[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF68462.1

[Show Plain Result]


## Summary of Sequence Search
    1::305
   11::306     2e-67  45%  312 aa  PANE_LACLA RecName: Full=Putative 2-dehydropantoate 2-reductase;   
   11::302     2e-61  42%  307 aa  PANE_STRP3 RecName: Full=Putative 2-dehydropantoate 2-reductase;   
   11::302     2e-61  42%  307 aa  PANE_STRP1 RecName: Full=Putative 2-dehydropantoate 2-reductase;   
   11::302     3e-61  42%  307 aa  PANE_STRP8 RecName: Full=Putative 2-dehydropantoate 2-reductase;   
   11::302     6e-61  40%  307 aa  PANE_STRP6 RecName: Full=Putative 2-dehydropantoate 2-reductase;   
    1::295     1e-26  33%  301 aa  PANE_PYRHO RecName: Full=Putative 2-dehydropantoate 2-reductase;   
    3::303     1e-26  28%  310 aa  PANE_AQUAE RecName: Full=Putative 2-dehydropantoate 2-reductase;   
    1::295     5e-25  32%  300 aa  PANE_PYRAB RecName: Full=Putative 2-dehydropantoate 2-reductase;   
   67::292     6e-24  31%  294 aa  PANE_ARCFU RecName: Full=Putative 2-dehydropantoate 2-reductase;   
   11::290     1e-19  25%  296 aa  PANE_VIBCH RecName: Full=2-dehydropantoate 2-reductase;       
   65::291     2e-17  28%  303 aa  PANE_SHIFL RecName: Full=2-dehydropantoate 2-reductase;       
   65::291     2e-17  28%  303 aa  PANE_ECOLI RecName: Full=2-dehydropantoate 2-reductase;       
   19::302     4e-17  24%  303 aa  YKPB_BACSU RecName: Full=Uncharacterized oxidoreductase ykpB;      
   19::291     4e-17  27%  303 aa  PANE_SALTI RecName: Full=2-dehydropantoate 2-reductase;       
   19::291     5e-17  28%  303 aa  PANE_SALTY RecName: Full=2-dehydropantoate 2-reductase;       
   65::291     7e-17  28%  303 aa  PANE_ECO57 RecName: Full=2-dehydropantoate 2-reductase;       
   65::290     3e-16  27%  303 aa  PANE_YERPE RecName: Full=2-dehydropantoate 2-reductase;       
   35::298     1e-13  26%  326 aa  PANE_RHILO RecName: Full=Putative 2-dehydropantoate 2-reductase;   
  159::268     2e-12  35%  303 aa  PANE_PSEAE RecName: Full=Probable 2-dehydropantoate 2-reductase;   
   80::274     5e-12  30%  279 aa  PANE_PYRAE RecName: Full=Putative 2-dehydropantoate 2-reductase;   
   82::339     3e-11  26%  350 aa  PANE_SCHPO RecName: Full=Probable 2-dehydropantoate 2-reductase;   
   29::298     6e-10  24%  301 aa  PANE_LISIN RecName: Full=Putative 2-dehydropantoate 2-reductase;   
   26::296     8e-10  20%  303 aa  PANE_HALSA RecName: Full=Putative 2-dehydropantoate 2-reductase;   
   61::289     2e-09  24%  295 aa  PANE_MYCTU RecName: Full=Putative 2-dehydropantoate 2-reductase;   
