  MNMA_RICRO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::364     3e-53  37%  365 aa  MNMA_RICPU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   42::382     4e-53  39%  383 aa  MNMA_SYNR3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   86::403     4e-53  40%  409 aa  MNMA_PROM3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::357     4e-53  38%  366 aa  MNMA_CHLTE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::364     5e-53  37%  365 aa  MNMA_RICAE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::357     2e-52  36%  358 aa  MNMA_MAGSM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::352     3e-52  36%  353 aa  MNMA2_BACFN RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   22::352     5e-52  36%  353 aa  MNMA2_BACFR RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   80::371     8e-52  41%  378 aa  MNMA_SPHWW RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::350     8e-52  37%  357 aa  MNMA_CHLPD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::337     1e-51  37%  338 aa  MNMA_SYNWW RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::351     1e-51  34%  354 aa  MNMA1_BACV8 RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   45::382     2e-51  37%  387 aa  MNMA_ANAMM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   46::388     3e-51  39%  391 aa  MNMA_SYNS3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::362     4e-51  34%  369 aa  MNMA_ORITB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::365     4e-51  38%  370 aa  MNMA_MYCPN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::353     4e-51  36%  354 aa  MNMA_BORRA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::353     4e-51  36%  354 aa  MNMA_BORDL RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   35::368     5e-51  37%  370 aa  MNMA_WOLWR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   60::360     7e-51  40%  366 aa  MNMA_CORDI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::353     7e-51  35%  354 aa  MNMA_BORT9 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::373     7e-51  39%  374 aa  MNMA_ACIC5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::360     9e-51  35%  365 aa  MNMA_RICAH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::368     9e-51  36%  370 aa  MNMA_DESHY RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::360     1e-50  35%  367 aa  MNMA_RICBR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::360     1e-50  35%  367 aa  MNMA_RICB8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::362     2e-50  38%  362 aa  MNMA_SYNFM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::362     2e-50  36%  368 aa  MNMA_CYTH3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::350     2e-50  32%  355 aa  MNMA_BORBZ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::361     2e-50  39%  376 aa  MNMA_AMOA5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   55::407     3e-50  38%  417 aa  MTU1_YEAST RecName: Full=Mitochondrial tRNA-specific
   20::357     3e-50  35%  361 aa  MNMA_PORG3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::359     3e-50  38%  375 aa  MNMA_LEPIN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::359     3e-50  38%  375 aa  MNMA_LEPIC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::351     3e-50  38%  357 aa  MNMA_DEHE1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   35::368     4e-50  36%  370 aa  MNMA_WOLPM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::357     4e-50  37%  361 aa  MNMA_PORGI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::372     4e-50  35%  398 aa  MNMA_OCHA4 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   23::350     4e-50  32%  355 aa  MNMA_BORBU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::351     4e-50  33%  353 aa  MNMA1_CLOBK RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   38::370     6e-50  34%  371 aa  MNMA_NEOSM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   33::355     6e-50  39%  358 aa  MNMA_DESOH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::351     6e-50  37%  357 aa  MNMA_DEHSC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::351     6e-50  37%  357 aa  MNMA_DEHSB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::354     6e-50  38%  370 aa  MNMA_ACIBL RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   85::375     7e-50  41%  383 aa  MNMA_ZYMMO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   35::366     7e-50  35%  368 aa  MNMA_WOLPP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::358     7e-50  37%  375 aa  MNMA3_BACV8 RecName: Full=tRNA-specific 2-thiouridylase mnmA 3;    
   21::351     1e-49  36%  357 aa  MNMA_GLOVI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::378     1e-49  36%  399 aa  MNMA_AGRRK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::377     1e-49  36%  398 aa  MNMA_RHISN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::353     1e-49  35%  354 aa  MNMA_BORHD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::347     2e-49  36%  348 aa  MNMA_MYXXD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::368     2e-49  38%  371 aa  MNMA_ROSCS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::359     2e-49  38%  377 aa  MNMA_LEPBL RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::359     2e-49  38%  377 aa  MNMA_LEPBJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::351     3e-49  33%  353 aa  MNMA2_CLOBH RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   20::351     3e-49  33%  353 aa  MNMA2_CLOB1 RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   35::369     5e-49  37%  371 aa  MNMA_WOLTR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   53::402     6e-49  38%  406 aa  MNMA_PROM4 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::345     8e-49  36%  355 aa  MNMA_PELPD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::343     8e-49  36%  344 aa  MNMA_DESPS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   60::357     1e-48  40%  361 aa  MNMA_CORA7 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::372     1e-48  35%  398 aa  MNMA_BRUME RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   45::384     1e-48  37%  385 aa  MNMA_PROM0 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::372     1e-48  35%  398 aa  MNMA_BRUSI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::376     2e-48  37%  395 aa  MNMA_CORJK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::372     2e-48  35%  398 aa  MNMA_BRUSU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::372     2e-48  35%  398 aa  MNMA_BRUO2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::372     2e-48  35%  398 aa  MNMA_BRUMB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::372     2e-48  35%  398 aa  MNMA_BRUC2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::372     2e-48  35%  398 aa  MNMA_BRUAB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::372     2e-48  35%  398 aa  MNMA_BRUA2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::372     2e-48  35%  398 aa  MNMA_BRUA1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::350     2e-48  37%  351 aa  MNMA2_BACV8 RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   21::360     2e-48  36%  380 aa  MNMA_LEPBP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::360     2e-48  36%  380 aa  MNMA_LEPBA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::375     3e-48  35%  398 aa  MNMA_SINMW RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::372     3e-48  35%  396 aa  MNMA_RHILO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   41::386     3e-48  35%  394 aa  MNMA_HYPNA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::351     3e-48  33%  353 aa  MNMA2_CLOBM RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   75::384     4e-48  38%  385 aa  MNMA_PROM9 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   53::402     4e-48  37%  404 aa  MNMA_PROM1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   45::354     5e-48  38%  372 aa  MNMA_NOCFA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   45::384     7e-48  37%  385 aa  MNMA_PROMS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   45::384     7e-48  35%  390 aa  MNMA_PROMP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::375     9e-48  35%  398 aa  MNMA_RHIME RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   45::384     9e-48  36%  385 aa  MNMA_PROM2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   37::386     1e-47  37%  388 aa  MNMA_PROMT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   60::360     1e-47  39%  365 aa  MNMA_CORGL RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   60::360     1e-47  39%  365 aa  MNMA_CORGB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   35::366     2e-47  33%  367 aa  MNMA_EHRCR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::353     2e-47  35%  356 aa  MNMA_AQUAE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::339     2e-47  36%  341 aa  MNMA_SULDN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   38::387     2e-47  35%  408 aa  MNMA_RHIL3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::339     3e-47  36%  340 aa  MNMA_SULNB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   43::352     3e-47  37%  366 aa  MNMA_PROAC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::377     3e-47  35%  400 aa  MNMA_RHOPB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::384     3e-47  35%  399 aa  MNMA_RHOBA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   46::393     3e-47  35%  431 aa  MNMA_BEII9 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::338     4e-47  38%  339 aa  MNMA_NITSB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   35::366     4e-47  33%  367 aa  MNMA_EHRCJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::372     6e-47  35%  384 aa  MNMA_METRJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   38::385     8e-47  35%  408 aa  MNMA_RHIEC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   81::440     1e-46  35%  451 aa  MTU1_DICDI RecName: Full=Mitochondrial tRNA-specific
   29::376     1e-46  36%  399 aa  MNMA_RHILW RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   60::360     1e-46  40%  365 aa  MNMA_COREF RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::371     2e-46  37%  406 aa  MNMA_CORU7 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   35::368     2e-46  37%  378 aa  MNMA_ANAPZ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   38::385     2e-46  35%  408 aa  MNMA_RHIE6 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   53::392     2e-46  37%  406 aa  MNMA_PROMA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   45::377     2e-46  36%  390 aa  MNMA_PROM5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::353     2e-46  38%  359 aa  MNMA_CHLSY RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::353     2e-46  38%  359 aa  MNMA_CHLAA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::372     2e-46  37%  407 aa  MNMA_BART1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::358     3e-46  40%  360 aa  MNMA_BDEBA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::355     4e-46  35%  358 aa  MNMA_THEP1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::372     5e-46  34%  391 aa  MNMA_BARBK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::354     6e-46  37%  364 aa  MNMA_RHOOB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::373     6e-46  36%  385 aa  MNMA_METPB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::355     6e-46  39%  380 aa  MNMA_BEUC1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::372     6e-46  36%  408 aa  MNMA_BARQU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::377     6e-46  34%  398 aa  MNMA_AGRT5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
  160::486     8e-46  36%  488 aa  MNMA_RUBXD RecName: Full=Bifunctional protein nifU/mnmA;Includes:
   44::338     8e-46  39%  356 aa  MNMA_MYCS2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::348     8e-46  38%  348 aa  MNMA_FERNB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::352     8e-46  39%  372 aa  MNMA_CORK4 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::372     1e-45  36%  409 aa  MNMA_BARHE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::341     1e-45  34%  353 aa  MNMA_PERMH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::373     2e-45  34%  400 aa  MNMA_RHOP5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::337     2e-45  36%  338 aa  MNMA_CAMLR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::373     2e-45  35%  397 aa  MNMA_BRASB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::379     3e-45  35%  380 aa  MNMA_SULMW RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   94::377     4e-45  38%  405 aa  MNMA_MARMM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::341     4e-45  34%  342 aa  MNMA_HYDS0 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::349     9e-45  35%  349 aa  MNMA_THELT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::373     9e-45  35%  377 aa  MNMA_RHORT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::377     9e-45  35%  398 aa  MNMA_RHOPS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::377     9e-45  34%  397 aa  MNMA_RHOPA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   67::350     9e-45  40%  355 aa  MNMA_FRASN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   62::358     1e-44  37%  362 aa  MNMA_SACEN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::367     1e-44  36%  373 aa  MNMA_MAGSA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   64::350     2e-44  38%  363 aa  MNMA_THEFY RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::372     2e-44  35%  391 aa  MNMA_MESSB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   31::359     2e-44  36%  390 aa  MNMA_AZOC5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   32::362     3e-44  33%  399 aa  MNMA_PARL1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   27::371     3e-44  35%  383 aa  MNMA_CAUCR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   66::355     4e-44  37%  358 aa  MNMA_THEMA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::354     4e-44  37%  364 aa  MNMA_RHOSR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::332     6e-44  39%  346 aa  MNMA_DESVV RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   19::332     6e-44  39%  346 aa  MNMA_DESVH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::338     8e-44  38%  357 aa  MNMA_MYCGI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   54::401     8e-44  35%  409 aa  MNMA_CAUSK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::353     1e-43  37%  356 aa  MNMA_MYCA9 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::341     