   24::207     9e-09  25%  319 aa  PANE_ANASP RecName: Full=Putative 2-dehydropantoate 2-reductase;   
   93::276     1e-08  26%  290 aa  PANE_CAUCR RecName: Full=Putative 2-dehydropantoate 2-reductase;   
   23::268     2e-08  23%  298 aa  PANE_BACSU RecName: Full=Probable 2-dehydropantoate 2-reductase;   
  143::336     3e-08  28%  356 aa  YD144_YEAST RecName: Full=Uncharacterized protein YDL144C;
   69::359     1e-04  26%  379 aa  PANE_YEAST RecName: Full=2-dehydropantoate 2-reductase;       
    1::305

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKXXXXXXXXMGCRFGYMLLEAGHDVTLIDGWQEHVDAIRSKGLFVETETTQKYYPIPAMLADESQGEFE
PANE_LACLA      ----------MGSRFGLMLHKGGNEVTLIDGWPEHVKAIKEHGLRANYNGEELTAHLSVELQSESKEKTD
PANE_STRP3      ----------MGCRFGYQISKTNNDVILLDNWEDHINAIKENGLVV-TGDVEETVKLPIMKPTEATQEAD
PANE_STRP1      ----------MGCRFGYQISKTNNDVILLDNWEDHINAIKENGLVV-TGDVEETVKLPIMKPTEATQEAD
PANE_STRP8      ----------MGCRFGYQISKTNNDVILLDNWEDHINAIKENGLVV-TGDVEETVKLPIMKPTEATQEAD
PANE_STRP6      ----------MGCRFGYQISKTNNDVILLDNWEDHINAIKENGLVV-TGDVEETVKLPIMKPTEATQEAD
PANE_PYRHO      MKIYILGAGAIGSLVGGLLANVGEDVTLI-GRGRHIEAINKRGLMIEGLTTKATTSIPGAKPD-------
PANE_AQUAE      MKFLIVGVGAIGSAYLAFLTRAGHEAAGLVR-RNPVNRIKVEGIWGEFEIPVKTFT----KVEEVPFIPD
PANE_PYRAB      MKIYILGAGAIGSLFGGLLANAGEDVLLI-GRDPHVSAINEKGLIVGIKDLNVKVEATTRVPEEKP---D
PANE_ARCFU      ---------------------------------------------------------------------D
PANE_VIBCH      ----------VGSLWALHLHSAGHQVAL---WSRQAQPTITLQLDEEAPISFRNQNLDTLI------HAD
PANE_SHIFL      ---------------------------------------------------------------------D
PANE_ECOLI      ---------------------------------------------------------------------D
YKPB_BACSU      ------------------LSEKGNDVTFLVR-QKRAEQLKKTGLVIHSEKGNVSFQ-PELISAGETGQFD
PANE_SALTI      ------------------LCKHGHDV---QGWLRSVNLIDTDGSFFNESLTAND---PDFLAKS-----E
PANE_SALTY      ------------------LCKHGHDV---QGWLRSVNLIDTDGSFFNESLTAND---PDFLAKS-----E
PANE_ECO57      ---------------------------------------------------------------------D
PANE_YERPE      ---------------------------------------------------------------------E
PANE_RHILO      ----------------------------------HLEAIQANGLRLIEDGEESMAPVRAAAKAEELGAQD
PANE_PSEAE      ----------------------------------------------------------------------
PANE_PYRAE      ----------------------------------------------------------------------
PANE_SCHPO      ---------------------------------------------------------------------E
PANE_LISIN      -------------------------LTLFTHRKEQADLLNQKGILIDNETTKNIHIHAAQITEEEQTKQQ
PANE_HALSA      -------------------------VTLLGHQSEHLTRVREDGLRVVQPDGTTRVTRPSVATDPSXXXXX
PANE_MYCTU      ---------------------------------------------------------------EVAGPVD
PANE_ANASP      --------------------KAGSDVHFL--LKSDYEKVNQDGLLVESKDGDFTLPQVNAYNDVAKPKCD
PANE_CAUCR      ----------------------------------------------------------------------
PANE_BACSU      -----------------------HDVTVVTRRQEQAAAIQSEGIRLYKGGEEFRADCSADTSINS--DFD
YD144_YEAST     ----------------------------------------------------------------------
PANE_YEAST      ------------------------------------------------------YPVEKCECPESKKPID


                         .         .         *         .         .         .         .:140
query           LVILFTKAMQLDSMLQRIKPLLPAAKVVMILSNGLGNIETLEKYVDRQKIYAGVTLWSSELEGAGHIMAT
PANE_LACLA      LIILFTKAMQLDKMLQDIKPLIDEHTKVLCLLNGIGHEDTIEKYVSKNNIFIGNTMWTAGLEGPGKAKLF
PANE_STRP3      LIILFTKAMQLPQMLQDIKGIIGKETKVLCLLNGLGHEDVIRQYIPEHNILMGVTVWTAGLEGPGRAHLQ
PANE_STRP1      LIILFTKAMQLPQMLQDIKGIIGKETKVLCLLNGLGHEDVIRQYIPEHNILMGVTVWTAGLEGPGRAHLQ
PANE_STRP8      LIILFTKAMQLPQMLQDIKGIIGKETKVLCLLNGLGHEDVIRQYIPEHNILMGVTVWTAGLEGPGRAHLQ
PANE_STRP6      LIILFTKAMQLPQMLQDIKGIIGKETKVLCLLNGLGHEDVIRQYIPEHNILMGVTVWTAGLEGPGRAHLQ
PANE_PYRHO      LIILTTKSYSTDDALNSAKDIVRDTWVLS-LQNGIGNEEKIMELGGRP--IGGITTNGAVLKEPGVVEWR
PANE_AQUAE      IVIISVKSYDTEEALKKVKPVVGENTFIMIAQNGYGNYEKAVEIYGEGKVILSRIIFGSKVIKPGHIRIT
PANE_PYRAB      LIVLATKSYSTIEALKSARHIVKGSWVLSI-QNGIGNEDKIIEFGG--KAIGGITTNGAMVEAPGVIKWT
PANE_ARCFU      ITFVTVKAYDTETVAKKLAEV--DAGVVCSLQNGVGNEEILAKYC--RKVLGGVTTYGANLKDYGHVVYA
PANE_VIBCH      LLLITVKAWQVEAALQPLLPHLNRETILLFMHNGMGAVEAISESLTHFPVLFATTTHGALKATLNQVSHT
PANE_SHIFL      LLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIEELQNI--QQPLLMGTTTHAARRDG-NVIIHV
PANE_ECOLI      LLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIEELQNI--QQPLLMGTTTHAARRDG-NVIIHV
YKPB_BACSU      VVIIASKAYSLGQVIEDVKPFIHQESVIIPFLNGYRHYEQLFAAFSKEQVLGGLCFIESALDNKGEIHHT
PANE_SALTI      LLLVTLKAWQVSDAVRTLASTLPVTSPILLIHNGMGTIEELQSI--QQPMLMGAITHAARRDG-NIIIHV
PANE_SALTY      LLLVTLKAWQVSDAVRTLASTLPVTSPILLIHNGMGTIEELQNI--QQPMLMGTITHAARRDG-NIIIHV
PANE_ECO57      LLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIEELQNI--QQPLLMGTTTHAACRDG-NVIIHV
PANE_YERPE      LLLVCLKAWQVSSAVTALLPKLNPECKILLLHNGMGTQEELP--LNEHVFLHGVTTHAARRDG-NTIIHV
PANE_RHILO      YVVLALKAHSLTPALDQIAPLLGDHTSVVTMQNGVGPLEAIWQRIGPQRVIGSVVYPAVEVDAPGLIRHV
PANE_PSEAE      ----------------------------------------------------------------------