1e-43  34%  342 aa  MNMA_HELPS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::343     1e-43  37%  345 aa  MNMA_HELHP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::365     1e-43  37%  378 aa  MNMA_RENSM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   87::377     2e-43  40%  382 aa  MNMA_SPHAL RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::341     2e-43  36%  342 aa  MNMA_HELPH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   84::378     2e-43  38%  384 aa  MNMA_ERYLH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::341     2e-43  36%  342 aa  MNMA_HELPJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::338     2e-43  34%  338 aa  MNMA_CAMJD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::341     3e-43  36%  342 aa  MNMA_HELPY RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::338     3e-43  34%  338 aa  MNMA_CAMJR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::338     3e-43  34%  338 aa  MNMA_CAMJE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   32::360     4e-43  36%  389 aa  MNMA_XANP2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   21::359     5e-43  35%  360 aa  MNMA_UNCTG RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::353     5e-43  36%  358 aa  MNMA_MYCPA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::342     7e-43  33%  345 aa  MNMA1_ARCB4 RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   17::338     9e-43  34%  338 aa  MNMA_CAMJ8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::353     1e-42  36%  358 aa  MNMA_MYCA1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::338     1e-42  34%  338 aa  MNMA_CAMJJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::373     1e-42  34%  397 aa  MNMA_BRASO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::373     1e-42  36%  393 aa  MNMA_BRAJA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::360     1e-42  36%  370 aa  MNMA_RHOE4 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::280     1e-42  38%  385 aa  MNMA_METEP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   32::370     2e-42  34%  371 aa  MNMA_PELUB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   85::375     3e-42  37%  384 aa  MNMA_NOVAD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::341     3e-42  35%  342 aa  MNMA_HELPG RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::370     3e-42  32%  392 aa  MNMA_RHOCS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::372     3e-42  33%  393 aa  MNMA_OLICO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::373     4e-42  34%  382 aa  MNMA_METS4 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::380     7e-42  33%  398 aa  MNMA_RHOP2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   55::347     1e-41  39%  351 aa  MNMA_DESVM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::368     1e-41  34%  370 aa  MNMA2_BACTN RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   43::329     2e-41  36%  339 aa  MNMA_THEM4 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::354     2e-41  34%  361 aa  MNMA_GLUDA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::369     2e-41  36%  379 aa  MNMA_ARTAT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::341     3e-41  33%  342 aa  MNMA_HELAH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::356     5e-41  33%  361 aa  MNMA_GLUOX RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   35::369     5e-41  32%  370 aa  MNMA_EHRRG RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   64::352     6e-41  37%  362 aa  MNMA_ACIC1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::363     8e-41  37%  387 aa  MNMA_CLAM3 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::369     8e-41  37%  379 aa  MNMA_ARTS2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   62::357     1e-40  39%  366 aa  MNMA_NOCSJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::358     1e-40  33%  364 aa  MNMA1_BACFR RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   17::338     1e-40  38%  345 aa  MNMA_WOLSU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::363     2e-40  38%  397 aa  MNMA_CLAMS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   35::369     4e-40  32%  370 aa  MNMA_EHRRW RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::353     7e-40  36%  358 aa  MNMA_MYCLE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::353     7e-40  36%  358 aa  MNMA_MYCLB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::365     9e-40  38%  378 aa  MNMA_MICLC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   64::347     9e-40  39%  352 aa  MNMA_FRAAA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   45::386     2e-39  33%  389 aa  MNMA_PARDP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   20::325     2e-39  36%  338 aa  MNMA_CAMFF RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::348     2e-39  35%  349 aa  MNMA_ANADF RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   64::359     3e-39  37%  366 aa  MNMA_LEIXX RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   65::358     4e-39  37%  360 aa  MNMA_SALAI RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   95::359     4e-39  38%  367 aa  MNMA_PETMO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   29::371     1e-38  33%  382 aa  MNMA_METNO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   62::372     2e-38  36%  383 aa  MNMA_KOCRD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::339     3e-38  30%  339 aa  MNMA_CAMC5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::264     3e-38  37%  343 aa  MNMA2_FUSNN RecName: Full=tRNA-specific 2-thiouridylase mnmA 2;    
   44::353     6e-38  34%  357 aa  MNMA_MYCVP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   73::371     8e-38  34%  375 aa  MNMA_SILPO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   76::374     1e-37  35%  379 aa  MNMA_RHOS4 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   76::374     1e-37  35%  379 aa  MNMA_RHOS1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   37::379     1e-37  33%  380 aa  MNMA_ROSDO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   52::304     1e-37  37%  352 aa  MNMA_LAWIP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::347     2e-37  32%  364 aa  MNMA1_BACFN RecName: Full=tRNA-specific 2-thiouridylase mnmA 1;    
   18::358     2e-37  32%  358 aa  MNMA_THENN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   72::361     2e-37  37%  376 aa  MNMA_STRAW RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   79::377     2e-37  34%  381 aa  MNMA_SILST RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   22::324     2e-37  37%  356 aa  MNMA_DESDG RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   70::365     4e-37  37%  378 aa  MNMA_STRGG RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   72::356     5e-37  38%  376 aa  MNMA_STRCO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::339     5e-37  30%  340 aa  MNMA_CAMC1 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   82::380     1e-36  33%  384 aa  MNMA_DINSH RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   76::374     2e-36  34%  379 aa  MNMA_RHOSK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::353     3e-36  34%  363 aa  MNMA_MYCUA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::353     3e-36  34%  363 aa  MNMA_MYCMM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   64::347     3e-36  37%  352 aa  MNMA_FRASC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::351     4e-36  36%  359 aa  MNMA_TROWT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   25::351     4e-36  36%  359 aa  MNMA_TROW8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::338     5e-36  34%  359 aa  MNMA_MYCSJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::338     6e-36  34%  359 aa  MNMA_MYCSS RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   44::338     6e-36  34%  359 aa  MNMA_MYCSK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   79::379     8e-36  33%  380 aa  MNMA_JANSC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   50::338     8e-36  34%  343 aa  MNMA_DESAP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   45::379     1e-35  33%  385 aa  MNMA_SORC5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   76::361     1e-34  33%  378 aa  MNMA_RHOS5 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::344     3e-34  33%  345 aa  MNMA_ACICJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   18::355     1e-33  31%  358 aa  MNMA_THESQ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::361     2e-33  34%  368 aa  MNMA_CAMHC RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::372     2e-33  30%  400 aa  MNMA_NITWN RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   64::353     5e-33  34%  367 aa  MNMA_MYCTU RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   64::353     5e-33  34%  367 aa  MNMA_MYCTA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   64::353     5e-33  34%  367 aa  MNMA_MYCBT RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   64::353     5e-33  34%  367 aa  MNMA_MYCBP RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   64::353     5e-33  34%  367 aa  MNMA_MYCBO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   92::365     1e-32  37%  365 aa  MNMA_KINRD RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   17::350     1e-32  31%  351 aa  MNMA_ANADE RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   65::358     1e-29  33%  360 aa  MNMA_SALTO RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   30::376     2e-29  29%  400 aa  MNMA_NITHX RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   37::101     6e-04  38%  252 aa  XNI_SHEHH RecName: Full=Uncharacterized exonuclease xni;       
  100::196     6e-04  35%  226 aa  QUEC_HELPY RecName: Full=Queuosine biosynthesis protein queC;      
    1::368

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSESPKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_SALTI      MSESPKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_SALPB      MSESPKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_SALPA      MSESPKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_SALCH      MSESPKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_SALTY      MSESPKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_SALAR      MSESPKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_CITK8      MSESPKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_ECOSM      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_ECOLI      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_ECOLC      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_ECOHS      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_ECODH      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_ECO57      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_ECO24      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_ECOUT      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_ECOL5      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_ECOK1      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_SHISS      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_SHIFL      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_SHIF8      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_SHIDS      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_SHIBS      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_SHIB3      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_ECOL6      MSETAKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_ENT38      MSASPKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_KLEP3      MSESQKKXXXXXXXXXXXXXXAYLLLQQGYKVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_KLEP7      MSESQKKXXXXXXXXXXXXXXAYLLLQQGYKVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
MNMA_ENTS8      ---------------------AWLLQQQGYQVEGLFMKNWEEDDGEDYCTAASDLADAQAVCDKLGIELH
MNMA_SERP5      ---------------------AYLLQQQGYQVAGLFMKNWEEDDDEEYCSAATDLADAQAVCDKLGIELH
MNMA_YERE8      ---------------------AYLLQQQGYQVAGLFMKNWEEDDGEEYCSAATDLADAQAVCDKLGMELH
MNMA_PHOLL      ---------------------AYLLQQQGYQVAGLFMKNWEEDDDEEYCSAATDLADAQSVCDKLGIELH
MNMA_PROMH      ---------------------AYLLKEQGYQVVGLFMKNWEEDDDTEYCSASADLADAQAVCDKLGIELH
MNMA_YERP3      ---------------------AYLLQQQGYQVAGLFMKNWEEDDDEEYCSAATDLADAQAVCDKLGMELH
MNMA_YERPY      ---------------------AYLLQQQGYQVAGLFMKNWEEDDDEEYCSAATDLADAQAVCDKLGMELH
MNMA_YERPS      ---------------------AYLLQQQGYQVAGLFMKNWEEDDDEEYCSAATDLADAQAVCDKLGMELH
MNMA_YERPP      ---------------------AYLLQQQGYQVAGLFMKNWEEDDDEEYCSAATDLADAQAVCDKLGMELH
MNMA_YERPN      ---------------------AYLLQQQGYQVAGLFMKNWEEDDDEEYCSAATDLADAQAVCDKLGMELH
MNMA_YERPG      ---------------------AYLLQQQGYQVAGLFMKNWEEDDDEEYCSAATDLADAQAVCDKLGMELH
MNMA_YERPE      ---------------------AYLLQQQGYQVAGLFMKNWEEDDDEEYCSAATDLADAQAVCDKLGMELH
MNMA_YERPB      ---------------------AYLLQQQGYQVAGLFMKNWEEDDDEEYCSAATDLADAQAVCDKLGMELH
MNMA_YERPA      ---------------------AYLLQQQGYQVAGLFMKNWEEDDDEEYCSAATDLADAQAVCDKLGMELH
MNMA_PECCP      ---------------------AYLLQQQGYHVEGLFMKNWEEDDDTEYCSAATDLADAQAVCDKLGIELH
MNMA_SODGM      ---------------------AWLLQQQGYRVEGLFMKNWEEDDNEEYCTAASDLADARAVCDTLGIALH
MNMA_ERWCT      ---------------------AYLLQQQGYHVEGLFMKNWEEDDDTEYCSAATDLADAQAVCDKLGIELH
MNMA_EDWI9      ---------------------AYLLQQQGYQVAGLFMKNWEEDDSDEYCSAATDLADAQAVCDRLGIELH
MNMA_SHEAM      ---------------------AYLLKQQGYQVEGLFMKNWEEDDTDEYCAAAEDLKDAQAVCDKLGIKLH
MNMA_HAEI8      ---------------------AFILQQQGYQVEGLFMKNWEEXXXXXXXXXXXXXXXXXXXXXKLGIKLH
MNMA_HAEIN      ---------------------AFILQQQGYQVEGLFMKNWEEXXXXXXXXXXXXXXXXXXXXXKLGIKLH
MNMA_SHELP      ---------------------AYLLMQQGYQVEGLFMKNWEEDDTDEYCAAAEDLKDAQAVCDKLGIKLH
MNMA_HAES1      ---------------------AFILQQQGYQVEGLFMKNWEEDDDTDYCTAANDLADAQAVCDKLGIKLH
MNMA_HAEIG      ---------------------AFILQQQGYQVEGLFMKNWEEXXXXXXXXXXXXXXXXXXXXXKLGIKLH
MNMA_HAES2      ---------------------AFILQQQGYQVEGLFMKNWEEDDDTDYCTAANDLADAQAVCDKLGIKLH
MNMA_PSYIN      ---------------------AYLLQQQGYLVEGLFMKNWEEDDTDQYCAAAQDLEDAQSVCDKLGIPLH
MNMA_PHOPR      ---------------------AYLLLQQGYQVEGLFMKNWEEDDNEEYCSAAEDLADAQAVCDKLGIHLH
MNMA_SHEON      ---------------------AYLLMQQGYQVEGLFMKNWEEDDNDEYCAAAEDLKDAQAVCDKLGIKLH
MNMA_SHEHH      ---------------------AYLLMKQGYQVEGLFMKNWEEDDTDEYCAAADDLKDAQAVCDKLGIKLH
MNMA_AERS4      ---------------------AYLLQQQGYQVEGLFMKNWEEDDTDEYCSASQDLADAKAVCDKLGMKLH
MNMA_SHEPW      ---------------------AYLLMKQGYQVEGLFMKNWEEDDTDEYCAAADDLKDAQAVCDKLGIKLH
MNMA_AERHH      ---------------------AYLLQQQGYQVEGLFMKNWEEDDTDEYCSAAQDLADAKAVCDKLGMKLH
MNMA_ACTPJ      ---------------------AFILQQQGYQVEGLFMKNWEEXXXXXXXXXXXXXXXXXXXXXKLGMKLH