PANE_PYRAE      --------------------------VAVVAQNGIGGYEEIKEAYPNS--VPAVVTYGVYREGC-RAELR
PANE_SCHPO      NMIVTTKAGQTENALSKYLPYLSKNSNILFVQNGMGAVENVPEEQNKPSIYQGVISHGCFQTAPFHFSHA
PANE_LISIN      LLIIAVKQYSLNEIIPILQKL-PTKIPILFIQNGAGHLERLSELGTTRTILLGISEHGAGREDDTTVIWR
PANE_HALSA      XXXXXXXKSYDTASAARALGRQCDGAMVLTLQNGLGNAAVLAEHVPADTVLVGTTTHGAARTEPGVVRHA
PANE_MYCTU      VLILAVKATQNDAARPWLTRLCDERTVVAVLQNGVEQVEQVQPHCPSSAVVPAIVWCSAETQPQGWVRLR
PANE_ANASP      VVVVALKTTQNHLLPKLLPPIVKNDGIVLVLQNGLGVEEEIAEILPQVHIIGGLCFLCSNKVGAGYIHHL
PANE_CAUCR      ---------------------------VAILRNGVEHVAPFVGKIAAERLVPAVVDIPAERSAPGRMLQR
PANE_BACSU      LLVVTVKQHQLQSVFSSLERI--GKTNILFLQNGMGHIHDLKDWHVGHSIYVGIVEHGAVRKSDTAVDHT
YD144_YEAST     ----------------------------------------------RYTVLSGIQLIGSTKIGSGHISQV
PANE_YEAST      NLVVTTKTYQTKEALAPYLPYINKNTNLILIQNGLGVLELLREEINRPHLFQGVISHGVYQDKAGVFNHA


                         +         .         .         .         .         *         .:210
query           GTGTIELQPIASQDSAQEAKVIATLNSAGLNAEISPDVLLSIWKKAAFNSVMNTYCALLDCNVGGFGQRP
PANE_LACLA      GDGSVELQNLISGEEETAKKLAEILSESGLNAKYSNNIHYSIYRKACVNGTMNGLCTILDTNMAGLGETK
PANE_STRP3      GVGALNLQSMDPSNQEAGHQVADLLNEANLNATYDENVVPNIWRKACVNGTMNSTCALLDCTIGELFASE
PANE_STRP1      GVGALNLQSMDPSNQEAGHQVADLLNEANLNATYDENVVPNIWRKACVNGTMNSTCALLDCTIGELFASE
PANE_STRP8      GVGALNLQSMDPNNQDAGHQVADLLNKANLNATYDENVVPNIWRKACVNGTMNSTCALLDCTIGELFASE
PANE_STRP6      GVGALNLQSMDPNNQDAGHQVADLLNKANLNATYDENVVPNIWRKACVNGTMNSTCALLDCTIGELFASE
PANE_PYRHO      GRGIIGLYPKGRNEFVEEVK--ETFNRAGLETEVTENIIGWKWAKTIVNSAINPIGAILEVKNGAIKDND
PANE_AQUAE      VSAVVIGDPSGKIDEEFLKNLARTFTEAGIPTRYERDVYKYLVDKIIYNSALNPLGALFEVNYGSLAENP
PANE_PYRAB      GKGVIGLYPQGKEKFIE--KVADVFNSADIETHVSENIISWIWAKAIVNSAINPIGTLLEVKNKVIREND
PANE_ARCFU      GEGYTYVGEMDGRVSGEAEMVAEVLRDAGMRAEAVNDIEFRIWAKAVVNAAINPITAICRVKNGEVVRNP
PANE_VIBCH      GFGQTQVGPFNALGARCDF-IADVFNHALAPVTWNPEIQQALWRKLAVNCAINPLTAIHQCANGAL-VAP
PANE_SHIFL      ANGITHIGPARQQDGDYSADILQT---------VLPDVAAELWRKLAVNCVINPLTAIWNCPNGELRHHP
PANE_ECOLI      ANGITHIGPARQQDGDYSADILQT---------VLPDVAAELWRKLAVNCVINPLTAIWNCPNGELRHHP
YKPB_BACSU      SASH---RFVFGEWNGERTERIRALEEAGVKAEISGHIEKDIWKKYLFIAAQAGITTLFQRPLGPILATE
PANE_SALTI      ANGTTHIGPAREQDG-DYSYLAEILQGVLPDVAWHNNIRAEMWRKLAVNCVINPLTALWNCPNGELRHHT
PANE_SALTY      ANGTTHIGPAREQDG--DYSYLADILQGVLDVAWHNNIRAEMWRKLAVNCVINPLTALWNCPNGELRHHT
PANE_ECO57      ANGITHIGPARQQDGDYSADILQT---------VLPDVAAELWRKLAVNCVINPLTAIWNCPNGELRHHP
PANE_YERPE      ASGMTHIGPTSSV-IIDDNHLADTLHQALPDVAWHNDISAACWQKLAVNCVINPLTGLYNCRNGDVQRYP
PANE_RHILO      EGKRFSLGEPSGERSERVTLLAEEMVKAGLQAPVRDDIRSEIWVKLWGNLSFNPISALTGSTLAAIVADE
PANE_PSEAE      ---------------------LTQLSQAGIPHSWSDDILERLWRKLALNCAINPLTVLHDCRNGGLRQHP
PANE_PYRAE      GVGEIYLPSAVST-------LAELLERGGGRVRLVEDIEPYRWLKLAVNAAINAITALLQAPNGVIISSP
PANE_SCHPO      GLGDLKISKVAAETPCEMIKSLGKSELLRLRYMNYPELLVNQCEKLVINACINPTTATLDCVNGELYNDE
PANE_LISIN      GHGRTKYS-IFQGELNDDLKELLT-SSPAFPIEKHANYQAIIQEKLFINAVINPLTAVLGVQNGKLLENQ
PANE_HALSA      GGGETTIGRYRGXXXXXXXXXXXXFSTGGMETTVTASPQRAVWEKVLVNVGINAATALADVDNGALVECP
PANE_MYCTU      GEAALVVPPAAEQFAG-------LLRGAGATVDCDPDFTTAAWRKLLVNALAGFM--VLSGRRSAMFRRD
PANE_ANASP      DYGQITLGEYAHGYSDRMQQISHDFQTAGISIELLEDLLLGRWKKLVWNIPYNGLSVVLN----------
PANE_CAUCR      RNGWIKV-PVGPAGEAFAALFAHT----PIELHVVEDFVTEAWKKLALNCAGAVNALVL--KPAGIAHDE
PANE_BACSU      GLGAIKWSAFDDAE-PDRLNILFQHNHSDFPIYYETDWYRLLTGKLIVNACINPLTALLQVKNGELLTTP
YD144_YEAST     GQDHLSCGAFDPQDAAQAANFVRMYSNEGQNVEFDPRVRYSRWKKLLYNAAINTSTALVGLDVPGVNKKS
PANE_YEAST      GWAGMKIAPWTEEEMIQKKSVVAANNSLGIEHSTYQEMLFGQLFKFLVNACMNPVTAILDCVNGEMKASC


                         .         .         .         +         .         .         .:280
query           GALDLAQAVVDEFVLVAASQNIPLTEQMVMNTVKKVFDPRESGHHYPSMHQDLHKGRLTEIDYLNGAIAR
PANE_LACLA      PAHDMVVTIVNEFAAVAKFENVNLDIAEVVQHVETCFDPSTIGLHYPSMYQDLIKNRLTEIDYINGAVSR
PANE_STRP3      DGLKMVKEIIHEFVIVGQAEGVELNEQYVMDTSVK------AAHHYPSMHQDLQNHRLTEIDFINGAVNT
PANE_STRP1      DGLKMVKEIIHEFVIVGQAEGVELNEQYVMDTSVK------AAHHYPSMHQDLQNHRLTEIDFINGAVNT
PANE_STRP8      DGLKMVKEIIHEFVIVGQAEGVELNEQYVMDTSVK------AAHHYPSMHQDLQNHRLTEIDFINGAVNT
PANE_STRP6      DGLKMVKEIIHEFVIVGQAEGVELNEEEITQYVMDT--SVRAAHHYPSMHQDLQNHRLTEIDFINGAVNT
PANE_PYRHO      YLLSIAVEVVKEGCKIALQNGIKFDISPMELLIQTLEQTREN---YNSMLQDIWRGKRTEIDFINGKIIE
PANE_AQUAE      HTKELMNRVIDEIFQVIEKAKLPCFWKSA-DEYKKVFYEKPTAEHYPSMLEDVKKGK-TEIEALNGAIVE
PANE_PYRAB      FLLSMAMEVVKEGCRVALQNGIEFDVPPMDLFFQTLEQTREN---YNSMLQDIWRGKKTEVDYINGKIVE
PANE_ARCFU      HLWEVARAVADEGRQVMARMGY---EFDAASEVRKVAE--MTAENRSSMLQDLERGKRTEVEFINGAIVK
PANE_VIBCH      EFTPIITAILDEVTAVMQAEAISGEAEALRDGVYQVI--QATAANLSSMHQDVFHRRPTEIDFITGYVVR
PANE_SHIFL      QEI---MQICEEVAAVIEREGHHTSAEDLRDYVMQVIDA--TAENISSMLQDIRALRHTEIDYINGFLLR
PANE_ECOLI      QEI---MQICEEVAAVIEREGHHTSAEDLRDYVMQVIDA--TAENISSMLQDIRALRHTEIDYINGFLLR
YKPB_BACSU      AGRHTAQTLIGEICTVLRKEGVPADPALEEESFRTM--TSMSYHMKSSMLRDMENGQTTEGDHLHGFLIE
PANE_SALTI      ---DEINAICEEVAAVIEREGYHTSADDLCYYVEQVID--STAENISSMLQDVRAMRHTEIDYITGYLLK
PANE_SALTY      ---DEINAICEEVAAVIEREGYHTSADDLRYYVEQVID--STAENISSMLQDVRAMRHTEIDYITGYLLK