MNMA_SHESW      ---------------------AYLLMQQGYQVEGLFMKNWEEDDNNEYCAAAEDLKDAQAVCDKLGIKLH
MNMA_SHEB9      ---------------------AYLLMQQGYQVEGLFMKNWEEDDNNEYCAAAEDLKDAQAVCDKLGIKLH
MNMA_SHEPC      ---------------------AYLLMQQGYQVEGLFMKNWEEDDNNEYCAAAEDLKDAQAVCDKLGIKLH
MNMA_SHEB8      ---------------------AYLLMQQGYQVEGLFMKNWEEDDNNEYCAAAEDLKDAQAVCDKLGIKLH
MNMA_SHEPA      ---------------------AYLLMKQGYQVEGLFMKNWEEDDTDEYCAAADDLKDAQAVCDKLGIKLH
MNMA_ACTP2      ---------------------AFILQQQGYQVEGLFMKNWEEXXXXXXXXXXXXXXXXXXXXXKLGMKLH
MNMA_SHEB5      ---------------------AYLLMQQGYQVEGLFMKNWEEDDNNEYCAAAEDLKDAQAVCDKLGIKLH
MNMA_SHEB2      ---------------------AYLLMQQGYQVEGLFMKNWEEDDNNEYCAAAEDLKDAQAVCDKLGIKLH
MNMA_SHESH      ---------------------AYLLLKQGYQVEGLFMKNWEEDDTDEYCAAADDLKDAQAVCDKLGIKLH
MNMA_VIBPA      ---------------------AYLLKQQGYQVEGLFMKNWEEDDNEEYCTAAEDLADAQAVCDKLGIHLH
MNMA_MANSM      ---------------------AFILQQQGYQVEGLFMKNWEEXXXXXXXXXXXXXXXXXXXXXKLGMKLH
MNMA_VIBCH      ---------------------AYLLKQQGYQVEGLFMKNWEEDDNEEYCTAAEDLADAQAVCDKLGIPLH
MNMA_VIBC3      ---------------------AYLLKQQGYQVEGLFMKNWEEDDNEEYCTAAEDLADAQAVCDKLGIPLH
MNMA_VIBVY      ---------------------AYLLKQQGYQVEGLFMKNWEEDDDSEYCTAAEDLADAQAVCDKLGIHLH
MNMA_SHEWM      ---------------------AYLLLKQGYQVEGLFMKNWEEDDTDEYCAAADDLKDAQAVCDKLGIKLH
MNMA_TOLAT      ---------------------AYLLQQQGYQVEGLFMKNWEEDDSDEYCSAATDLADAQAVCDKLGIKLH
MNMA_SHEDO      ---------------------AYLLMQQGYEVEGLFMKNWEEDDTDEYCAAADDLKDAQAVCDKLGIKMH
MNMA_VIBVU      ---------------------AYLLKQQGYQVEGLFMKNWEEDDDSEYCTAAEDLADAQAVCDKLGIHLH
MNMA_VIBFM      ---------------------AYLLQQQGYQVEGLFMKNWEEDDNEEYCTAAEDLADAQAVCDKLGIHLH
MNMA_VIBF1      ---------------------AYLLQQQGYQVEGLFMKNWEEDDNEEYCTAAEDLADAQAVCDKLGIHLH
MNMA_HAEDU      ---------------------AFILQQQGYQVEGLFMKNWEEXXXXXXXXXXXXXXXXXXXXXRLGIKLH
MNMA_VIBHB      ---------------------AYLLKQQGYQVEGLFMKNWEEDDNEEYCTAAEDLADAQAVCDKLDIHLH
MNMA_PSEHT      ---------------------AYLLKQQGYQVEGLFMKNWEEDDNDEYCAAADDLKDAQAVCDKLGIELH
MNMA_IDILO      MSNASKKXXXXXXXXXXXXXXAYLLMQQGYQVEGLFMKNWEEDDTDEYCAASDDLADAEKVCETLGIELH
MNMA_BAUCH      ---------------------ALLLLQQGYTVEGLFMKNWEEDDHEQYCTVAKDLADAQAVCNQLGIILH
MNMA_SHESM      ---------------------AYLLMQQGYQVEGLFMKNWEEDDNDEYCAAAEDLKDAQAVCDKLGIKLH
MNMA_SHESR      ---------------------AYLLMQQGYQVEGLFMKNWEEDDNDEYCAAAEDLKDAQAVCDKLGIKLH
MNMA_PASMU      ---------------------AFILQQQGYQVEGLFMKNWEEXXXXXXXXXXXXXXXXXXXXXKLGIKLH
MNMA_COLP3      ---------------------AYLLKEQGYQVEGLFMKNWEEDDTDEYCAASQDLEDAQAICDKLDIKLH
MNMA_SHESA      ---------------------AYLLMQQGYQVEGLFMKNWEEDDNDEYCAAAEDLKDAQAVCDKLGIKLH
MNMA_SHEFN      ---------------------AYLLMQQGFEVEGLFMKNWEEDDTDEYCAAADDLKDAQAVCDKLGIKMH
MNMA_PSEA6      -SNSQKKXXXXXXXXXXXXXXAYILLQQGYQVEGLFMKNWEEDDNDEYCAAADDLKDAQAVADKLGIVLH
MNMA_ACTSZ      ---------------------AFILQQQGYQVEGLFMKNWEEXXXXXXXXXXXXXXXXXXXXXKLGIRLH
MNMA_BLOPB      ---------------------AWLLQQQGYKVEGLFMKNWEDDDSTEQCASASDLSDTHSVCDNLGIYLH
MNMA_PSEU2      -----------------------LLMEQGYQVEGLFMKNWEEDDGTEYCTAREDLADAQAVCDKIGIKLH
MNMA_PSE14      -----------------------LLMEQGYQVEGLFMKNWEEDDGTEYCTAREDLADAQAVCDKIGIKLH
MNMA_PSEFS      -----------------------LLMEQGYEVEGLFMKNWEEDDGTEYCTAMDDLADAQAVCDKIGIKLH
MNMA_PSESM      -----------------------LLMEQGYQVEGLFMKNWEEDDGTEYCTAREDLADAQAVCDRIGIKLH
MNMA_MARMS      ---------------------ALILMQQGYQVEGLFMKNWDEDDGTEYCTAKDDLADAQAVSDKLGIKLH
MNMA_PSEU5      ---------------------ALLLLEQGYQVEGLFMKNWEEDDGTEYCTAKEDLADAQAVCDRIGIKLH
MNMA_PSYWF      -----------------------LLQQAGFQVEGLFMKNWEEDDGTEYCTAMEDLADAQAVCDKIGINLH
MNMA_PSEMY      ---------------------ALLLMEQGYQVEGLFMKNWDEDDGTEYCTAMDDLADAQAVCDRIGIKLH
MNMA_PSEPF      ---------------------ALLLIEQGYEVEGLFMKNWEEDDGTEYCTAMDDLADAQAVCDKIGIKLH
MNMA_PSEF5      ---------------------ALLLMEQGYQVEGLFMKNWEEDDGTEYCTAMDDLADAQAVCDKIGIKLH
MNMA_PSEA7      ---------------------ALLLQQQGYQVEGLFMKNWDEDDGTEYCTAREDLADAQAVCDRIGIKLH
MNMA_PSEPW      ---------------------ALLLMEQGYQVEGLFMKNWEEDDGTEYCTAREDLADAQAVCDRIGIKLH
MNMA_PSEE4      ---------------------ALLLMEQGYQVEGLFMKNWEEDDGTEYCTAREDLADAQAVCDRIGIKLH
MNMA_PSEPG      ---------------------ALLLIEQGYQVEGLFMKNWEEDDGTEYCTAREDLADAQAVCDRIGIKLH
MNMA_SACD2      ---------------------ALLLKQQGYKVEGLFMKNWDEDDGTEYCTAMTDLMDAAAVCQKLDIHLH
MNMA_PSEPK      ---------------------ALLLIEQGYQVEGLFMKNWEEDDGTEYCTAREDLADAQAVCDRIGIKLH
MNMA_PSEP1      ---------------------ALLLIEQGYQVEGLFMKNWEEDDGTEYCTAREDLADAQAVCDRIGIKLH
MNMA_PSEA8      ---------------------ALLLLQQGYQVEGLFMKNWDEDDGTEYCTAREDLADAQAVCDRIGIKLH
MNMA_PSEAE      ---------------------ALLLLQQGYQVEGLFMKNWDEDDGTEYCTAREDLADAQAVCDRIGIKLH
MNMA_PSEAB      ---------------------ALLLLQQGYQVEGLFMKNWDEDDGTEYCTAREDLADAQAVCDRIGIKLH
MNMA_METCA      ---------------------ALLLLRQGYRVSGLFMKNWEEDDGTEYCTAAQDFADAKQVCERLGVELH
MNMA_MARAV      ---------------------AWLLKDQGYQVEGLFMKNWDEDDGTEYCTAMTDLADAQAVADAIGIKLH
MNMA_PSYA2      -----------------------LLQQAGFVVEGLFMKNWEEDDGTEYCTAMDDLADAQAVCDKIGIKLH
MNMA_PSYCK      -----------------------LLQQAGFMVEGLFMKNWEEDDGTEYCTAMDDLADAQAVCDKIGIKLH
MNMA_FRAP2      ---------------------ALLLKQQGYDVTGVFMKNWEEDDTDEFCSAEQHIADAQAVCDSIGIPFK
MNMA_FRATT      ---------------------ALLLKQQGYDVTGVFMKNWEEDDTDEFCSAEQDIADAQAVCDSIGIPFK
MNMA_FRATM      ---------------------ALLLKQQGYDVTGVFMKNWEEDDTDEFCSAEQDIADAQAVCDSIGIPFK
MNMA_FRAT1      ---------------------ALLLKQQGYDVTGVFMKNWEEDDTDEFCSAEQDIADAQAVCDSIGIPFK
MNMA_BUCAP      ---------------------AWFLKNENYQVEGLFMKNWEEDDEKEYCNAAKDLSDAEEVCKKLNIHLH
MNMA_ACIBS      ---------------------AALLLQQGYQVEGLFMKNWEEDDGTEYCTAMEDLADAQAVADKIGIKLH
MNMA_ACIBY      ---------------------AALLLQQGYQVEGLFMKNWEEDDGTEYCTAMEDLADAQAVADKIGIKLH
MNMA_ACIBT      ---------------------AALLLQQGYQVEGLFMKNWEEDDGTEYCTAMEDLADAQAVADKIGIKLH
MNMA_ACIB5      ---------------------AALLLQQGYQVEGLFMKNWEEDDGTEYCTAMEDLADAQAVADKIGIKLH
MNMA_ACIB3      ---------------------AALLLQQGYQVEGLFMKNWEEDDGTEYCTAMEDLADAQAVADKIGIKLH
MNMA_FRATN      ---------------------ALLLKQQGYDVTGVFMKNWEEDDTDEFCSAEQDIADAQAVCDSIGIPFK
MNMA_ACIBC      ---------------------AALLLQQGYQVEGLFMKNWEEDDGTEYCTAMEDLADAQAVADKIGIKLH
MNMA_FRATW      ---------------------ALLLKQQGYDVTGVFMKNWEEDDTDEFCSAEQDIADAQAVCDSIGIPFK
MNMA_FRATO      ---------------------ALLLKQQGYDVTGVFMKNWEEDDTDEFCSAEQDIADAQAVCDSIGIPFK
MNMA_FRATH      ---------------------ALLLKQQGYDVTGVFMKNWEEDDTDEFCSAEQDIADAQAVCDSIGIPFK
MNMA_FRATF      ---------------------ALLLKQQGYDVTGVFMKNWEEDDTDEFCSAEQDIADAQAVCDSIGIPFK
MNMA_BLOFL      ---------------------AWLLQQQGYLVEGLFMKNWENDDEKEYCSSEEDLSDAWSICNTLKIPLH
MNMA_ALKOO      MSKAPKKVVIGMSGGVDSSVAALLLKQQGYDVVGIFMKNWDESDELGYCTSAEDYEDVRRVCDQIGIPYY
MNMA_ACIAD      ---------------------AALLLQQGYQVEGLFMKNWEEDDGTEYCTALEDLADAQAVADKIGIKLH
MNMA_CHRSD      ---------------------ALTLLEQGYAVEGLFMKNWDEDDGTEYCTAKEDLADAQAVCDTLGITLH
MNMA_HAHCH      ---------------------AYLLKALGYEVEGLFMKNWDEDDGTEYCTALSDLEDAQKVCDKLGIKLH
MNMA_LACC3      ---------------------ALLLKQQGYDVVGVFMKNWDDTDENGVCTATTDYEDVAKVASEIGIPYY
MNMA_CUPTR      ---------------------AWLLKQQGYEVIGLFMKNWEDDDDSEYCSTRQDWLDVVSVADLIGVDVE
MNMA_EXIS2      ---------------------AYLLKQQGYNVIGIFMKNWDDTDENGFCTATEDYEDVIAVANQIGIPYY
MNMA_LYSSC      ---------------------AYLLKQQGYEVIGIFMKNWDDTDENGVCTATEDYDDVIKVCNQIGIPYY
MNMA_RALEH      ---------------------AWLLKQQGYEVIGLFMKNWEDDDDSEYCSTRQDWLDVVSVADLIGVDVE
MNMA_METFK      ---------------------ALLLKEQGYEVVGLFMKNWEDDDTDEYCPAKQDLIDAAAVADKIGIELE
MNMA_NITEU      ---------------------ALLLKQQGYDVTGLFMKNWEEDDTDEYCSSRQDFLDAASVADILDIPLE
MNMA_ALKMQ      ------------------------LKEQGYDVIGIFMKNWDEPDEYGYCTAAEDYEDVRRVCEQIGIPYY
MNMA_CHRVO      ---------------------AWLLKQQGHEVIGVFMQNWEDDNDDEYCSIKQDALDAMSVADIVGIDME
MNMA2_GEOKA     ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYEDVVRVCNQIGIPYY
MNMA_GEOTN      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYEDVVRVCNQIGIPYY
MNMA_BACLD      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGFCTATEDYEDVIKVCNQIGIPYY
MNMA_BACCN      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_POLSQ      ---------------------AWMLKEQGFEVIGLFMKNWEDDDNDEYCSARQDWLDVVSVADMIGIDVE
MNMA_RALEJ      ---------------------AWLLKQQGYEVIGLFMKNWEDDDDSEYCSTRQDWLDVVSVADLIGVDVE
MNMA_BURCC      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_STACT      ---------------------AYLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIAVCNQIGIPYY
MNMA_BORA1      ---------------------AWLLKQQGYEVVGLFMKNWEDDDDSEYCSTRQDLLDAASVADLIGVEFE
MNMA_BACHK      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_BACCZ      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_BACCQ      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_BACAN      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_BACAH      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_BORPD      ---------------------AWLLKQQGYEVIGLFMKNWEDDDDSEYCSTRQDLLDAASVADLVGVDFE
MNMA_AZOSE      ---------------------ALLLKQQGFDVTGLFMKNWEDDDDDEYCSTRQDLVDVASVCDVIGIDLE
MNMA_LISMO      ---------------------AHILKEQGYDVIGIFMKNWDDTDEFGVCTATEDYDDVIRVANQIGIPYY
MNMA_BACCR      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_BACC1      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_AZOSB      ---------------------ALLLKQQGYEVTGLFMKNWEDDDDDEYCSTRQDLVDVASVCDVIGIDLE
MNMA_ALCBS      ----------------------------GYQVEGLFMKNWNEDDGTDYCTAREDLLDAMQVAGVLGIELH
MNMA_XANCP      ---------------------AWKLAQDGEPIAGLFMQNWA-DDGSGDCRAEDDRRDAVAVCGVLGIPFH
MNMA_XANCB      ---------------------AWKLAQDGEPIAGLFMQNWA-DDGSGDCRAEDDRRDAVAVCGVLGIPFH
MNMA_XANC8      ---------------------AWKLAQDGEPIAGLFMQNWA-DDGSGDCRAEDDRRDAVAVCGVLGIPFH
MNMA_LISIN      ---------------------AHILKEQGYDVIGIFMKNWDDTDEFGVCTATEDYDDVIRVANQIGIPYY
MNMA_BURPS      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_BURP6      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_THICR      ---------------------ALLLKQQGYDVEGLFMKNWEGDDTEDYCPAAEDLKDVLAICEKLDIPLH
MNMA_BURMS      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_BURMA      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_BURM9      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_BURM7      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_BACWK      ---------------------ALLLKEQGYDVIGIFMKNWDDTDANGVCTATEDYNDVIEVCNQIGIPYY
MNMA_RALME      ---------------------AWLLKQQGYEVIGLFMKNWEDDDDSEYCSTRQDWLDVASVADVIGVDVE
MNMA_LISMF      ---------------------AHILKEQGYDVIGIFMKNWDDTDEFGVCTATEDYDDVIRVANQIGIPYY
MNMA_LISMC      ---------------------AHILKEQGYDVIGIFMKNWDDTDEFGVCTATEDYDDVIRVANQIGIPYY
MNMA_LISW6      ---------------------AHILKEQGYDVIGIFMKNWDDTDEFGVCTATEDYDDVIRVANQIGIPYY
MNMA_BURP1      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_BURP0      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_STRZP      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPYY
MNMA_STRPJ      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPYY
MNMA_LISMH      ---------------------AHILKEQGYDVIGIFMKNWDDTDEFGVCTATEDYDDVIRVANQIGIPYY
MNMA_STRSY      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGFCTATEDYKDVAAVADQIGIPYY
MNMA_STRS2      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGFCTATEDYKDVAAVADQIGIPYY
MNMA_STRPS      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPYY
MNMA_STRR6      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPYY
MNMA_STRP2      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPYY
MNMA_STAS1      ---------------------AHILKEQGYDVIGIFMKNWDNTDENGYCTATEDYNDVIAVCNQIGIPYY
MNMA_BURTA      ---------------------AWLLKEQGYDVIGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_STRP7      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPYY
MNMA_STAAB      ---------------------AHVLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_BUCAI      ---------------------AWILKKQNYQVEGLFMKNWEEDDQEGYCSSTKDLLDAENICKKLNIYLH
MNMA_STRZT      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPYY
MNMA_STRPN      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPYY
MNMA_STRPI      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPYY
MNMA_BURCM      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_NEIM0      ---------------------AALLKQQGYQVRGVFMQNWEDDDNDEYCSIKQDSFXXXXXXXXXXXXXX
MNMA_LACLA      ---------------------ALLLKEQGYDVIGVFMKNWDDTDENGVCTATEDYKDVAAVADQIGVPYY
MNMA_XANC5      ---------------------AWKLAQQGEPIAGLFMQNWA-DDGSGDCRAEDDRRDAVAVCGVLGIPFH
MNMA_NEIMB      ---------------------AALLKQQGYQVRGVFMQNWEDDDNDEYCSIKQDSFXXXXXXXXXXXXXX
MNMA_BURXL      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDSEYCSTRQDWIDVVSVADLIGIDVE
MNMA_STAAT      ---------------------AHVLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_STAAR      ---------------------AHVLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_STAAN      ---------------------AHVLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_STAAM      ---------------------AHVLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_STAAE      ---------------------AHVLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_STAAC      ---------------------AHVLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_STAA9      ---------------------AHVLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_STAA8      ---------------------AHVLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_STAA3      ---------------------AHVLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_STAA2      ---------------------AHVLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_STAA1      ---------------------AHVLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_XANAC      ---------------------AWKLAQQGEPIAGLFMQNWA-DDGSGDCRAEDDRRDAVAVCGVLGIPFH
MNMA_STRP4      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPYY
MNMA_NITEC      ---------------------ALLLKQQGYDVIGLFMKNWEDDDTDEYCSSRKDFLDAASVADILDIPLE
MNMA_NEIMF      ---------------------AALLKQQGYQVRGVFMQNWEDDDNDEYCSIKQDSFXXXXXXXXXXXXXX
MNMA_STAAW      ---------------------AHVLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_STAAS      ---------------------AHVLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYY
MNMA_STRGC      ---------------------ALLLKEQGYDVIGIFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_LACS1      ---------------------AYLLKQQGYDVVGVFMKNWDDKNDSGVCTVTEDYQDVAKVASQIGIPYY
MNMA_LACRJ      ---------------------ALLLKRQGYDVVGVFMKNWDDTDENGVCTATEDYKDVAKVASKIGIPYY
MNMA_LACRD      ---------------------ALLLKRQGYDVVGVFMKNWDDTDENGVCTATEDYKDVAKVASKIGIPYY
MNMA_STRZJ      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPYY
MNMA_STRMU      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_RALPJ      ---------------------AWLLKQQGYDVVGLFMKNWEDDDDSEYCSTRQDWIDVVSVADLIGVDVE
MNMA_LACLM      ---------------------ALLLKEQGYDVIGVFMKNWDDTDENGVCTATEDYKDVAAVADQIGVPYY
MNMA_LACAC      ---------------------ALLLKQQGYDVVGVFMKNWDDTDDSGVCTATEDYEDVKKVADKIGIPYY