PANE_ECO57      QEI---MQICEEVAAVIEREGHHTSAEDLRDYVMQVIDA--TAENISSMLQDIRTLRHTEIDYINGFLLR
PANE_YERPE      ---ELIERLCAEVASVMEMEGYHTSTESLLSYVNNVI--RSTADNTSSLLQDLRSQRHTEIDYITGYLLR
PANE_RHILO      GTRALARTMMLEAQAIGESLGV----RFPIGVDRRIKGAGDVGEHKTSMLQDLERGRPMEIDALVSAVQE
PANE_PSEAE      EEI---AALCDELGQLLHASGYDAAARSLLEDVRAVID--ATAANYSSMHQDVTRGRRTEIGYLLG----
PANE_PYRAE      YAQTLALEVAQEVLNVATALGV----KMPRNPVEEVLRVASAAKNLSSTARDVAACAKTEIDYINGAVVK
PANE_SCHPO      SAKELFRCIIKECVDIFF-KCIPLFKEKILN-VNRLLDTKVNGANSSSTRQDCLLLRETEIDAINGYVVK
PANE_LISIN      EWHRLLIRVVNEVETVLPIEN-------ALEKVETIC--RTTALNFSSMALDCMNERMTEIDGIVLPILE
PANE_HALSA      PG---ERVLXXXXXXXXXXXXXXXXXXXXXXXXXXXQVAARTASNESSMRQDLAGGARTEVESLHGAVVE
PANE_MYCTU      DVAALSRRYVAECLAVARAEGAXXXXXXXXXXXXXXXSPQDMG---TSMLADRAAHRPLEWDLRNGVIVR
PANE_ANASP      ----------------------------------------------------------------------
PANE_CAUCR      GAAQVMRSLVRECVAVGRAEGADLSDDLPDQVIARAADPGSVN----SLHADRAAGRAMELDARNGVIVR
PANE_BACSU      AYLAFMKLVFQEACRILKLEN----EEKAWERVQAVCG--QTKENRSSMLVDVIGGRQTEADAIIGYLLK
YD144_YEAST     TEIEVFHPAMRXXXXXXXXXXXXXXXXXXXXXXKKVFK--------PSMCVDCEKGQLMELEVILGNPIR
PANE_YEAST      GPV--FTSIIDECLQILRVAYRPLFQNAVLTTDNMVSEVTRIGRNSSSMRQDTLFLRDIEIEYINGYVVK


                         .         *         .         .         .         .         +:350
query           IGAQNNIAVPVNKLLTQLIHAKEAQ
PANE_LACLA      KGKKYNVATPYCDFLTQLVHSKE--
PANE_STRP3      KGEKLGINTPYCRMITELVHAKEA-
PANE_STRP1      KGEKLGINTPYCRMITELVHAKEA-
PANE_STRP8      KGEKLGINTPYCRMITELVHAKEA-
PANE_STRP6      KGEKLGINTPYCRMITELVHAKEA-
PANE_PYRHO      YAKLVNLEAPLNFLLWALVKAKES-
PANE_AQUAE      LGKKYGVSTPTNEFITKMVKAKE--
PANE_PYRAB      YAKAVNLEAPMNLLLWGLIKGKEA-
PANE_ARCFU      KGEEFGIDCAVNRTLLNLVRGVES-
PANE_VIBCH      KGEQHGIATPVNSALYQQIKTLE--
PANE_SHIFL      RARAHGIAVPENTRLFEMVKRKESE
PANE_ECOLI      RARAHGIAVPENTRLFEMVKRKESE
YKPB_BACSU      KAKRLSLAAPVLETVYANLQMYEAE
PANE_SALTI      RARVHGLAVPENSRLFEMVKRKESE
PANE_SALTY      RARVHGLAVPENSRLFEMVKRKESE
PANE_ECO57      RARAHGIAVPENTRLFEMVKRKESE
PANE_YERPE      RARSHGMALPENARLYELIKRKES-
PANE_RHILO      LG-----------------------
PANE_PSEAE      -------------------------
PANE_PYRAE      YGEALGVATPVNKALFNLIKARES-
PANE_SCHPO      LAENNGFQATVNKTMMLLTKSR---
PANE_LISIN      KGDKTETSLPTLRTLYQIIKGLEGE
PANE_HALSA      RARDHDIAVPVIRTLADLV------
PANE_MYCTU      KARAHGLATPISDVLVPLLAA----
PANE_ANASP      -------------------------
PANE_CAUCR      RGAAHGIATP---------------
PANE_BACSU      -------------------------
YD144_YEAST     IAKRNGVATPTLSILYNLLVLVQAK
PANE_YEAST      LADNLNLCCKVNKTIGEL-------