MNMA_XANOR      ---------------------AWKLAQQGEPIAGLFMQNWA-DDGSGDCRAEDDRRDAVAVCGVLGMPFH
MNMA_XANOP      ---------------------AWKLAQQGEPIAGLFMQNWA-DDGSGDCRAEDDRRDAVAVCGVLGMPFH
MNMA_THIDA      ---------------------AYLLKQQGYDVLGVFMKNWDDDDNTEHCTARQDFLDVLAVADVLGIEVE
MNMA_HERAR      ---------------------AWLLKEQGYEVIGLFMKNWEDDDDSEYCSTRQDWIXXXXXXXXXXXXIE
MNMA_BURM1      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_STAHJ      ---------------------AHVLKDQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIAVCNQIGIPYY
MNMA_LACLS      ---------------------ALLLKEQGYDVIGVFMKNWDDTDENGVCTATEDYKDVAAVADQIGVPYY
MNMA_BUCBP      ---------------------AWILKKKGYHVEGLFMKNWEESDSDMHCSSKKDLSDAQGVCNQLNIFLH
MNMA_RALSO      ---------------------AWLLKQQGYEVIGLFMKNWEDDDDSEYCSTRQDWIDVVSVADLIGVDVE
MNMA_NEIG1      ---------------------AALLKQQGYQVRGVFMQNWENDDNDEYCSIKQDSFXXXXXXXXXXXXXX
MNMA_BURPP      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDSEYCSTRQDWIDVVSVADLIGIDVE
MNMA_BURA4      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_STAES      ---------------------AYLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIAVCNQIGIPYY
MNMA_STAEQ      ---------------------AYLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIAVCNQIGIPYY
MNMA_XANOM      ---------------------AWKLAQQGEPIAGLFMQNWA-DDGSGDCRAEDDRRDAVAVCGVLGMPFH
MNMA_STRMK      ---------------------AWRLVQQGEAVAGLFMQNWA-DDGSGDCRAEDDRRDAVAVCGLLGIPFH
MNMA_STRA5      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_STRA3      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_STRM5      ---------------------AWRLVQQGEAVAGLFMQNWA-DDGSGECRAEDDRRDAVAVCGLLGIPFH
MNMA_STRSV      ---------------------ALLLKEQGYDVIGIFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_JANMA      ---------------------AWLLKEQGYEVIGLFMKNWEDDDDSEYCSTRQDWIXXXXXXXXXXXXIE
MNMA_LACGA      ---------------------ALLLKQQGFDVVGVFMKNWDDTDDSGVCTATEDYEDVKKVADEIGIPYY
MNMA_BURS3      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_STRA1      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_LACJO      ---------------------ALLLKQQGFDVVGVFMKNWDDTDDSGVCTATEDYEDVKKVADEIGIPYY
MNMA_LACBA      ------------------------LKQQGYDVIGVFMKNWDDTDENGVCTATEDYKDVAKVAAKIGIPYY
MNMA_DIAST      ---------------------AHLLKQQGHEVVGIFMKNWEDDDDSEFCSSRQDFLDAASVADVIGIEIE
MNMA_BACHD      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYQDVVQVCNQLGIAYY
MNMA_STRU0      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_DECAR      ---------------------ALLLKQQGWNVIGLFMKNWEDDDTEEYCSSRQDLIDVMSVADKIGIDVE
MNMA_STRT2      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIDIPYY
MNMA_STRT1      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIDIPYY
MNMA_STRPZ      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_NITOC      ------------------------LQQQGYPTSGLFMKNWVDFADESECTVAQDREDAQAVTSLLGISFH
MNMA_LACSS      ---------------------ALLLKQQGYDVIGVFMKNWDDTDENGVCTATEDYEDVAKVASKIGIPYY
MNMA_BURCJ      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_LEGPL      ---------------------AWLLKEQGYQVEGLFMKNWEQDDHNDYCPAAKDLADAQAVCNQLRIPLH
MNMA_BACSU      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGFCTATEDYEDVIRVCNQIGIPYY
MNMA_ALHEH      ---------------------AMRLLEAGHHVEGLFMKNWEDDDTLTHCAAEEDLAEAQAVADHLGIRLH
MNMA_ACIAC      ---------------------AHLLKQQGHEVVGIFMKNWEDDDDSEYCSSNXXXXXXXXXXXXIGIEIE
MNMA_VESOH      ---------------------ALLLLKQGYQVEALFMKNWEEDDKGRYCSAKQDLSDAQNITNKLSIKLH
MNMA_STRPD      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_LEGPH      ---------------------AWLLKEQGYQVEGLFMKNWEQDDHNDYCPAAKDLADAQAVCNQLRIPLH
MNMA_LACH4      ---------------------ALLLKQQGYDVVGVFMKNWDDTDDSGVCTATEDYEDVKKVADKIGIPYY
MNMA_DELAS      ---------------------AHLLKQQGHEVVGIFMKNWEDDDDSEYCSSNXXXXXXXXXXXXXGIEIE
MNMA_STRPG      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_STRPF      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_STRP6      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_LEGPC      ---------------------AWLLKEQGYQVEGLFMKNWEQDDHNDYCPAAKDLADAQAVCNQLRIPLH
MNMA_COXB1      ---------------------ALVLKEKGYEVIGLFMQNWETDSKDPFCTAEQDLSDAKAIADHIGIPLY
MNMA_STRPC      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_STRPB      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_POLSJ      ---------------------AYLLKQQGHEVIGIFMKNWEDDDDSEYCSSNIXXXXXXXXXXXIGIEIE
MNMA_LEGPA      ---------------------AWLLKEQGYQVEGLFMKNWEQDDHNDFCPAAKDLADAQAVCNQLRIPLH
MNMA_COXBU      ---------------------ALVLKEKGYEVIGLFMQNWETDSKDPFCTAEQDLSDAKAIADHIGIPLY
MNMA_COXBN      ---------------------ALVLKEKGYEVIGLFMQNWETDSKDPFCTAEQDLSDAKAIADHIGIPLY
MNMA_COXB2      ---------------------ALVLKEKGYEVIGLFMQNWETDSKDPFCTAEQDLSDAKAIADHIGIPLY
MNMA_STRP1      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADKIGIPYY
MNMA_STRTD      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIDIPYY
MNMA_STRP8      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_STREM      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_COXBR      ---------------------ALVLKEKGYEVIGLFMQNWETDSKDPFCTAEQDLSDAKAIADHIGIPLY
MNMA_BACA2      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGFCTATEDYEDVIRVCNQIGIPYY
MNMA_STRPM      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_LACPL      ---------------------ALLLKQQGYDVVGVFMKNWDDTDENGVCTATEDYKDVAKVADKIGIPYY
MNMA_BURCH      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_BURCA      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_STRP3      ---------------------ALLLKEQGYDVIGVFMKNWHDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_NITMU      ---------------------ALLLKQQGYEVIGLFMKNWEDDDTDEYCSSRQDLIDAASVADVIGIPLE
MNMA_STRE4      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA1_GEOKA     ---------------------AYLLKQEGYDVIGVFMKNWDDTNDDGVCTATEDYEDVKRVANQLGIPYY
MNMA_BURP8      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDSEYCSTRQDWIDVVSVADLIGIDVE
MNMA_METPP      ---------------------AWLLKQQGHEVVGLFMKNWEDDDDDEYCSSRQDFLDAASVADVIGIEIE
MNMA_WIGBR      ---------------------AWFLKKSGYHVEGVFMKNWEEINSSIKCTFKKDLKDAQIVCDQIGININ
MNMA_LACF3      ---------------------ALLLKQQGYDVVGVFMKNWDDTDENGVCTATEDYKDVAKVATQIGIPYY
MNMA_POLNA      ---------------------AYLLKQQGHEVIGIFMKNWEDDDDSEFCSSNIXXXXXXXXXXXIGIEIE
MNMA_XYLFA      ---------------------AWRLNSQRETIAGLFMRNWT-DDGNGQCHAEEDRRDAVAVCGILGIAFH
MNMA_BORPA      ---------------------AWLLKQQGYEVVGLFMKNWEDDDDSEYCSTRQDLLDAASVADLVGVEFE
MNMA_BORPE      ---------------------AWLLKQQGYEVVGLFMKNWEDDDDSEYCSTRQDLLDAASVADLVGVEFE
MNMA_BORBR      ---------------------AWLLKQQGYEVVGLFMKNWEDDDDSEYCSTRQDLLDAASVADLVGVEFE
MNMA_BURVG      ---------------------AWLLKEQGYDVVGLFMKNWEDDDDGEYCSTRQDWIDVVSVADLIGIDVE
MNMA_NEIMA      ---------------------AALLKQQGYQVRGVFMQNWEDDDNDEYCSIKQDSFXXXXXXXXXXXXXX
MNMA_ENTFA      ---------------------ALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVAKVADQIGIPYY
MNMA_XYLFT      ---------------------AWRLNSQREAIAGLFMRNWT-DDGNGQCHAEEDRRDAVAVCGILGIAFH
MNMA_XYLFM      ---------------------AWRLNSQREAIAGLFMRNWT-DDGNGQCHAEEDRRDAVAVCGILGIAFH
MNMA_XYLF2      ---------------------AWRLNSQREAIAGLFMRNWT-DDGNGQCHAEEDRRDAVAVCGILGIAFH
MNMA_STRS7      ---------------------ALLLKEQGYDVIGVFMKNWDDTDEFGVCTATEDYKDVAAVADQIGIPYY
MNMA_OCEIH      ---------------------ALLLKQQGYDVVGIFMKNWDDTDEFGVCTATEDFDDVVRVCNQLEIPYY
MNMA_ACISJ      ---------------------AHLLKQQGHEVVGIFMKNWEDDDDSEFCSSRQDFLDAASVADVIGIEIE
MNMA_PARUW      ---------------------ALLMKEQGYNVIGLFMKNWEEKDENGVCSSAQDYDDVRRVCDHINIPYY
MNMA_BACSK      ---------------------ALLLKEQGYDVIGIFMKNWDDSNDSGFCSATEDYEDVERVAQQLGIPYY
MNMA_LACDB      ---------------------ALLLKQQGYDVVGVFMKNWDDTNDDGVCTATEDYEDVKKVADKIGIPYY
MNMA_DICNV      ---------------------AYLLKKQGYDVFGIFMKNWEETFSSGYCSAAEDLEDARDVCQTLDIPLH
MNMA_LACDA      ---------------------ALLLKQQGYDVVGVFMKNWDDTNDDGVCTATEDYEDVKKVADKIGIPYY
MNMA_FINM2      ---------------------ALLLKQQGYDVVGIFMKNWDETDDDGVCTAEEDYKDAVAVANEIGIDYY
MNMA_PEDPA      ---------------------AYLLKQQGYDVVGVFMKNWDDTDENGYCTATEDYKDVAKVAAKIGIPYY
MNMA_RUTMC      -----------------------LLLKQGYQVEALFMKNWEEDDKSGYCSVEQDLSDAQKIADKLDVKLH
MNMA_LEPCP      ---------------------AWLLKQQGHEVVAIFMKNWEDDDDSEFCSSRQDFLDAASVADVLGIEIE
MNMA_BACP2      ---------------------ALMLKEQGYDVIGIFMKNWDDTDENGVCTATEDYEDVIRVCNQIGIPYY
MNMA_RHOFD      ---------------------AWLLKQQGYEVIGIFMKNWEDDDDSEYCSSNXXXXXXXXXXXXXXXEIE
MNMA_MESFL      ---------------------AYLLIQQGYEVEGLFMRNWDQEIDNDVCPQEQDYLDALEVANKLGIKLH
MNMA_VEREI      ---------------------AYLLRQQGHEVVGIFMKNWEDDDDGGYCPSGTXXXXXXXXXXXIGIEIE
MNMA_MYCAP      ---------------------AYLLLKQGYEVEGLFMRNWDENISQDICPQEQDYQDALEVANKLGIKLH
MNMA_CHLMU      ---------------------AYLLKKQGYDVIGLFMKNWEEQDENGECTATKDFLDVEQIAEQLSIPYY
MNMA_BUCCC      ---------------------AWLLLKQGYQVEGLFMKNWDEDDSNDYCSSKIDFNDVKKVCKTLNIPLH
MNMA_MYCCT      ----------------------YLLLQQGYEVEGLFMRNWDSNINDDICPQEQDYLDAKAVADKLNIKLH
MNMA_CHLTR      ---------------------AYLLKKQGYNVVGLFMKNWGEQDENGECTATKDFRDVERIAEQLSIPYY
MNMA_CHLTA      ---------------------AYLLKKQGYNVVGLFMKNWGEQDENGECTATKDFRDVERIAEQLSIPYY
MNMA_CHLTB      ---------------------AYLLKKQGYNVVGLFMKNWGEQDENGECTATKDFRDVERIAEQLSIPYY
MNMA_CHLT2      ---------------------AYLLKKQGYNVVGLFMKNWGEQDENGECTATKDFRDVERIAEQLSIPYY
MNMA_MYCMS      ----------------------YLLLEQGYEVEGLFMRNWDSNINDDICPQEQDYLDAKAVADKLNIKLY
MNMA_CHLPN      -----------------------------YKVIGLFMKNWEEDSEGGLCSSTKDYEDVERVCLQLDIPYY
MNMA_CHLCV      -----------------------------YKVIGLFMKNWEEEDSDGLCSTAKDYEDVERVAGQLDIPYY
MNMA_HALHL      MTESPKRIVVGLSGGVDSAVAALRLVRAGHEVIGLFMKNWEDDDTLTQCSXXXXXXXXXXXXXHLGIPIR
MNMA_CHLAB      ---------------------AYLLKKYSYRVLGIFMKNWEEEDSNGLCSTAKDYEDVERVAEQLDIPYY
MNMA_CHLFF      ---------------------AYLLKNYSYKVLGLFMKNWEEEDGEGLCSTAKDYEDVEKVAGQLDIPYY
MNMA2_ARCB4     ---------------------ALLLKQQGYDVVGLFMRNWEYGIKGSQCPNRIEFEDAKKVGALIGIEVR
MNMA_UREU1      ---------------------ALLLKQQGYEVIGLFMANWESDKKHQGCESELDYQDAQAVAQKIGIPLY
MNMA_MYCPU      ---------------------AYLLKQQGHEVIGLFMRNWDSSLNQSLCPQEQDFQDASRVAKQIGIPIY
MNMA_PHYAS      ---------------------ALLLKKAGYEVEAVFMRNWDSQLNFDFCPQELDYKDALKVSLQLGIKLH
MNMA_ACHLI      ---------------------ALILLQQGYDVEAVFMRNWDSATNDETCEQEKDYQDALKVANKLGIKLH
MNMA_ONYPE      ---------------------AFLLKKQGYLVEAVFMRNWDSNLNNDICSQELDYKDSLKVSEQLGIKLH
MNMA_AYWBP      ---------------------AFLLKKQGYLVEAVFMRNWDSNLNNDICPQELDYKDALKVSEQLGIKLH
MNMA_MYCA5      ---------------------AYLLQQQGYEVVGLFMRNWDEAISQDVCPQEQDYADAKEVAKQLNIPLY
MNMA_GRAFK      ---------------------AYLLKEQGYEVIGLFMKNWHDDSVSDECPWLDDSNDAMMVADKLGIPFQ
MNMA_FLAPJ      ---------------------AYLLQEQGYEVIGLFMKNWHDDSVSNECPWLEDSNDALLVAEKLGIPFQ
MTU1_CHICK      -----------------------LLRRRGYQVTGVFMKNWDPLDEQGACSVDRDCEDAYRVCQKLDIPFH
MNMA_MYCMO      -----------------------LKYQQNHEVIAVFMRNWDEDINQDICPQEKDWEDAKKIASQLNIPIY
MNMA_MYCS5      ------------------------LLKKNYNVIGLFMRNWDSLINNDYCPQELDYKDAQEIARQLDIPLY
MNMA_MYCHJ      ---------------------AYLLKKAGHNVIAVFMRNWDSSLNNDFCPQEQDWLDAKVVAKQLNIPIF
MNMA_MYCH2      ---------------------AYLLKKAGHNVIAVFMRNWDSSLNNDFCPQEQDWLDAKVVAKQLNIPIF
MNMA_MYCH7      ---------------------AYLLKKAGHNVIAVFMRNWDSSLNNDFCPQEQDWLDAKVVAKQLNIPIF
MTU1_HUMAN      ---------------------ALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFH
MTU1_DROME      -----------------------LLAEQGFKVLGVFMRNWDEADEVGRCSGEADLKDAEWACRQLGVELR
MNMA_FLAJ1      ---------------------AYLLQQQGYEVIGLFMKNWHDDSVSNECPWLEDSNDALLVAEKLGIPFQ
MTU1_MOUSE      ---------------------ALLLRRRGYQVTGVFMKNWDSLDEQGVCAADKDCEDAYKVCQILDIPFH
MNMA_SYMTH      ---------------------AALLVEQGYEVIGVTMNTWTDDIPEEICCSLAAVEDARSVAHKLGIPYY
MNMA_AKKM8      ---------------------AALLVEQGHDVVGAYMKNWVNDEGPGECPWEQDIQDALAVAKTTGIEFR
MNMA_MYCPE      ---------------------AYLLKLRGYDVMGVFMQNWDPYINKESCEAEYDYQIASKVCQRLGIKLE
MTU1_PONAB      ---------------------ALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFH
MNMA_CARHZ      ---------------------AALLLEQGYEVVGVTMQIWDEVIGEEYCCSIYAVNDARRVADRLGIPYY
MTU1_DANRE      ---------------------ALLLKRMGYHVTGVFMKNWDSQEEKGLCSSDRDCEDAYKVCKMLDIPFH
MNMA_OPITP      ---------------------ALLLKQQGYDVVGAYMKNWNEDQVIGHCPWQQDIEDARRVATQIGIEFR
MNMA_NATTJ      ---------------------ALMLKEQGYEVIGAHMRIWYREEDEELCCSLAAVHDAKRVADKIGIPFY
MNMA_UREPA      -------------------------KQEGYEVIGLFMSNWDTENNHEFCESELDYQDAQAVAQKIGIPLY
MNMA_UREP2      -------------------------KQEGYEVIGLFMSNWDTENNHEFCESELDYQDAQAVAQKIGIPLY
MTU1_RAT        ---------------------ALLLRRRGYQVTGVFMKNWDSLDEQGICAADKDCEDAYKVCQILDIPFH
MNMA_GEOSL      ---------------------AALLKEEGHEVIGISMQVWDAPEGEKFCCSLDDIHDARRVAEQIGIPFY
MNMA_NOSP7      ---------------------AAILHHQGYEVIGLTL--WLMKGKGQCCSEGMIDAAD--LCEQLGVPHQ
MNMA_MYCGA      ---------------------AYLLQQQGYDVVAAFMQNWDKDDQIQGCDAKQDYEDTQKLCEQLKIKLY
MNMA_ANAVT      ---------------------AAILHNQGYEVIGLTL--WLMKGKGQCCSEGMIDAAY--ICEQLGIPHE
MNMA_CLOPE      ---------------------AYLLKEQGYDVIGVTMQIWQEDEREGGCCSLSAVDDARRVAQKLDIPFY
MNMA_CLOP1      ---------------------AYLLKEQGYDVIGVTMQIWQEDEREGGCCSLSAVDDARRVAQKLDIPFY
MNMA_ANASP      ---------------------AAILHNQGYEVIGLTL--WLMKGKGQCCSEGMIDAAY--ICEQLGIPHE
MNMA_CLOPH      ---------------------AYLLKEAGYDVIGVTMQIWQDEDNQTVCCGLSAVDDARRVANSLDIPYY
MNMA_CHLCH      -----------------------LLVQQGYRVTAVNLRLLDTLDAPYAEPTLQPSSLVVSDHPDYHIPLF
MNMA_GEOUR      ---------------------AALLKEEGHEVIGISMQVWDAEEGEKFCCSLDDIHDARRVAEQLEIPFY
MNMA_GEOMG      ---------------------AALLKEEGHEVIGISMQVWDYSEGEKFCCSLDDIHDARRVAEQIGIPFY
MNMA_SYNJB      ---------------------AALLQEQGYAVEGVTL--WLMRGKGQCCTEGLVDAAA--VCEQLGIPHH
MNMA1_THEPX     ---------------------AYLLKEQGFDVIGVTMQIWQDKDEEAVCCSLSAVNDARRVANKIGIKYY
MNMA1_THEP3     ---------------------AYLLKEQGFDVIGVTMQIWQDKDEEAVCCSLSAVNDARRVANKIGIKYY
MNMA_SOLUE      ---------------------AAMLVREGRTVVGMTMQLWNQRRLPELCCSLDDVYDARRVAEQVGIPYY
MNMA_CLOPS      ---------------------AYLLKEQGYDVIGVTMQIWQEDEREGGCCSLSAVDDARRVAQKLDIPFY
MNMA1_CLOBM     ---------------------AYLLKEQGYEVIGVTMQIWQDDEEEGGCCSLSAVADARRVANKIGIPFY
MNMA_MICAN      ---------------------------QGYDVIGLTL--WLMKGKGQCCSEGMVDAAF--ICEQLGVPHH
MNMA2_CLOBK     ---------------------AYLLKEQGYEVIGVTMQIWQDDEEEGGCCSLSAVADARRVANKIGIPFY
MNMA1_THETN     ---------------------AYLLKEQGFEVIGVTMRVWVDPDDDKSCCSLKAIHDAKKVAEILGIPHY
MNMA1_CLOBH     ---------------------AYLLKEQGYEVIGVTMQIWQDDEEEGGCCSLSAVADARRVANKIGIPFY
MNMA1_CLOB1     ---------------------AYLLKEQGYEVIGVTMQIWQDDEEEGGCCSLSAVADARRVANKIGIPFY
MNMA_CLOD6      ---------------------AYLLKQQGYDVIGVTMKLWQDDDVVEICCSLSAVEDARRVANKIGIPFY
MNMA1_CLOBL     ---------------------AYLLKEQGYEVIGVTMQIWQDDEEEGGCCSLSAVADARRVANKIGIPFY
MTU1_CAEEL      ---------------------AFLLKKRGFDVIGLHMINWDQEEGTSHCPRSKDESDARNVCDRLNIPFH
MNMA_HELMI      ---------------------AALLLEQGYDVIGVTLQIWPKDGAEGGCCSLSAVEDAKRVASKLGVPHY
MNMA_PELLD      ---------------------ACMLVREGYEVLGLHLKVLQEGDGS---TVLEPSPMTISSREEFHIPVF
MNMA2_CLOTE     ---------------------AYLLKEQGYEVIGATMQIWQDDEREGGCCSLSAVADARRVANKIGIPFY
MNMA_SYNJA      ---------------------AAILHEQGYAVEGVTL--WLMRGKGQCCTDGLVDAAA--ICEQLGIPHH
MNMA_CLONN      ---------------------AYLLKEKGYDLIGITMKVSCDLDVSE---------DAKKVADKLGIPYY
MNMA_CLOAB      ---------------------AYLLKEQGYDVIGVTMKLTPDDEQEGGCCSLSAVEDARRVAYRIGIPFY
MNMA_DESRM      ---------------------AALLQQQGYDIVGVTMQIWDPEVGDDYCCSLTAVDDARRVANVLGIPYY
MNMA_SYNY3      ------------------------LHRQGYAVVGVTL--WLMKGKGQCCSEGLVDAAS--ICEQLGVPHE
MNMA2_THEPX     ---------------------AYLLKKQGFDVIGLTMRVWVDHDSDKSCCSLKATQDAKKVAEILGIPHY
MNMA2_THEP3     ---------------------AYLLKKQGFDVIGLTMRVWVDHDSDKSCCSLKATQDAKKVAEILGIPHY
MNMA_PELTS      ---------------------AALLLEQGFEVIGITMQIWNESKGERTCCSLTAIDDARRVADKLGISHY
MNMA_CLOBA      MSLTKKKVLVGMSGGVDSSVAAYLLKEQGYEVIGATMQIWQEDEREGGCCSLSAVEDARRVCDKLDIPFY
MNMA_CYAP7      ------------------------LHHQGYDVVGLTL--WLMKGKGQCCSEGMVDAAF--ICEQLGIPHH
MNMA2_THETN     ---------------------AYLLKEQGYEVIGVTMQIWQDKDEEAVCCSLAAVNDARRVANKIGIKYY
MNMA_ACIF5      ---------------------ALLMQGQGYELTGVTMRLWPRSR----CCDEKDIEDAAEICARLGIPYT
MNMA_ACIF2      ---------------------ALLMQGQGYELTGVTMRLWPRSR----CCDEKDIEDAAEICARLGIPYT
MNMA2_SYNAS     ---------------------------------------------------------------QLGIPLH
MNMA_PELCD      ---------------------AALLLAQGHQVSGVTMRVWDTEDGRE----PAHIRDARKVAFDLGIPLH
MNMA_HERA2      ---------------------AVLLKEQGHDVTGVTMHLWEGDDNESQCCSVEMTAGARRVCAQYDIPYY
MNMA2_CLOBL     ---------------------AYILKERGYDVIGIYMDLWR-DEREEYCNKSAAEDARR-VAEKLDIPFH
MNMA_CLOK5      -----------------------LLKEQGYEVIGVTMQVWQEDDYESGCCSLSAVEDAKMVAYHLNIPHY
MNMA_CYAA5      ---------------------------QGYDVIGLTL--WLMKGKGQCCSEGMVDAAF--ICEQLGVPHH
MNMA_CLOB8      ---------------------AYLLKQQGYDVIGATMQIWQHDEEFEECCSLSAVDDARRVCDKLDIPFY
MNMA_PARD8      ------------------------LKEAGYDPTIFYIRGMEDKDGYIDCPAEEDIEITSYIARKYGCRFE
MNMA_DEIRA      ---------------------ASLLKEQGYQVIGAMMRFWPDDDTFDSCCSPDAAYEARRVAEQVGVPFY
MNMA_SYNP2      ---------------------AGILHRQGYTVEGVTL--WLMKGKGQCCSEGMVDAAD--ICEQLGIPHH
MNMA_CLOTH      ---------------------AAILLEQGYEVIGATMQIWPDTDEETKCCSLSAVDDARSVANKLGIPYY
MNMA_SYNP6      ------------------------LHRQGYAVEGLTL--WLMKGKGQCCSEGMVDAAG--ICEQMGVPYH
MNMA_SYNE7      ------------------------LHRQGYAVEGLTL--WLMKGKGQCCSEGMVDAAG--ICEQMGVPYH
MNMA_SALRD      ---------------------AVLLKERGYDVVGLTMKTWDYSDGKEVCCSIESMNDARVVATEHGFPHF
MNMA_PROVI      ---------------------ACMLVDEGYRVIGLNIKVLDSPESNPALQPSSLVISNR---EEFRIPVY
MNMA_MOOTA      ---------------------AALLKEAGYEVIGVTLALWXXXXXXXXXXXXXXSLKAVDVANILDIPYY
MNMA_DEIGD      ---------------------AALLKDAGYQVIGAMMRFWPDDDTFDTCCSPDAAYEARRVAEQVGVPFY
MNMA_CYAP8      ---------------------------QGYEVIGLTL--WLMKGKGQCCSEGMVDAAF--ICEQLGIPHH
MNMA1_CLOTE     ---------------------AYLLKEQGYDVIGMTMKNYHDGSKEKI---EDIMKSAKEVCDFLEIPFV
MNMA1_FUSNN     ---------------------AYLLKQQGYDIFGVTMKTFKDEDSDA-----------KKVCDDLGIEHY
MNMA_CLOBB      ---------------------AYLLKEQGYEVIGATMQIWQEDEREGGCCSLSAVEDARRVCDKLDIPFY
MNMA_CHLPB      ---------------------ACILIENGYRVTGLHIKVLDHSDDSLHLEKSPLIISDRK---EFRFPVF
MNMA_MYCGE      ---------------------ALLLKKQYQEVIGVFMECWDETLNNDFCSSFQDFQQAKKIANSLGIKLI
MNMA_GEOLS      ---------------------AALLQQQGHEVIGITMQLFEPCSSGP----GTPAHDGAQVAAQLGIPHH
MNMA3_BACFN     MKESKKRVLVGMSGGIDSTATCLMLQEQGYEIVGVTMRVWEPQDARELAA-------------RMGIEHY
MNMA_ACAM1      -------------------------KEKGYEVIGLTL--WLMQGKGQCCSDGLVDAAQ--LCEDLDIPHH
MNMA_TREDE      ---------------------AKLLIDQGYDVTGVTMQLLPKLSGI-YKEQTDDIEDAKKVADKLGIKHI
MNMA_CHLAD      ---------------------AALLQEAGHQVTGVTMHLWDDDEQESLCCAAEAATSARRVCALLGIPFY
MNMA3_BACFR     MKESKKRVLVGMSGGIDSTATCLMLQEQGYEIVGVTMRVWEPQDARELAA-------------RMGIEHY
MNMA_BORGA      ---------------------------KGYNIKCYYLKIWLEDELSYICPWQEDLNYVEAVCNKFNIPYE
MNMA_SYNS9      ---------------------AALLVEAGWEVEGLTL--WLMSGKGACCAEGLVDAAG--ICEQLGIPHH
MNMA_SYNPW      ---------------------AALLVEAGWEVEGLTL--WLMSGKGACCAEGLVDAAG--ICEQLEIPHH
MNMA_RICCK      ---------------------AAMLHAQGYNVIGITLQLYDHGMAKNACCAGQDIYDAKMVANKLGIPHY
MNMA_HALOH      ---------------------AALLKEQGYEVIGGTMEIFPDYEDEGGCCSLSSIEDARRVAHHIGIRHY
MNMA_THEEB      ------------------------LKAQGHPVVGLTL--WLMKGKGQCCSEGLVDAAR--LCEQLGVPHH
MNMA_SYNSC      ---------------------AALLVEAGWEVEGLTL--WLMSGKGACCAEGLVDAAG--ICEQLGIPHH
MNMA_ROSS1      ---------------------AALLHEAGHDVTGVTLHLWEGDDAESLCCSQEMTESARRVCAQLGIPYY
MNMA_BORAP      ---------------------------KGYSIKCYYLKIWLEDELSYICPWQEDLNYVEAVCSKFNVPYE
MNMA_TRIEI      ---------------------AAILHHQGYQVEGLTL--WLMKGKGQCCSEGMVDAAY--ICEQLDIPHH
MNMA_PROMM      ------------------------------------------------------------ICEQLKIPHH
MNMA3_BACTN     -----------------------MLQEQGYEIVGVTMRVWEPQDARELAA-------------RMGIEHY
MNMA_RICTY      ---------------------AAMLHEQGHHVIGITLQLYDYGIAKNACCAGKDIYDAKMVANKLGIPHY
MNMA_RICFE      ---------------------AAMLHEQGHNVIGITLQLYDHGMAKNACCAGQDIYDAKMVANKLGIPHY
MNMA_CALS8      ---------------------AAILKEEGYEVYGATMQIWQNECGEELCCSIYAVDDARKVANILDIPYY
MNMA_RICPR      ---------------------AAMLHEQGHNVIGITLQLYDYGIAKNACCAGQDIYDAKMVANKLGIPHY
MNMA_RICM5      ---------------------AAMLHEQGHNVIGITLQLYDHGMAKNACCAGQDIYDAKMVANKLGIPHY
MNMA_RICCN      ---------------------AAMLHEQGHNVIGITLQLYDHGMAKNACCAGQDIYDAKMVANKLGIPHY
MNMA1_BACTN     --------------------------EQGYKPTLFYIKIGM--DGAEYCSAEEDIEMSTAIARKYGLSLE
MNMA_THET8      ---------------------ALLLKEAGYEVVGAMMRFWPDEAGKESCCTPDAAYEARRVADRLGIPFY
MNMA_THET2      ---------------------ALLLKEAGYEVVGAMMRFWPDEAGKESCCTPDAAYEARRVADRLGIPFY
MNMA1_SYNAS     ---------------------ALLLKEEGYEVAGVTMLGVREEENKVRCCGREAIEDARGVCEILGIPHY
MTU1_SCHPO      ---------------------AYLLKSQGYNVEGVFMRNWDEDSAPSGCPAERDWATVQKVCKKLNISCR
MNMA_SYNPX      ---------------------AALLVEAGWEVEGLTL--WLMSGKGACCAEGLVDAAG--ICEQLGIPHH
MNMA_RICRS      ---------------------AAMLNEQGHNVIGITLQLYDHGMAKNACCAGQDIYDAKMVANKLGIPHY
MNMA_RICRO      ---------------------AAMLNEQGHNVIGITLQLYDHGMAKNACCAGQDIYDAKMVANKLGIPHY
MNMA_RICPU      ---------------------AAMLHEQGHNVIGITLQLYDHGMAKNSCCAGQDIYDAKMVANKLGIPHY
MNMA_SYNR3      ---------------------AALLRDAQWQVEGLTL--WLMSGKGACCAEGLVDAAG--LCEELEIPHH
MNMA_PROM3      ------------------------------------------------------------ICEQLKIPHH
MNMA_CHLTE      ---------------------ACLLIKQGYHVTGL---NIRVLDTPEDTPTLAPSAMRISDSEEFDFPVF
MNMA_RICAE      ---------------------AAMLHEQGHNVIGITLQLYDHGMAKNACCAGQDIYDAKMVANKLGIPHY
MNMA_MAGSM      ---------------------AALLVEQGYEVIGLTMQLWDHSSGSRSCCALDDLYDARQVAQTLGIPYY
MNMA2_BACFN     --------------------------EQGYKPTLFYIKIGM--DGAEYCSAEEDIELSTAIARRYGLALE
MNMA2_BACFR     --------------------------EQGYKPTLFYIKIGM--DGAEYCSAEEDIELSTAIARRYGLALE
MNMA_SPHWW      ------------------------------------------------------------VADRLGIAHY
MNMA_CHLPD      ---------------------ACLLMKQGYRVLGLNIRILDTPD--EHPSLAPSPLLISDHAD-YQFPVF
MNMA_SYNWW      ---------------------ALLLREQGYEVTGLTMVHLEREAGEKAAR----------IANELQIEHK
MNMA1_BACV8     -----------------------LLCEQGYKPDLFYIKIGMDGDEDLTCTAEEDIELCTATARKYGLSLN
MNMA_ANAMM      ---------------------AALLHERGYKVIGATMQLHSSSSGAKSCCGSVDIYDAKRVASTLGFPHY
MNMA_SYNS3      ---------------------AALMVEAGWEVEGLTL--WLMSGKGACCAEGLVDAAG--ICQQLGVPHH
MNMA_ORITB      ---------------------AAILKEDGYNVIGITMQLYNHDTAKGACCAGQDIYDAKFVANQLQIPHY
MNMA_MYCPN      ---------------------ALLLKQQYREVIGIFMECWDNNEHKSGCSSKEDFREAQAIAQLLGIKLI
MNMA_BORRA      --------------------------QKGYKIKCYYLKIWLEDEGE--CPWKEDITYVDSVCKKFNVPYK
MNMA_BORDL      --------------------------QKGYKIKCYYLKIWLEDEGE--CPWKEDITYVDSVCKKFNVPYE
MNMA_WOLWR      ---------------------AALLHNLGYQVIGVTLQLYGTDGNANACCAGQDIYDAKRVAESVGFPHY
MNMA_CORDI      ------------------------------------------------------------VCDKLGIPFY
MNMA_BORT9      ----------------------YIMIQKGYKIKCYYLKIWLEDEGE--CPWKEDINYVEAVCKKFNVPYE
MNMA_ACIC5      ---------------------AAMLREEGYDLIGLTLQLWNQKDGQGRCCSIDDVYDARRVAETLGIPYY
MNMA_RICAH      ---------------------AAMLHEQGHNVIGITLQLYDHGMAKNACCAGQDIYDAKMVANKLGIPHY
MNMA_DESHY      -----------------------LLKEEGYEVIGITLQTMPSGGPDDVCCSITAIDDARRVAHQLGIPHY
MNMA_RICBR      ---------------------AGILCEQGYNVIGITLQLYDHGMAKNACCAGQDIYDAKMVANKLGMPHY
MNMA_RICB8      ---------------------AGILCEQGYNVIGITLQLYDHGMAKNACCAGQDIYDAKMVANKLGMPHY
MNMA_SYNFM      ---------------------AILLKEQGNDVFGVHMRHVPPSRTGRWCAGAMIREKEAFLCERFGFPIA
MNMA_CYTH3      ---------------------AVMLHEQGYEVIGMTMKTWDYANKETGCCSLDSINDARNIAVSLGFPHY
MNMA_BORBZ      ---------------------------KGYSIKCYYLKIWVEDELSYICPWQEDLNYVEAICNKFNVPYE
MNMA_AMOA5      ---------------------ALLLHEQGYEIVGLTMKTWDYVSSETGCCSLDSINDARNVAVSLGFPHI
MTU1_YEAST      ---------------------------------GVYMQNWSEDPGKEPC-YERDWRDVNRVAKHLNIRVD
MNMA_PORG3      ------------------------LCEEGYKPAIFYIRGMEDEDGYIDCPAEEDIELTTLIARRYGCPFE
MNMA_LEPIN      ---------------------AGLLMEDGYEVIGVNLRTWEYDTTKKSCCSPEDIRDARDVGISLKIPFY
MNMA_LEPIC      ---------------------AGLLMEDGYEVIGVNLRTWEYDTTKKSCCSPEDIRDARDVGISLKIPFY
MNMA_DEHE1      ---------------------AMLLLEQGYDVAGLQLKSNNEPYGNGY--NLKLINRAREVAAALGIPHY
MNMA_WOLPM      ---------------------AALLHNLGYKVVGVTLQLYGTDGNANACCAGQDIYDAKRVAESVGFPHY
MNMA_PORGI      ------------------------LCEEGYKPAIFYIRGMEDKDGYIDCPAEEDIELTTLIARRYGCPFE
MNMA_OCHA4      ---------------------AGILKREGYDVVGVTLQLYDHGAAVHRCCAGQDIEDARRVSESLGIPHY
MNMA_BORBU      ---------------------------KGYSIKCYYLKIWVEDELSYICPWQEDLNYVEAICNKFNVPYE
MNMA1_CLOBK     ---------------------AYILKERGYDVIGIYMDLWR-DEREEYCNKSAAEDARR-VAEKLDIPFH
MNMA_NEOSM      ------------------------LHRVGYKVIGVTLQLHNNQTNRKTCCAGSDIFDAKRVAAQFGFLHY
MNMA_DESOH      ---------------------AHLLKQSGADVTAIFLTGYEPED---------RAGRLEKLFTQMDIPVF
MNMA_DEHSC      ---------------------AMLLLEQGYNVAGLQLKSNNEPYGNGY--NLKLINRAREVAAALNIPHY
MNMA_DEHSB      ---------------------AMLLLEQGYNVAGLQLKSNNEPYGNGY--NLKLINRAREVAAALNIPHY
MNMA_ACIBL      ---------------------AAMLRAEGYNLVGLTMQLWNQEPGVGRCCSLDDVYDARRVAETLAIPYY
MNMA_ZYMMO      ------------------------------------------------------------VAEKIGIPHY
MNMA_WOLPP      ---------------------AALLYNLGYEVIGVTLQLYGSDGNARKCCAGQDIYDAKYVAESVGFPHY
MNMA3_BACV8     -----------------------MLQEQGYEVVGVTMRTWDQDEPDDVLEARA-------LAERLGIEHH
MNMA_GLOVI      ---------------------AALVRKQGYRVCGVTL--WLMRGKGSCCSDGMKDAAR--VCEQLDIPHH
MNMA_AGRRK      ---------------------AGILKRQGYDVLGITLQLYDHGAAVHRCCAGQDIDDARRVCETIGIPHY
MNMA_RHISN      ---------------------AGLLKREGYDVLGITLQLYDHGAAVHRCCAGQDIDDARRVCETLGIPHY
MNMA_BORHD      --------------------------QKGYKIKCYYLKIWLEDEGE--CPWEEDINYVEAVCTKFNVPYE
MNMA_MYXXD      ---------------------AALLKEQGHEVIGITLRVWSYEGKATCCCSPDDIDDARAVAQTLGIPFY
MNMA_ROSCS      ---------------------AALLHEAGHDVTGVTLHLWEGDDAESLCCSQEMTESARRVCAQLGIPYY
MNMA_LEPBL      ---------------------AGLLMEEGYEVIGVNLRTWEYDTTKKSCCSPEDIRDARDVGLSLKIPFY
MNMA_LEPBJ      ---------------------AGLLMEEGYEVIGVNLRTWEYDTTKKSCCSPEDIRDARDVGLSLKIPFY
MNMA2_CLOBH     ---------------------AYILKERGYDVIGIYMDLWR-DERKGYCNKSAAEDARR-VAEKLDIPFH
MNMA2_CLOB1     ---------------------AYILKERGYDVIGIYMDLWR-DERKGYCNKSAAEDARR-VAEKLDIPFH
MNMA_WOLTR      ---------------------AVLLHRLGYQVIGVTLQLYGADGNSNVCCAGQDIYDAKRVAEGTGFPHY
MNMA_PROM4      ---------------------AALLVEAGWKVEGLTL--WLMEGKGSCCTEGLVDAAG--ICEQLKIPHH
MNMA_PELPD      ---------------------AALLKEQGHEIIGITMQFFAPS-----CQGAGTPAHDAAVAAHLGITHH
MNMA_DESPS      -----------------------ILQKQKGPVLGFFMKLNQPDYETQ-------RDRVSQIAQKLDIKLE
MNMA_CORA7      ------------------------------------------------------------ICDKLGIPFY
MNMA_BRUME      ---------------------AGILKREGYDVVGVTLQLYDHGAAVHRCCAGQDIEDARRVSESLGIPHY
MNMA_PROM0      --------------------------ERGWNVEGLTL--WLIKGQGSCCSEGLVDAAG--LCEDLGINHK
MNMA_BRUSI      ---------------------AGILKREGYDVVGVTLQLYDHSAAVHRCCAGQDIEDARRVSESLGIPHY
MNMA_CORJK      --------------------------EAGHEVIGVHLALSQSPEGSRGCCSLEDSADARRVADKLGIPFY
MNMA_BRUSU      ---------------------AGILKREGYDVVGVTLQLYDHGAAVHRCCAGQDIEDARRVSESLGIPHY
MNMA_BRUO2      ---------------------AGILKREGYDVVGVTLQLYDHGAAVHRCCAGQDIEDARRVSESLGIPHY
MNMA_BRUMB      ---------------------AGILKREGYDVVGVTLQLYDHGAAVHRCCAGQDIEDARRVSESLGIPHY
MNMA_BRUC2      ---------------------AGILKREGYDVVGVTLQLYDHGAAVHRCCAGQDIEDARRVSESLGIPHY
MNMA_BRUAB      ---------------------AGILKREGYDVVGVTLQLYDHGAAVHRCCAGQDIEDARRVSESLGIPHY
MNMA_BRUA2      ---------------------AGILKREGYDVVGVTLQLYDHGAAVHRCCAGQDIEDARRVSESLGIPHY
MNMA_BRUA1      ---------------------AGILKREGYDVVGVTLQLYDHGAAVHRCCAGQDIEDARRVSESLGIPHY
MNMA2_BACV8     ---------------------ALLLQDAGYEVTGITFRFYEKENDTEYLEDARA------LCERLNIPHL
MNMA_LEPBP      ---------------------AGLLMEAGYDVIGVNLRTWEYDTTKKSCCSPEDIRDARDVGLSLNIPFY
MNMA_LEPBA      ---------------------AGLLMEAGYDVIGVNLRTWEYDTTKKSCCSPEDIRDARDVGLSLNIPFY
MNMA_SINMW      ---------------------AGLLKREGYDVLGITLQLYDHGAAVHRCCAGQDIDDARRVCETIGIPHY
MNMA_RHILO      ---------------------AGLLKREGYDVVGVTLQLYDHGAATHRCCAGQDIDDARRVSETLGIPHY
MNMA_HYPNA      ---------------------AAMLKAEGYDVIGITLQLYDHGAAIEKCCAGQDIHDARNVSDAIGIPHY
MNMA2_CLOBM     ---------------------AYILKERGYEVIGIYMDLWR-DEREEYCNKSAAEDARR-VAEKLDIPFH
MNMA_PROM9      ------------------------------------------------------------LCEDLGINHK
MNMA_PROM1      ---------------------AALLCKAGWDVEGLTL--WLMKGKGSCCSDGLVDAAG--ICDQLGIKHH
MNMA_NOCFA      --------------------------------------------GSRGCCSKEDAGDARRAADVLGIPFY
MNMA_PROMS      --------------------------ERGWNVEGLTL--WLMKGQGSCCSEGLVDAAG--LCEDLGINHK
MNMA_PROMP      --------------------------EDGWKVEGLTLWLMK---GEGSCCSEGLVDAAG-LCEDLGINHN
MNMA_RHIME      ---------------------AGLLKREGYDVLGITLQLYDHGAAVHRCCAGQDIDDARRVCETIGIPHY
MNMA_PROM2      --------------------------EKGWNVEGLTL--WLMKGQGSCCSEGLVDAAG--LCEDLGINHK
MNMA_PROMT      ---------------------AALLCKAGWDVEGLTL--WLMKGKGSCCSDGLVDAAG--ICDQLGIKHH
MNMA_CORGL      ------------------------------------------------------------VCDKLGIPFY
MNMA_CORGB      ------------------------------------------------------------VCDKLGIPFY
MNMA_EHRCR      ---------------------AALLHKLGYKVIGITLQLYNNTTGKGACCGSLDTQDAKQVASIMGFPHY
MNMA_AQUAE      ---------------------ALLLKEQGHDVIRVTLRACEVNETHNVCCSPKDVQDASRVAKRLGIPHL
MNMA_SULDN      ---------------------AMFLKEEGYEVEGLYMKLHSNPGYHEI-----HEARARKAADFLGIKLH
MNMA_RHIL3      ---------------------AGLLKQQGYDVLGITLQLYDHGAAVHRCCAGQDIDDARRVCETLGIPHY
MNMA_SULNB      ---------------------AVLLQKEGYEVEGVYMRLHDKPGYHE-----DNWGKVQKVADYLRIKVH
MNMA_PROAC      -------------------------------------------EGSRGCCSLEDSFDARRAADRLGIPFY
MNMA_RHOPB      ---------------------AALLKSEGYDVVGITLQLYDHGAAKGACCAGQDIHDARAVADRIGIPHY
MNMA_RHOBA      ---------------------AHLLLRDGHEVIGVFMRHGEASDHKQGCCSATDAADARRVAMSMGIPFY
MNMA_BEII9      ---------------------AALLKREGYEVIGVTLQLYDHGEAKGACCAGQDIQDARQVADQLGIPHY
MNMA_NITSB      -----------------------LLQSRGYEVIGVYMKFHPR---EEY--HQKNIANIQKVAKHLGIEYH
MNMA_EHRCJ      ---------------------AALLHKLGYKVIGITLQLYNNTSGKGGCCGSTDTQDAKQVASSMGFPHY
MNMA_METRJ      ---------------------AGLLKRQGFDVVGVTLQLYDHGAASHRCCAGQDIHDARAAAEHLGIPHY
MNMA_RHIEC      ---------------------AGLLKQQGYDVLGITLQLYDHGAAVHRCCAGQDIDDARHVCETLGIPHY
MTU1_DICDI      ---------------------AKLLKLQGFDVTGVFIKSWDEVEDTGRCQGERDWKDALEASNFLDIPMY
MNMA_RHILW      ---------------------AGLLKQQGYDVLGITLQLYDHGAAVHRCCAGQDIDDARRVCETLGIPHY
MNMA_COREF      ------------------------------------------------------------VCDKLGIPFY
MNMA_CORU7      --------------------------EAGHEVIGVHLALSQSPEGSRGCCSLEDSADARRVADKLGIPFY
MNMA_ANAPZ      ---------------------AVLLHKMGYKVIGATMQLYSSPNASKSCCGNADIYDAKKVAASFGFPHY
MNMA_RHIE6      ---------------------AGLLKQQGYDVLGITLQLYDHGAAVHRCCAGQDIDDARRVCETLGIPHY
MNMA_PROMA      ---------------------AALLVEAGWNVEGITL--WLMSGKGSCCTDGLVDAAG--ICEQLGIPHH
MNMA_PROM5      --------------------------EDGWKVEGLTLWLMK---GEGSCCSEGLVDAAG-LCEDLGIQHN
MNMA_CHLSY      ----------------------------GHQVTGVTMHLWDDDEXXXXXXXXXXXXXXXXXXXXXGIPFY
MNMA_CHLAA      ----------------------------GHQVTGVTMHLWDDDEXXXXXXXXXXXXXXXXXXXXXGIPFY
MNMA_BART1      ---------------------AGLLKREGYNVIGITLQLYDHGAATHRCCAGQDIEDARRVAEMLGIPHY
MNMA_BDEBA      ---------------------AALLVEQGYEVIGATMQVWDYEEGNGTCCSSIXXXXXXXXXXXLGIPFY
MNMA_THEP1      ----------------------YLLLKEGHEVKAFHMKTKEDEFKKKVCCSPSDTADAMRIAHFLGVEIE
MNMA_BARBK      ---------------------AGLLKREGYDVVGITLQLYDHGAATHRCCAGQDIEDARRVAETLRIPYY
MNMA_RHOOB      --------------------------------------------GSRGCCSKEDAGDARRAADVLGIPFY
MNMA_METPB      ---------------------AGLLKREGYDVVGVTLQLYDHGAATHRCCAGRDIHDARAVAETLGIPHY
MNMA_BEUC1      --------------------------------------------GSRGCCSIEDASDARRAADVLGIPFY
MNMA_BARQU      ---------------------AGLLKKEGYDVIGITLQLYDHGAATHRCCAGQDIEDARRVAETLGIPHY
MNMA_AGRT5      ---------------------AGILKREGYDVLGITLQLYDHGAAVHRCCAGQDIDDARRVCETLGIPHY
MNMA_RUBXD      ---------------------ALLLKERGYEVVAVTFRLHDGEPGSRSCCSPDTVLFARETAHGLGIPHF
MNMA_MYCS2      --------------------------------------------GSRGCCSKEDASDARRVADILGIPFY
MNMA_FERNB      ----------------------YLLIEKGYEVTAYHMKTVRDEIKHKVCCSPSDTHDAQLIAKKFGVPFK
MNMA_CORK4      --------------------------------------------GSRGCCSLEDSGDARRVADALGIPFY
MNMA_BARHE      ---------------------AGLLKKEGYDVIGITLQLYDHGAATHRCCAGQDIEDARCVAETLGIPHY
MNMA_PERMH      ---------------------ALLLKEKGYDVIGVTLKSIVCSNDIQVCCSPQDIKDAKRVASYLGIEHY
MNMA_RHOP5      ---------------------AALLKAEGYDVVGITLQLYDHGEAKGACCAGQDIHDARTVAERIGIPHY
MNMA_CAMLR      ---------------------AYKLKQAGHEIIGCYMKNYHEENIQKV----------EKVANFLGIKYH
MNMA_BRASB      ---------------------AALLKSEGYDVVGITLQLYDHGAATHRCCAGQDIHDARNVAERLGIPHY
MNMA_SULMW      ---------------------ALLLKKQGYDVIGIFMKYYNFE-----CPWREDSIDAMLVSQSLKIPFY
MNMA_MARMM      ------------------------------------------------------------VAEACGFRHY
MNMA_HYDS0      ---------------------AYLLKEQGHDVIGVTLRFYKEEENARVCCSPKDVQDARIVCDMLGIPHI
MNMA_THELT      ------------------------LKNEGYEIVAYHMKTMKDEFKHKICCSPSDTVDAKLIAKTAGVPLK
MNMA_RHORT      ---------------------AALLKEQGHDVVGLTMRLYDHGKGARTCCAGQDIHDARRVADRLGIAHY
MNMA_RHOPS      ---------------------AALLKSQGYDVVGITLQLYDHGAATHRCCAGQDIHDARAVAERIGIPHY
MNMA_RHOPA      ---------------------AALLKAQGYDVVGITLQLYDHGEAKGACCAGQDIHDARAVAERIGIPHY
MNMA_FRASN      ----------------------------------------------------------------LGIPFY
MNMA_SACEN      --------------------------------------------------------------DILGIPFY
MNMA_MAGSA      ---------------------AALLKEQGYDVVGVTLQLYDATSGIETCCAGKDIHDARAVADALGIPHY
MNMA_THEFY      --------------------------------------------------------------DVIGIPFY
MNMA_MESSB      ---------------------AGLLAREGYEVVGVTLQLYDHGAAVHRCCAGQDIDDARRVAETLGIAHY
MNMA_AZOC5      ---------------------AGLLARAGFDVVGVTLQLYDQGEAARRCCAGQDIYDARDVADRLGIPHY
MNMA_PARL1      ---------------------AALLKEQGYDVVGITLQLYDHGAAKGACCAGQDIQDARRVADQIGIPHY
MNMA_CAUCR      ---------------------AALLARAGYDVVGVTLQLYDHGAAKGACCAGQDILDARMAAERIGIPHY
MNMA_THEMA      ----------------------------------------------------------------LGVEIE
MNMA_RHOSR      --------------------------------------------GSRGCCSKEDAGDARRAADVLGIPFY
MNMA_DESVV      -----------------------LLKEQGQQVCGLHARFIPP-------TGHDPVPDIRAMCDRLGVDLH
MNMA_DESVH      -----------------------LLKEQGQQVCGLHARFIPP-------TGHDPVPDIRAMCDRLGVDLH
MNMA_MYCGI      --------------------------------------------GSRGCCSKEDAGDARRVADVLGIPFY
MNMA_CAUSK      ---------------------AALLAKAGYDVVGVTLQLYDHGAAKGACCAGQDILDARMAAERIGIPHY
MNMA_MYCA9      --------------------------------------------GSRGCCSKEDAADARRVADMLGIPFY
MNMA_HELPS      ---------------------AYSLKEQGHELVGIYLKLHASEKKHDL-----YIKNAQKACEFLGIPLE
MNMA_HELHP      ---------------------AHLLSSQGYEVIGIYLKLHDKNKKHDI-----YIANCEQVAAHLHIDFQ
MNMA_RENSM      --------------------------------------------GSRGCCTIEDSTDAWKACEKLGIPYY
MNMA_SPHAL      ------------------------------------------------------------VADRLGFVHH
MNMA_HELPH      ---------------------AYSLKEQGHELVGIYLKLHASEKKHDL-----YIKNAQKACEFLGIPLE
MNMA_ERYLH      ------------------------------------------------------------VADRLGIAHY
MNMA_HELPJ      ---------------------AYSLKEQGHELVGIYLKLHASEKKHDL-----YIKNAQKACEFLGIPLE
MNMA_CAMJD      ---------------------AYKLKNLGHEVIGCYMKNYHEENIKKV----------EKVANFLQIPYH
MNMA_HELPY      ---------------------AYSLKEQGHELVGIYLKLHASEKKHDL-----YIKNAQKACEFLGIPLE
MNMA_CAMJR      ---------------------AYKLKNLGHEVIGCYMKNYHEENIKKV----------EKVANFLQIPYH
MNMA_CAMJE      ---------------------AYKLKNLGHEVIGCYMKNYHEENIKKV----------EKVANFLQIPYH
MNMA_XANP2      ---------------------AGLYARAGYDVVGVTLQLYDHGEAAHRCCAGQDIYDASEVARTLGIPHY
MNMA_UNCTG      ---------------------AYLLKKQGYEVTGTTMSIWDKTKVNDSCLGPENENIETAIADFLTIPLY
MNMA_MYCPA      --------------------------------------------GSRGCCSKEDASDARRVADVLGIPFY
MNMA1_ARCB4     ---------------------AYMLQNEGYEVEGIYLKLHNRTDGYH----EKNLGYIEDVAKFLNIKYY
MNMA_CAMJ8      ---------------------AYKLKNLGHEVIGCYMKNYHEENIKKV----------EKVANFLQIPYH
MNMA_MYCA1      --------------------------------------------GSRGCCSKEDASDARRVADVLGIPFY
MNMA_CAMJJ      ---------------------AYKLKNLGHEVIGCYMKNYHEENIKKV----------EKVANFLQIPYH
MNMA_BRASO      ---------------------AALLKSQGYDVVGITLQLYDHGAATHRCCAGQDIHDARNVAERLGIPHY
MNMA_BRAJA      ---------------------AALLKAEGYDVVGITLQLYDHGAATHRCCAGQDIHDARDVAAKLGIPHY
MNMA_RHOE4      --------------------------------------------GSRGCCSKEDAGDARRAADVLGIPFY
MNMA_METEP      ---------------------AGLLKREGYDVVGVTLQLYDHGAATHRCCAGRDIHDARAVAETLGIPHY
MNMA_PELUB      ---------------------AAMMKNEGYNVIGITLKLYKETASSKQCCAGQDIMDAKRVADKLKIEHK
MNMA_NOVAD      ----------------------------------------------------------------LGIAHY
MNMA_HELPG      ---------------------AYSLKEQGHELVGVYLKLHASEKKHDL-----YIKNAQKACEFLGIPLE
MNMA_RHOCS      ---------------------AALLKEQGYDVVGITLQLYDHGGRKGACCAGQDIYDARQVADRIDIPHY
MNMA_OLICO      ---------------------AALLKAEGYDVIGITLQLYDHGEATHRCCAGQDIHDARDVAERIGIPHY
MNMA_METS4      ---------------------AGLLRRQGYDVVGITLQLYDHGAATHRCCAGQDIHDARRAAETLGIPHY
MNMA_RHOP2      ---------------------AALLKSQGYDVVGITLQLYDHGAATHRCCAGQDIHDARDVAERIGIPHY
MNMA_DESVM      ------------------------------------------------------------MCARLGVDFH
MNMA2_BACTN     ---------------------AMRLLEAGYEVTGVTFRFYELNDSTEYLEDARH------LAERLGIRHI
MNMA_THEM4      ------------------------------------------------------------VAQKFGVELK
MNMA_GLUDA      ------------------------LVAEGHEVVGATLQLYDESARKGACCAGRDIHDARRVADRLGIPHY
MNMA_ARTAT      --------------------------------------------GSRGCCTIEDSRDAWRACDVLGIPYY
MNMA_HELAH      ---------------------AYNLKEQGHELVGIYLKLHASEKKHDL-----YIKNAQKACEFLGIPLE
MNMA_GLUOX      ---------------------AALLKRQGHEVIGATLQLYDHGQAAKACCAGRDIMDARAVADRLGFPHY
MNMA_EHRRG      ---------------------AALLHKLGYKVIGITLQNNKNSNTKGACCGSLDTKDAKQVASSMGFPHY
MNMA_ACIC1      ----------------------------------------------------------------LGIPFY
MNMA_CLAM3      --------------------------------------------GSRGCCTIEDSMDARRAADLLGIPFY
MNMA_ARTS2      --------------------------------------------GSRGCCTIEDSRDAWRACDVLGIPYY
MNMA_NOCSJ      --------------------------------------------------------------DVIGIPFY
MNMA1_BACFR     ---------------------AMLLLEAGYEVTGVTFRFYEFNGSTEYLEDARA------LAARLGIGHI
MNMA_WOLSU      ---------------------AYLLQEAGHEVVGIYLKLHDND-----LKHAQNIQNIEKVSQKLGIETH
MNMA_CLAMS      --------------------------------------------GSRGCCTVEDSMDARRAADLLGIPFY
MNMA_EHRRW      ---------------------AALLHKLGYKVIGITLQLYXXXXXKGACCGSLDTQDAKQVASSMGFPHY
MNMA_MYCLE      --------------------------------------------GSRGCCSKEDVSDARRVADVLGIPFY
MNMA_MYCLB      --------------------------------------------GSRGCCSKEDVSDARRVADVLGIPFY
MNMA_MICLC      --------------------------------------------GSRGCCTIEDASDAWRACERLGIPFY
MNMA_FRAAA      ----------------------------------------------------------------LGIPFY
MNMA_PARDP      ---------------------AAMLAAQGYDVIGVTLQLYDHXXXXXXXXXXXXXQDIHDVAERIGFPHY
MNMA_CAMFF      ------------------------LLEAGYSVVGCYMKLHSKPGYHE-----ENIRKVKKVGEFLGIETH
MNMA_ANADF      ---------------------AALLVAEGHDVIGVSMRVADYSDARRSCCAPXXXXXXXXXXXXXXIPFY
MNMA_LEIXX      ----------------------------------------------------------------IGIPYY
MNMA_SALAI      --------------------------------------------------------------DVIGIPFY
MNMA_PETMO      ----------------------------------------------------------------------
MNMA_METNO      ---------------------AGLLKRQGYDVVGITLQLYDHGAATHRCCAGQDIHDARRAAETLGIPHY
MNMA_KOCRD      --------------------------------------------------------------EKLGIPYY
MNMA_CAMC5      ---------------------AKILKEAGHEIEGCYMKLHQKPGYHE-----ENIRKVKKVGEYLGIKVH
MNMA2_FUSNN     ---------------------AYLLKEQGYEVIGITLNQHLEENSKDI-------EDTKKVCDKLGIIHE
MNMA_MYCVP      --------------------------------------------GSRGCCSKEDAGDARRVADVLGIPFY
MNMA_SILPO      ------------------------------------------------------------VAEERGFPHY
MNMA_RHOS4      ------------------------------------------------------------VAETMGFPHY
MNMA_RHOS1      ------------------------------------------------------------VAETMGFPHY
MNMA_ROSDO      ---------------------AAMLAEEGYDVVGVTLQLYDHXXXXXXXXXXXXXXDIHDVSEKMGFPHY
MNMA_LAWIP      -------------------------------------------------------------CHNLNVPLH
MNMA1_BACFN     ---------------------AMLLLEAGYEVTGVTFRFYEFNGSTEYLEDARA------LAARLGIGHI
MNMA_THENN      ----------------------YLLLKEGHEVKAFHMKTKEDEFKKKVCCSPSDTADAIRIARSLGVEIE
MNMA_STRAW      --------------------------------------------------------------DVIGIPFY
MNMA_SILST      ------------------------------------------------------------VAEERGFPHY
MNMA_DESDG      --------------------------EAGHQVTALHAHFLSPHDTPE--TTAHNTQAIEKACRALGADFH
MNMA_STRGG      --------------------------------------------------------------DVIGIPFY
MNMA_STRCO      --------------------------------------------------------------DVIGIPFY
MNMA_CAMC1      ---------------------AKFLQEAGHEVQGCYMMLHQKPGYHE-----ENIRKVKKVGEYLGIKVH
MNMA_DINSH      ------------------------------------------------------------VAEEMGFPHY
MNMA_RHOSK      ------------------------------------------------------------VAETMGFPHY
MNMA_MYCUA      --------------------------------------------GSRGCCSKEDASDARRVADVLGIPFY
MNMA_MYCMM      --------------------------------------------GSRGCCSKEDASDARRVADVLGIPFY
MNMA_FRASC      ----------------------------------------------------------------LGIPFY
MNMA_TROWT      -----------------------------HDVVGVHLALSRSASGKRGCCTPRXXXXXXXXXXXIGIPFY
MNMA_TROW8      -----------------------------HDVVGVHLALSRSASGKRGCCTPRXXXXXXXXXXTIGIPFY
MNMA_MYCSJ      --------------------------------------------GSRGCCSKEDAGDARRVADVLDIPFY
MNMA_MYCSS      --------------------------------------------GSRGCCSKEDAGDARRVADVLDIPFY
MNMA_MYCSK      --------------------------------------------GSRGCCSKEDAGDARRVADVLDIPFY
MNMA_JANSC      ------------------------------------------------------------VAETMGFPHY
MNMA_DESAP      ----------------------------------------------------------------LGLPHH
MNMA_SORC5      ----------------------------GYEVVGVTLHLWDPDDGKSRCCAPEDQHDARRVADHLGIPHY
MNMA_RHOS5      ------------------------------------------------------------VAETMGFPHY
MNMA_ACICJ      ---------------------AGLMHEAGHEVIGVTLQLYDHGAAKGACCAGQDIHDARNVADRLGIAHY
MNMA_THESQ      ----------------------YLLLKEGHEVKAFHMKTKEDEFKKKVCCSPSDTADAIRIARSLGVEIE
MNMA_CAMHC      ---------------------AKILKDAGYEIEGCYMKLHGRDDYHA-----KNIEKVQDVGNFLEIKTH
MNMA_NITWN      ---------------------AALLKSEGYDVVGITLQLYDHGAATHRCCAGQDIHDARNVAARLGVPHY
MNMA_MYCTU      ----------------------------------------------------------------LGIPFY
MNMA_MYCTA      ----------------------------------------------------------------LGIPFY
MNMA_MYCBT      ----------------------------------------------------------------LGIPFY
MNMA_MYCBP      ----------------------------------------------------------------LGIPFY
MNMA_MYCBO      ----------------------------------------------------------------LGIPFY
MNMA_KINRD      ----------------------------------------------------------------------
MNMA_ANADE      ---------------------AALLAGEGHEVIGVTMRVADYSDAARSCCAPDDVEDXXXXXXXLGIPFY
MNMA_SALTO      --------------------------------------------------------------DVLSIPFY
MNMA_NITHX      ---------------------AALLKSEGYDVVGITLQLYDHGAATHRCCAGQDIHDARNVAERLGIPHY
XNI_SHEHH       -------------------------------------------------------------CRKL-LKFH
QUEC_HELPY      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVNGKSR
MNMA_SALTI      TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVNGKSR
MNMA_SALPB      TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVNGKSR
MNMA_SALPA      TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVNGKSR
MNMA_SALCH      TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVNGKSR
MNMA_SALTY      TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVNGKSR
MNMA_SALAR      TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRVDINGKSR
MNMA_CITK8      TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_ECOSM      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_ECOLI      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_ECOLC      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_ECOHS      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_ECODH      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_ECO57      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_ECO24      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_ECOUT      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_ECOL5      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_ECOK1      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_SHISS      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_SHIFL      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_SHIF8      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_SHIDS      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_SHIBS      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_SHIB3      TVNFAAEYWNNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_ECOL6      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLCADYIATGHYVRRAXVDGKSR
MNMA_ENT38      TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADFIATGHYVRRADVDGKSQ
MNMA_KLEP3      TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSQ
MNMA_KLEP7      TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSQ
MNMA_ENTS8      TVNFAAEYWDNVFEHFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
MNMA_SERP5      TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADFIATGHYVRRQDVDSKSR
MNMA_YERE8      TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRQDVNGKSR
MNMA_PHOLL      TVNFAAEYWDNVFEHFLAEYRAGRTPNPDILCNKEIKFKAFLEFAAEDLNADYIATGHYVRRRDINGKSQ
MNMA_PROMH      TINFAAEYWDNVFEHFLSEYKAGRTPNPDILCNKEIKFKAFLEYAAEDLGADYIATGHYVRRRDIDGKSQ
MNMA_YERP3      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRQDVDGKSR
MNMA_YERPY      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRQDVDGKSR
MNMA_YERPS      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRQDVDGKSR
MNMA_YERPP      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRQDVDGKSR
MNMA_YERPN      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRQDVDGKSR
MNMA_YERPG      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRQDVDGKSR
MNMA_YERPE      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRQDVDGKSR
MNMA_YERPB      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRQDVDGKSR
MNMA_YERPA      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRQDVDGKSR
MNMA_PECCP      TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRHDVDGKSR
MNMA_SODGM      TVNFAAEYWDNVFAHFLAEYQVGRTPNPDILCNKEIKFKAFLEFADDDLGADYIATGHYVRRADVNGKSR
MNMA_ERWCT      TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRHDVDGKSR
MNMA_EDWI9      TVNFAAEYWDNVFELFLQEYRAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRRDINGTTQ
MNMA_SHEAM      TVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFADDILDADYIAMGHYVRRRDTDGKTE
MNMA_HAEI8      KINFAAEYWDNVFEHFLTEYKAGRTPNPDILCNKEIKFKAFLEYAAEDLGADYIATGHYVRRAGDNENAK
MNMA_HAEIN      KINFAAEYWDNVFEHFLTEYKAGRTPNPDILCNKEIKFKAFLEYAAEDLGADYIATGHYVRRAGDNENAK
MNMA_SHELP      TVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFADDILDADYIAMGHYVRRSDASGQSQ
MNMA_HAES1      KINFAAEYWDNVFEHFLAEYKAGRTPNPDILCNKEIKFKAFLEYAVEDLGADYIATGHYVRRSDVNGQTK
MNMA_HAEIG      KINFAAEYWDNVFEHFLTEYKAGRTPNPDILCNKEIKFKAFLEYAAEDLGADYIATGHYVRRAGDNENAK
MNMA_HAES2      KINFAAEYWDNVFEHFLAEYKAGRTPNPDILCNKEIKFKAFLEYAVEDLGADYIATGHYVRRSDVNGQTK
MNMA_PSYIN      TINFAAEYWDNVFEHFLAEYKAGRTPNPDIMCNKEIKFKAFLEFAAEDLGADYIATGHYVRRREVDGHVQ
MNMA_PHOPR      TINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEVLEADYIAMGHYTRRSFPTAKPK
MNMA_SHEON      TVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFADDILDADYIAMGHYVRRRDEDGTTQ
MNMA_SHEHH      TVNFASEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFADEILDADYIAMGHYVRRRDIDGTSQ
MNMA_AERS4      TINFAAEYWDNVFEHFLEEYKAGRTPNPDILCNKEIXXXXXXXXXXXXXGATYIATGHYVRRDDSTGHPR
MNMA_SHEPW      TVNFASEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFADEILDADYIAMGHYVRRRDIDGTSQ
MNMA_AERHH      TINFAAEYWDNVFEHFLEEYKAGRTPNPDILCNKEIXXXXXXXXXXXXXGATYIATGHYVRRDDSTGRPR
MNMA_ACTPJ      KINFAAEYWDNVFEHFLNEYKAGRTPNPDILCNKEIKFKAFLEYAAEDLGADYIATGHYVRRSGDDNNAQ
MNMA_SHESW      TVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFADEILDADYIAMGHYVRRRDSDGSTQ
MNMA_SHEB9      TVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFADEILDADYIAMGHYVRRRDTDGSTQ
MNMA_SHEPC      TVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFADEILDADYIAMGHYVRRRDSDGSTQ
MNMA_SHEB8      TVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFADEILDADYIAMGHYVRRRDSDGSTQ
MNMA_SHEPA      TVNFASEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFADEILDADYIAMGHYVRRRDIDGTSQ
MNMA_ACTP2      KINFAAEYWDNVFEHFLNEYKAGRTPNPDILCNKEIKFKAFLEYAAEDLGADYIATGHYVRRSGDDNNAQ
MNMA_SHEB5      TVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFADEILDADYIAMGHYVRRRDSDGSTQ
MNMA_SHEB2      TVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFADEILDADYIAMGHYVRRRDSDGSTQ
MNMA_SHESH      TVNFASEYWDNVFEYFLAEYKAGRTPNPDIICNKEIKFKAFLEFADDILDADYIAMGHYVRRSDESGQSQ
MNMA_VIBPA      TINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEVLEADYIAMGHYVRRSPENGKPQ
MNMA_MANSM      KINFAAEYWDNVFEHFLAEYKAGRTPNPDILCNKEIKFKAFLEYAAEDLGADYIATGHYVRRRGDDENAR
MNMA_VIBCH      TINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEVLDADYIAMGHYVRRTPQNGKPQ
MNMA_VIBC3      TINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEVLDADYIAMGHYVRRTPQNGKPQ
MNMA_VIBVY      KINFAAEYWDNVFEYFLSEYKAGRTPNPDILCNKEIKFKAFLEFADEVLDADYIAMGHYVRRSPENGKPQ
MNMA_SHEWM      TVNFASEYWDNVFEYFLAEYKAGRTPNPDIICNKEIKFKAFLEFADDILDADYIAMGHYVRRSDDSGQSQ
MNMA_TOLAT      TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRDDSTGHPR
MNMA_SHEDO      TVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFADDILDADYIAMGHYVRRRDSDGSVQ
MNMA_VIBVU      KINFASEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEVLDADYIAMGHYVRRSPENGKPQ
MNMA_VIBFM      TINFAAEYWDNVFEYFLEEYKAGRTPNPDILCNKEIKFKAFLEFADEVLDADFIAMGHYVRRTIANGKPQ
MNMA_VIBF1      TINFAAEYWDNVFEYFLEEYKAGRTPNPDILCNKEIKFKAFLEFADEVLDADFIAMGHYVRRTIANGKPQ
MNMA_HAEDU      KINFAAEYWDNVFEHFLAEYQAGRTPNPDILCNKEIKFKAFLEYAAEDLGADYIATGHYVRRSADNENAQ
MNMA_VIBHB      TINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEVLDADYIAMGHYVRRSENDEKPQ
MNMA_PSEHT      TVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFAAQALGADFIATGHYVRRELRDDKYV
MNMA_IDILO      TINFAAEYWDNVFEYFLEEYKAGRTPNPDIMCNKEIKFKXXXXXXXXXXXXXYIATGHYVRRQQRDGKWE
MNMA_BAUCH      KVNFAAEYWDNVFEYFLAEYQVGRTPNPDILCNKNIKFKVFLDFATQNLGADYIATGHYVIRKDINGKSR
MNMA_SHESM      TVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEXXXXXXXXXXXXXXXXXYIAMGHYVRRRDADGTTQ
MNMA_SHESR      TVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEXXXXXXXXXXXXXXXXXYIAMGHYVRRRDADGTTQ
MNMA_PASMU      KINFAAEYWDNVFEHFLQEYKAGRTPNPDILCNKEIKFKAFLDYAAEDLGADYIATGHYVRRGEKDGQCQ
MNMA_COLP3      TINFATEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFACEDLGADYIATGHYVQRELRDNSWK
MNMA_SHESA      TVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEXXXXXXXXXXXXXXXXXYIAMGHYVRRRDADGTTQ
MNMA_SHEFN      TVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFADDILDADYIAMGHYVRRRDSDGSVE
MNMA_PSEA6      QINFAAEYWDNVFEYFLEEYKSGRTPNPDIMCNKEIXXXXXXXXXXXXXXXDYIATGHYVRRREVDGHWQ
MNMA_ACTSZ      KINFATEYWDNVFEHFLSEYKAGRTPNPDILCNKEIKFKAFLEYAAEDLGADYIATGHYVRRSGPDHDAH
MNMA_BLOPB      TINFSKEYWENVFQVFLQEYSVGRTPNPDILCNKEIKFKYFLEFALQDLDADLIATGHYVRRVDMNKKTY
MNMA_PSEU2      TANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALM-LGADLIATGHYVRRRDIDGRTE
MNMA_PSE14      TANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALM-LGADLIATGHYVRRRDIDGRTE
MNMA_PSEFS      TANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYAMM-LGADLIATGHYVRRRDIDGRTE
MNMA_PSESM      TANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALM-LGADLIATGHYVRRRDIDGRTE
MNMA_MARMS      TANFASEYWDNVFEHFLAEYKAGRTPNPDILCNKEIKFKAFLEYAMA-LNADYIATGHYVRRGEKNGEPL
MNMA_PSEU5      TANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYALM-LGADLIATGHYVRRRDRDGRSE
MNMA_PSYWF      TANFAMEYWDRVFEHFLAEYQAGRTPNPDILCNKEIKFKAFLDYAVT-LGADYIATGHYTRRSDGLEVAH
MNMA_PSEMY      TANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYALS-LGADLIATGHYVRRRDIDGRTE
MNMA_PSEPF      TANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYAMM-LGADLIATGHYVRRRDIDGRTE
MNMA_PSEF5      TANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYAMM-LGADLIATGHYVRRRDIDGRTE
MNMA_PSEA7      TANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYALM-LGADLIATGHYVRRRDLDGRTE
MNMA_PSEPW      TANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALS-LGADLIATGHYVRRRDTGAVTE
MNMA_PSEE4      TANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALS-LGADLIATGHYVRRRDTGELTE
MNMA_PSEPG      TANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALS-LGADLIATGHYVRRRDTGDLTE
MNMA_SACD2      TANFARQYWDNVFEYFLEEYKACRTPNPDILCNREIKFKVFLEYAKK-LGADYIATGHYTRTSQHEGCTQ
MNMA_PSEPK      TANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALS-LGADLIATGHYVRRRDTGALTE
MNMA_PSEP1      TANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALS-LGADLIATGHYVRRRDTGALTE
MNMA_PSEA8      TANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYALM-LGADLIATGHYVRRRDRDGRTE
MNMA_PSEAE      TANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYALM-LGADLIATGHYVRRRDRDGRTE
MNMA_PSEAB      TANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYALM-LGADLIATGHYVRRRDRDGRTE
MNMA_METCA      TVNFAAEYWDEVFEVFLSEYRAGRTPNPDILCNKQIKFRAFLDYA-EDLGADLIAMGHYARVAEEEGRLQ
MNMA_MARAV      TASFAAEYWDRVFEHFLSEYSAGRTPNPDILCNKEVKFRAFLDYAVT-LGADYIATGHYTRQRPLNGKAQ
MNMA_PSYA2      TANFAMEYWDRVFEHFLAEYKAGRTPNPDILCNKEIKFKAFLDYALT-LGADYIATGHYTRRS-VNYKNQ
MNMA_PSYCK      TANFAMEYWDRVFEHFLAEYKAGRTPNPDILCNKEIKFKAFLDYALT-LGADYIATGHYTRRS-VNYKNQ
MNMA_FRAP2      KINFAAEYWDNVFEHFLTEYKAGRTPNPDILCNKEIKFKAFLSYV-HLLGGDYIATGHYARTKVIDGSVQ
MNMA_FRATT      KINFAAEYWDNVFEHFLIEYKAGRTPNPDILCNKEIKFKAFLSYV-HLLGGDYIATGHYAQRLAADGSVQ
MNMA_FRATM      KINFAAEYWDNVFEHFLIEYKAGRTPNPDILCNKEIKFKAFLSYV-HLLGGDYIATGHYAQRLAADGSVQ
MNMA_FRAT1      KINFAAEYWDNVFEHFLIEYKAGRTPNPDILCNKEIKFKAFLSYV-HLLGGDYIATGHYAQRLAADGSVQ
MNMA_BUCAP      KVNFSKEYWEKVFENFLNEHKKGKTPNPDILCNKEIKFKIFFNYAIQELQSDYIATGHYAQIKKKNGKYF
MNMA_ACIBS      TANFAMEYWDRVFEHFLAEYAAGRTPNPDILCNKEIKFRAFLDHAMT-LGADFIATGHYARRAETAYNSK
MNMA_ACIBY      TANFAMEYWDRVFEHFLAEYAAGRTPNPDILCNKEIKFRAFLDHAMT-LGADFIATGHYARRAETAYNSK
MNMA_ACIBT      TANFAMEYWDRVFEHFLAEYAAGRTPNPDILCNKEIKFRAFLDHAMT-LGADFIATGHYARRAETAYNSK
MNMA_ACIB5      TANFAMEYWDRVFEHFLAEYAAGRTPNPDILCNKEIKFRAFLDHAMT-LGADFIATGHYARRAETAYNSK
MNMA_ACIB3      TANFAMEYWDRVFEHFLAEYAAGRTPNPDILCNKEIKFRAFLDHAMT-LGADFIATGHYARRAETAYNSK
MNMA_FRATN      KINFAAEYWDNVFEHFLIEYKAGRTPNPDILCNKEIKFKAFLSYV-HLLGGDYIATGHYARRVLEDGSVQ
MNMA_ACIBC      TANFAMEYWDRVFEHFLAEYAAGRTPNPDILCNKEIKFRAFLDHAMT-LGADFIATGHYARRAETAYNSK
MNMA_FRATW      KINFAAEYWDNVFEHFLIKYKAGRTPNPDILCNKEIKFKAFLSYV-HLLGGDYIATGHYAQRLAADGSVQ
MNMA_FRATO      KINFTAEYWDNVFEHFLIEYKAGRTPNPDILCNKEIKFKAFLSYV-HLLGGDYIATGHYAQRLAADGSVQ
MNMA_FRATH      KINFTAEYWDNVFEHFLIEYKAGRTPNPDILCNKEIKFKAFLSYV-HLLGGDYIATGHYAQRLAADGSVQ
MNMA_FRATF      KINFTAEYWDNVFEHFLIEYKAGRTPNPDILCNKEIKFKAFLSYV-HLLGGDYIATGHYAQRLAADGSVQ
MNMA_BLOFL      TVNFAQEYWENVFQVFLQAYQSGFTPNPDVLCNKEIKFKHFLDFALEDLGADFIATGHYVRCMNVKKKIT
MNMA_ALKOO      SVNFEKEYWDRVFTYFLNEYKAGRTPNPDVMCNKEIKFKAFLDHAIK-LGADYLATGHYAQVDYSDGEYR
MNMA_ACIAD      TANFAMEYWDRVFEHFLAEYAAGRTPNPDILCNKEIKFRAFIDHAMT-LGADFIATGHYTRRGESMQNSR
MNMA_CHRSD      TANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKVFLEYA-EMLGAEKIATGHYVRQGWRDGHCR
MNMA_HAHCH      TASFSAEYWDRVFEHFLDEYRAGRTPNPDILCNKEIKFKAFLDYA-QALGGDLIATGHYAQFSRFGEHTY
MNMA_LACC3      SINFEKEYWDRVFQYFLDEYKAGRTPNPDVMCNKEIKFKAFLDYA-DQLNADYIAMGHYAQKTDENGIVH
MNMA_CUPTR      AVNFAAEYKDRVFADFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAETIATGHYARRQNAAGRFE
MNMA_EXIS2      AVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLDHAMR-LGADFVATGHYARAVYEDGEHK
MNMA_LYSSC      AVNFEKQYWDKVFTYFLEEYKAGRTPNPDVMCNKEIKFKAFLEHAMS-LGADYLATGHYARDRSGDGEVK
MNMA_RALEH      AVNFAAEYKDRVFADFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAETIATGHYARRQNAAGRFE
MNMA_METFK      AVNFSKEYKERVFANFLEEYSAGRTPNPDILCNSEIKFKAFLDHAMA-LGGDLMATGHYAQVREKNGLFQ
MNMA_NITEU      VVNFSTEYRERVFNLFLKEYQAGRTPNPDVLCNSEIKFRAFLDHAL-NLGADWIATGHYAQVHETDGLFQ
MNMA_ALKMQ      TVNFEKEYWEKVFQYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHALK-LGADYLATGHYAQVDYKDGEYR
MNMA_CHRVO      IVNFAKEYKDRVFSYFLKEYSAGRTPNPDVLCNAEIKFKAFLDYAME-LGADCIATGHYARKLEQDGTHY
MNMA2_GEOKA     AVNFEKQYWDKVFTYFLNEYKAGRTPNPDVMCNKEIKFKAFLEHAMS-IGADYIATGHYARVEFRDGEYK
MNMA_GEOTN      AVNFEKQYWDKVFTYFLNEYKAGRTPNPDVMCNKEIKFKAFLEHAMS-IGADYVATGHYARVEFRDGEYK
MNMA_BACLD      AVNFEKQYWEKVFQYFLDEYKAGRTPNPDVMCNKEIKFKAFLEHALS-LGADYLATGHYARVDRTDGRVK
MNMA_BACCN      AVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHAMA-LGADYVATGHYARVAYMDGEYK
MNMA_POLSQ      AVNFAAEYRERVFADFLCEYAAGRTPNPDVLCNAEIKFKAFLDHAMS-LGADAIATGHYARVRHEGGRVQ
MNMA_RALEJ      AVNFAAEYKDRVFADFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAETIATGHYARRQNAAGRFE
MNMA_BURCC      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LDAEMIATGHYARVRERDGRFE
MNMA_STACT      AVNFEQEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAMK-LGADYVATGHYAQRRDADGNVE
MNMA_BORA1      YVNFASEYKDRVFADFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAEHIATGHYARVRAVDTRFQ
MNMA_BACHK      AVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHAIA-LGADYVATGHYARVAYMDGEYK
MNMA_BACCZ      AVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHAIA-LGADYVATGHYARVAYMDGEYK
MNMA_BACCQ      AVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHAIA-LGADYVATGHYARVAYMDGEYK
MNMA_BACAN      AVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHAIA-LGADYVATGHYARVAYMDGEYK
MNMA_BACAH      AVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHAIA-LGADYVATGHYARVAYMDGEYK
MNMA_BORPD      YVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMT-LGAEHIATGHYARVRAIAGEYQ
MNMA_AZOSE      VVNFSAEYKDRVFADFLREYEAGRTPNPDVLCNSEIKFRCFLDHAMA-LGADRIATGHYVREWANDGRSQ
MNMA_LISMO      AVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA-ESLGADYVATGHYAQVKKVGDEIE
MNMA_BACCR      AVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHAIA-LGADYVATGHYARVAYMDGEYK
MNMA_BACC1      AVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHAIA-LGADYVATGHYARVAYMDGEYK
MNMA_AZOSB      VVNFSAEYKDRVFADFLREYEAGRTPNPDILCNSEIKFRCFLDHAMQ-LGAERIATGHYVREWINDGRSQ
MNMA_ALCBS      TANFAEQYWDRVFAHFLAEYKAGRTPNPDILCNKEIKFQAFLDHAIT-LGADYIATGHY-SQVSHTGKAK
MNMA_XANCP      FRDFSGEYWSGVFEHFLAEYAAGRTPNPDVLCNREVKFKHFLE-AAQALGAERIATGHYARVAHLGGRWR
MNMA_XANCB      FRDFSGEYWSGVFEHFLAEYAAGRTPNPDVLCNREVKFKHFLE-AAQALGAERIATGHYARVAHLGGRWR
MNMA_XANC8      FRDFSGEYWSGVFEHFLAEYAAGRTPNPDVLCNREVKFKHFLE-AAQALGAERIATGHYARVAHLGGRWR
MNMA_LISIN      AVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA-ESLGADYVATGHYAQVKKVGDEIE
MNMA_BURPS      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAQTIATGHYARVRERDGRFE
MNMA_BURP6      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAQTIATGHYARVRERDGRFE
MNMA_THICR      VENFSGEYWDRVFEHFLAEYQSGRTPNPDILCNKEVKFKAFLEHAMT-LGADYIATGHYARISDENGQCY
MNMA_BURMS      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAQTIATGHYARVRERDGRFE
MNMA_BURMA      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAQTIATGHYARVRERDGRFE
MNMA_BURM9      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAQTIATGHYARVRERDGRFE
MNMA_BURM7      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAQTIATGHYARVRERDGRFE
MNMA_BACWK      AVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHAIA-LGADYVATGHYARVAYMDGEYK
MNMA_RALME      AVNFAAEYKDRVFADFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGANTIATGHYARRQAANGKFE
MNMA_LISMF      AVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA-ESLGADYVATGHYAQVKKVGDEIE
MNMA_LISMC      AVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA-ESLGADYVATGHYAQVKKVGDEIE
MNMA_LISW6      AVNFEKEYWDKVFTYFLEEYKLGRTPNPDVMCNKEIKFKAFLEHA-ESLGADYVATGHYAQVKKIGDEIE
MNMA_BURP1      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAQTIATGHYARVRERDGRFE
MNMA_BURP0      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAQTIATGHYARVRERDGRFE
MNMA_STRZP      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYARVADEDGTVH
MNMA_STRPJ      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAIT-LGADYVATGHYARVADEDGTVH
MNMA_LISMH      AVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA-ESLGADFVATGHYAQVKKVGDEIE
MNMA_STRSY      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAM-NLGADYVATGHYAQTRDEDGTVH
MNMA_STRS2      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAM-NLGADYVATGHYAQTRDEDGTVH
MNMA_STRPS      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYARVVDEDGTVH
MNMA_STRR6      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYARVADEDGTVH
MNMA_STRP2      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYARVADEDGTVH
MNMA_STAS1      AVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHALK-LGADYVATGHYARRRHEDGHVE
MNMA_BURTA      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAETIATGHYARVRERDGRFE
MNMA_STRP7      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYARVVDEDGTVH
MNMA_STAAB      AVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAM-NLGADYVATGHYARHRHEDGHVE
MNMA_BUCAI      KMNFSSEYWEYVFENFLKEYKKGNTPNPDILCNKEIKFNMFLNYSIQELKADYIATGHYARIKKINGKYL
MNMA_STRZT      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAIT-LGADYVATGHYARVADEDGTVH
MNMA_STRPN      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAIT-LGADYVATGHYARVADEDGTVH
MNMA_STRPI      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYARVADEDGTVH
MNMA_BURCM      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LDAEMIATGHYARVRERDGRFE
MNMA_NEIM0      XXNFAAQYKDKVFAYFLQEYSAGRTPNPDVLCNAEIKFKCFLDYAVGQ-GADTIATGHYARKEVRNGVHY
MNMA_LACLA      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAME-LGADYVATGHYAQRTDENGIVH
MNMA_XANC5      FRDFSGEYWNGVFAHFLAEYAAGRTPNPDVLCNREVKFKHFLD-AAQALGAERIATGHYAQVAHRGGRWR
MNMA_NEIMB      XXNFAAQYKDKVFAYFLQEYSAGRTPNPDVLCNAEIKFKCFLDYAVGQ-GADTIATGHYARKEVRNGVHY
MNMA_BURXL      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAQTIATGHYARVRENNGRFE
MNMA_STAAT      AVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAM-NLGADYVATGHYARHRHEDGHVE
MNMA_STAAR      AVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAM-NLGADYVATGHYARHRHEDGHVE
MNMA_STAAN      AVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAM-NLGADYVATGHYARHRHEDGHVE
MNMA_STAAM      AVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAM-NLGADYVATGHYARHRHEDGHVE
MNMA_STAAE      AVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAM-NLGADYVATGHYARHRHEDGHVE
MNMA_STAAC      AVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAM-NLGADYVATGHYARHRHEDGHVE
MNMA_STAA9      AVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAM-NLGADYVATGHYARHRHEDGHVE
MNMA_STAA8      AVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAM-NLGADYVATGHYARHRHEDGHVE
MNMA_STAA3      AVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAM-NLGADYVATGHYARHRHEDGHVE
MNMA_STAA2      AVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAM-NLGADYVATGHYARHRHEDGHVE
MNMA_STAA1      AVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAM-NLGADYVATGHYARHRHEDGHVE
MNMA_XANAC      FRDFSGEYWSDVFEHFLAEYAAGRTPNPDVLCNREVKFKHFLD-AAQALGAERIATGHYAQVAHRGGRWR
MNMA_STRP4      SVNFEKEYWDRVFEYXXAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYARVADEDGTVH
MNMA_NITEC      AVNFSAEYRERVFSLFLAEYQAGRTPNPDVLCNSEIKFKAFLDHALA-LGADWIATGHYAQVHEINGQFQ
MNMA_NEIMF      XXNFAAQYKDKVFAYFLQEYSAGRTPNPDVLCNAEIKFKCFLDYAVGQ-GADTIATGHYARKEVRNGVHY
MNMA_STAAW      AVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAM-NLGADYVATGHYARHRHEDGHVE
MNMA_STAAS      AVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAM-NLGADYVATGHYARHRHEDGHVE
MNMA_STRGC      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALT-LGADYVATGHYAQKRDQDGLVH
MNMA_LACS1      SVNFEKEYWDRVFTYFLDEYKNGRTPNPDIMCNKEVKFKAFLDYAMS-IDADYIAMGHYAQRRDEDGRVH
MNMA_LACRJ      SVNFEKEYWDRVFKYFIAEYKKGRTPNPDVICNKEIKFKAFIEY-ANQLGADYVATGHYADKRDENGRMH
MNMA_LACRD      SVNFEKEYWDRVFKYFIAEYKKGRTPNPDVICNKEIKFKAFIEY-ANQLGADYVATGHYADKRDENGRMH
MNMA_STRZJ      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAIT-LGADYVATGHYARVVDEDGTVH
MNMA_STRMU      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQVSDADGTVH
MNMA_RALPJ      AVNFAAEYKDRVFADFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMA-LGADTIATGHYARVREVDGRFE
MNMA_LACLM      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAME-LGADYVATGHYAQRTDEDGTVH
MNMA_LACAC      SINFEKEYWHRVFEYFLDEYKKGRTPNPDVMCNSQIKFKSFLEFAM-DLDADYIAMGHYAKTTDANGVTH
MNMA_XANOR      FRDFSGEYWSGVFEHFLAEYAAGRTPNPDVLCNREVKFKHFLD-AAQALGAERIATGHYAQVAHRGGRWR
MNMA_XANOP      FRDFSGEYWSGVFEHFLAEYAAGRTPNPDVLCNREVKFKHFLD-AAQALGAERIATGHYAQVAHRGGRWR
MNMA_THIDA      AVNFAAEYKERVFSYFLAEYQAGRTPNPDVLCNAEIKFKAFLDDAIAR-GADYIATGHYVGKGDTFGRAA
MNMA_HERAR      AVNFAAEYKDRVFAEFLREYEAGRTPNPDVLCNAEIKFKAFLDHAML-LGADMIATGHYARVREVTGQVQ
MNMA_BURM1      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAETIATGHYARVRERDGRFE
MNMA_STAHJ      AVNFEQEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHALK-LGADYVATGHYARRRHDDGHVE
MNMA_LACLS      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAME-LGADYVATGHYAQRTDEDGTVH
MNMA_BUCBP      KVNFSFEYWENVFQKFLFEYKMGRTPNPDVLCNKEIKFKIFFEYSIQDLQAHYIATGHYVQKRIFKNKYF
MNMA_RALSO      AVNFAAEYKDRVFADFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMA-LGADTIATGHYARVREAGGRFE
MNMA_NEIG1      XXNFAAQYKDKVFAYFLQEYSAGRTPNPDVLCNAEIKFKCFLDYAVGQ-GADTIATGHYARKEARNGVHY
MNMA_BURPP      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAETIATGHYVRQNERNGRFE
MNMA_BURA4      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LDAEMIATGHYARVRERDGRFE
MNMA_STAES      AVNFEEQYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHALK-LGADYVATGHYARRRHDDGHVE
MNMA_STAEQ      AVNFEEQYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHALK-LGADYVATGHYARRRHDDGHVE
MNMA_XANOM      FRDFSGEYWSGVFEHFLAEYAAGRTPNPDVLCNREVKFKHFLD-AAQALGAERIATGHYAQVAHRGRRWR
MNMA_STRMK      FRDFSSEYWQGVFEHFLAEYAAGRTPNPDVLCNREVKFKHFLD-AARELGAERIATGHYARVTQRGHQWL
MNMA_STRA5      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQTRDENGIVH
MNMA_STRA3      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQTRDENGIVH
MNMA_STRM5      FRDFSNEYWQGVFEHFLAEYAAGRTPNPDVLCNREVKFKHFLD-AARELGAERIATGHYARVAQRGHQWL
MNMA_STRSV      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALT-LGADYVATGHYAQKRDQDGLVH
MNMA_JANMA      AVNFASEYKDRVFAEFLREYQAGRTPNPDVLCNAEIKFKAFLDHAML-LGADMIATGHYARVREVTGRVE
MNMA_LACGA      SINFEKDYWERVFEYFLNEYKKGRTPNPDVMCNKEIKFKSFLDFAM-DLDADYIAMGHYAAKVDENGIVH
MNMA_BURS3      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LDAEMIATGHYARVRERDGRFE
MNMA_STRA1      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQTRDENGIVH
MNMA_LACJO      SINFEKDYWERVFEYFLDEYKKGRTPNPDVMCNKEIKFKSFLDFAM-DLDADYIAMGHYAARVDDNGVVH
MNMA_LACBA      SVNFEKEYWDRVFTYFLDEYKKGRTPNPDVICNKEIKFKAFLDYALE-LGADYIATGHYAQTRDEAGHAH
MNMA_DIAST      HVNFAAEYKDRVFAEFLREYQAGRTPNPDVLCNAEIKFKAFLDHAMR-LGAEKIATGHYVRQNPATGLFE
MNMA_BACHD      AVNFEKEYWDKVFTYFLEEYKAGRTPNPDVMCNKEIKFKAFLNHALT-LGADYVATGHYAQVKNVDGQYQ
MNMA_STRU0      SVNFEKEYWDRVFEYFLSEYKAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQRRDEDGIVH
MNMA_DECAR      VVNFAAEYRERVFAEFLSEYQAGRTPNPDILCNSEIKFKAFLDHAMQ-LGAEKIATGHYAGVREFDGKFQ
MNMA_STRT2      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQVVDEDGIVH
MNMA_STRT1      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQVVDEDGIVH
MNMA_STRPZ      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQKRDENGKVH
MNMA_NITOC      EANFAMEYWDRVFHYFLEEYRLGRTPNPDILCNREIKFKTFLDHALA-LGNTLIATGHYARIDQKEGRYR
MNMA_LACSS      SVNFEKEYWDRVFEYFLDEYKHGRTPNPDVMCNKEVKFKAFLDYAME-LDADFIAMGHYAQERDENGIAH
MNMA_BURCJ      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LDAEMIATGHYARVRERDGRFE
MNMA_LEGPL      TVNFSKEYWDRVFAYFLSEYEKGRTPNPDVLCNKEIKFNAFLNYALT-LGADYIATGHYAKNTIEGSIGY
MNMA_BACSU      AVNFEKQYYEKVFQYFLDEYKAGRTPNPDVLCNKEIKFKAFLEHALS-LGADYLATGHYARVDRSGGKVR
MNMA_ALHEH      RANFAARYREQVFEVCLREYRAGRTPNPDILCNQRIKFRAFLDHALS-LGASKVATGHYAGVGEQGGRFT
MNMA_ACIAC      HVNFAAEYKDRVFAEFLREYEAGRTPNPDVLCNAEIKFKAFLDHAMR-VGAEKIATGHYVRHNPATGLHE
MNMA_VESOH      TINFSVDYWNDVFTHFLKEYKKGRTPNPDILCNQKIKFGAFLKHAIS-LGADKIATGHYARIAKKNGTYQ
MNMA_STRPD      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQKRDENGTVY
MNMA_LEGPH      TVNFSKEYWDRVFAYFLSEYEKGRTPNPDVLCNKEIKFNAFLNHALT-LGADYIATGHYAKNTIEGSIGY
MNMA_LACH4      SINFEKEYWHRVFEYFLNEYKKGRTPNPDVMCNSQIKFKSFLDFAM-DLDADYIAMGHYAKTVDADGLTH
MNMA_DELAS      HVNFASEYKDRVFAEFLREYQAGRTPNPDVLCNAEIKFKAFLDHAMR-LGAEKIATGHYVRQNPDTQLFE
MNMA_STRPG      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQKRDENGTVH
MNMA_STRPF      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQKRDENGTVH
MNMA_STRP6      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQKRDENGTVH
MNMA_LEGPC      TVNFSKEYWDRVFAYFLSEYEKGRTPNPDVLCNKEIKFNAFLNHAL-NLGADYIATGHYAKNTIEGSIGY
MNMA_COXB1      VVNFSKAYWNHVFQHCLDEFAQGRTPNPDVWCNREIKFKSLLDHAKK-LGATHLATGHYACIQNENNEYR
MNMA_STRPC      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQKRDENGTVH
MNMA_STRPB      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQKRDENGTVH
MNMA_POLSJ      HVNFAADYKDRVFAEFLREYQAGRTPNPDILCNAEIKFKAFLDHAMR-LGAEKIATGHYVRRNESTGLHE
MNMA_LEGPA      TVNFSKEYWDRVFAYFLSEYEKGRTPNPDVLCNKEIKFNAFLNHAL-NLGADYIATGHYAKNTIEGSIGY
MNMA_COXBU      VVNFSKAYWNHVFQHCLDEFAQGRTPNPDVWCNREIKFKSLLDHAKK-LGATHLATGHYACIQNENNEYR
MNMA_COXBN      VVNFSKAYWNHVFQHCLDEFAQGRTPNPDVWCNREIKFKSLLDHAKK-LGATHLATGHYACIQNENNEYR
MNMA_COXB2      VVNFSKAYWNHVFQHCLDEFAQGRTPNPDVWCNREIKFKSLLDHAKK-LGATHLATGHYACIQNENNEYR
MNMA_STRP1      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQKRDENGTVH
MNMA_STRTD      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQVVDEDGIVH
MNMA_STRP8      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLGYAMT-LGADYVATGHYAQKRDENGTVH
MNMA_STREM      SVNFEKEYWDRVFEYFLAEYRSGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQKRDENGVVH
MNMA_COXBR      VVNFSKAYWNHVFQHCLDEFAQGRTPNPDVWCNREIKFKSLLDHAKK-LGATHLATGHYACIQNENNEYR
MNMA_BACA2      AVNFEKQYWEKVFQYFLDEYKAGRTPNPDVMCNKEIKFKAFLDHALS-LGADYLATGHYARVDRSAGTVR
MNMA_STRPM      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQKRDENGTVH
MNMA_LACPL      SINFEKEYWDRVFTYFLDEYKKGRTPNPDVICNKEIKFKAFLDYAM-DLGADYIATGHYARQHDEDGTMH
MNMA_BURCH      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LDAEMIATGHYARVRERDGRFE
MNMA_BURCA      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LDAEMIATGHYARVRERDGRFE
MNMA_STRP3      SVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQKRDENGTVH
MNMA_NITMU      AVNFSAEYKERVFSHFLAEYKAGRTPNPDVLCNAEIKFKAFLDHAA-GLGADYIATGHYAQVRNTDGVFQ
MNMA_STRE4      SVNFEKEYWDRVFEYFLAEYRSGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQKRDENGVVH
MNMA1_GEOKA     SVNFEKEYWDRVFTYFIDELKRGRTPNPDVLCNTEIKFKAFVDYALS-LDADYIATGHYARINRENGQIA
MNMA_BURP8      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LGAETIATGHYARVREIDGRFE
MNMA_METPP      HVNFAAEYRDRVFAEFLREYEAGRTPNPDVLCNAEIKFKAFLDHALR-LGAGKIATGHYVRRAEAGGRFE
MNMA_WIGBR      IVNFSEQYWNKVFKIFLREYKIGNTPNPDILCNKEIKFKYFLNFAIKEMQADYIATGHYVRKINFNGKSQ
MNMA_LACF3      SVNFEKEYWDRVFTYFIDEFKKGRTPNPDVICNKEIKFKAFIEY-ANQLGADYVATGHYALKRDEAGNMH
MNMA_POLNA      HVNFAANYKDRVFAEFLREYQAGRTPNPDILCNAEIKFKAFLDHAMR-LGAEKIATGHYVRQNEATGLHE
MNMA_XYLFA      FRDFSHEYWQEVFTHFLAEYANGRTPNPDVLCNREIKFKHFLETARE-LGADSIATGHYARIKHYRQRWH
MNMA_BORPA      YVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMA-LGAEHIATGHYARVRTVETRHQ
MNMA_BORPE      YVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMA-LGAEHIATGHYARVRTVETRHQ
MNMA_BORBR      YVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMA-LGAEHIATGHYARVRTVETRHQ
MNMA_BURVG      AVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMS-LDAEMIATGHYARVRERDGRFE
MNMA_NEIMA      XXNFAAQYKDKVFAYFLQEYSAGRTPNPDVLCNAEIKFKCFLDYAVGQ-GADTIATGHYARKEVRNGVHY
MNMA_ENTFA      SVNFEKEYWDRVFEYFLAEYRLGRTPNPDVMCNKEIKFKAFLDYAMQ-LGADYVATGHYAQETDENGVVH
MNMA_XYLFT      FRDFSHEYWQEVFTHFLAEYANGRTPNPDVLCNREIKFKHFLETARE-LGADRIATGHYARIEHYRQRWH
MNMA_XYLFM      FRDFSHEYWQEVFTHFLAEYANGRTPNPDVLCNREIKFKHFLETARE-LGADRIATGHYARIEHYRQRWH
MNMA_XYLF2      FRDFSHEYWQEVFTHFLAEYANGRTPNPDVLCNREIKFKHFLETARE-LGADRIATGHYARIEHYRQRWH
MNMA_STRS7      SVNFEKEYWDRVFEYFLAEYRSGRTPNPDVMCNKEIKFKAFLDYAMT-LGADYVATGHYAQKRDENGVVH
MNMA_OCEIH      SVNFEKQYWDKVFTYFLDEYKAGRTPNPDVMCNKEIKFKAFLDHALA-LGADYLATGHYAQRRDKNGRVE
MNMA_ACISJ      HVNFAAEYKDRVFAEFLREYQAGRTPNPDVLCNAEIKFKAFLDHAMR-LGAEKIATGHYVRQNPATGLFE
MNMA_PARUW      AVNFVENYRKQVFTQFIADFQKGWTPNPDILCNREIKFKVFLEKALE-LGADFLATGHYCQNLILDGSPS
MNMA_BACSK      AVNFEKQYWDKVFTYFLEEYKAGRTPNPDVMCNKEIKFKAFLNHAIS-LGADYVATGHYAQLQELDGEYR
MNMA_LACDB      SINFEKEYWERVFQYFLKEYKAGRTPNPDIMCNTEVKFKSFLEXXXXXXXXXXXM-GHYAKTVDENGVTH
MNMA_DICNV      TVNFVQQYHDRVFQLFLDEYRAGRTPNPDVLCNREIKF-AELALYAQQLGADFLATGHYAQRLQSNHEAA
MNMA_LACDA      SINFEKEYWERVFQYFLKEYKAGRTPNPDIMCNTEVKFKSFLEXXXXXXXXXXXM-GHYAKTVDENGVTH
MNMA_FINM2      SINFEKEYYDRVFTYFLDEYKKGRTPNPDIMCNKEIKFKAFLDFAMK-LGADYVATGHYARIERGDDGVK
MNMA_PEDPA      SVNFEKEYWDRVFTYFLDEYKKGRTPNPDVICNNEIKFKAFLDYAIS-LGADYVATGHYAQERDENGHQH
MNMA_RUTMC      AVNFSADYWNDVFIHFLKEHKKGRTPNPDVLCNQKIKFRVFLEHALS-LGADKIATGHYARIAEKNGTYQ
MNMA_LEPCP      HVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMR-LGADRIATGHYVRHNPATGLHE
MNMA_BACP2      AVNFEKQYWDKVFQYFLDEYKAGRTPNPDVMCNKEIKFKAFLEHALS-LGADYLATGHYARVDRTGDEVK
MNMA_RHOFD      HVNFAAEYKDRVFAEFLREYQAGRTPNPDILCNAEIKFKAFLDHALR-LGAQKIATGHYARVRCVDGRFE
MNMA_MESFL      RIDFVQEYWEYVFEYFIKEYKKGRTPNPDILCNKYIKFDKFLNHAINELKADYIAMGHYVRFNEKTKQYE
MNMA_VEREI      HVNFAADYKERVFAEFLREYQAGRTPNPDVLCNAEIKFKAFLDHALR-LGAEKIATGHYVRRNPASGRFE
MNMA_MYCAP      RVDFVNEYWNDVFKTFISEYEAGRTPNPDILCNKYIKFKAFSDYAFNNLGADYIAMGHYAKVTD----GR
MNMA_CHLMU      TVSFAKEYKERVFSRFLKEYTNGYTPNPDVLCNREIKFD-LLQKKVRELKGDFLATGHYCR-GGLDGTG-
MNMA_BUCCC      TINFSEEYWENVFLNFLKEHKKGNTPNPDILCNKIIKFNICLKFSLKYLKSDYFATGHYAKIKKTKKNFY
MNMA_MYCCT      RVDFIKEYWDYVFSYFIEEYKKARTPNPDILCNKYIKFDKFLNYAINQLNADYIAMGHYA-KVEFNKTTK
MNMA_CHLTR      TVSFSKEYKERVFSRFLREYANGYTPNPDVLCNREIKFD-LLQKKVRELKGDFLATGHYCRGADGTGLSR
MNMA_CHLTA      TVSFSKEYKERVFSRFLREYANGYTPN