[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF68527.1

[Show Plain Result]


## Summary of Sequence Search
    1::722
  128::299     2e-18  35%  325 aa  YBEQ_ECOLI RecName: Full=Uncharacterized protein ybeQ;
  127::283     1e-14  34%  584 aa  YL018_MIMIV RecName: Full=Putative sel1-like repeat-containing
  393::517     3e-14  34%  794 aa  SE1L1_RAT RecName: Full=Protein sel-1 homolog 1;AltName:
  389::513     3e-14  34%  790 aa  SE1L1_MOUSE RecName: Full=Protein sel-1 homolog 1;AltName:
  393::517     3e-14  34%  794 aa  SE1L1_MESAU RecName: Full=Protein sel-1 homolog 1;AltName:
  393::517     3e-14  34%  794 aa  SE1L1_HUMAN RecName: Full=Protein sel-1 homolog 1;AltName:
  172::288     3e-13  36%  351 aa  FB84_ARATH RecName: Full=F-box protein At1g70590;
   58::169     8e-13  38%  184 aa  YBET_ECOLI RecName: Full=Uncharacterized protein ybeT;
  350::462     3e-12  36%  467 aa  Y1327_NEIMB RecName: Full=Uncharacterized protein NMB1327;
  120::246     3e-12  33%  250 aa  HCPA_HELPJ RecName: Full=Beta-lactamase hcpA;       
  133::266     7e-12  31%  533 aa  YL021_MIMIV RecName: Full=Putative sel1-like repeat-containing
  175::298     3e-11  31%  355 aa  HCPE_HELPJ RecName: Full=Putative beta-lactamase hcpE;       
  116::228     3e-11  29%  290 aa  HCPC_HELPY RecName: Full=Putative beta-lactamase hcpC;       
  116::228     3e-11  29%  290 aa  HCPC_HELPJ RecName: Full=Putative beta-lactamase hcpC;       
  120::246     3e-11  31%  250 aa  HCPA_HELPY RecName: Full=Beta-lactamase hcpA;       
  175::298     2e-10  30%  355 aa  HCPE_HELPY RecName: Full=Putative beta-lactamase hcpE;       
  396::522     1e-09  31%  696 aa  SKT5_YEAST RecName: Full=Protein SKT5;
  743::878     1e-09  27%  974 aa  PODJ_CAUCR RecName: Full=Localization factor podJL;AltName:
  743::878     1e-09  27%  974 aa  PODJ_CAUCN RecName: Full=Localization factor podJL;AltName:
  151::263     1e-09  28%  305 aa  HCPD_HELPJ RecName: Full=Putative beta-lactamase hcpD;       
  151::285     2e-09  26%  306 aa  HCPD_HELPY RecName: Full=Putative beta-lactamase hcpD;       
  667::838     9e-09  31% 1137 aa  K0746_MOUSE RecName: Full=SEL1-like repeat-containing protein
   22::134     2e-08  31%  154 aa  YWQK_BACSU RecName: Full=Uncharacterized protein ywqK;
  168::287     5e-08  28%  540 aa  YR815_MIMIV RecName: Full=Putative sel1-like repeat-containing
  782::914     5e-08  33%  932 aa  CHR3_SCHPO RecName: Full=Chitin synthase regulatory factor
  339::452     1e-07  29%  688 aa  SE1L2_RAT RecName: Full=Protein sel-1 homolog 2;AltName:
  339::452     2e-07  29%  688 aa  SE1L2_MOUSE RecName: Full=Protein sel-1 homolog 2;AltName:
   93::190     2e-07  28%  211 aa  MOTX_VIBPA RecName: Full=Sodium-type polar flagellar protein motX;
  292::452     2e-07  25%  688 aa  SE1L2_HUMAN RecName: Full=Protein sel-1 homolog 2;AltName:
   52::240     2e-07  33%  346 aa  LR2BP_RAT RecName: Full=LRP2-binding protein;
   40::131     2e-07  30%  138 aa  HCPB_HELPY RecName: Full=Beta-lactamase hcpB;       
  309::457     7e-07  31%  509 aa  K0141_RAT RecName: Full=Uncharacterized protein KIAA0141 homolog;
   39::195     9e-07  28%  268 aa  EXOR_RHIME RecName: Full=Exopolysaccharide production negative
   57::125     1e-06  32%  165 aa  Y1625_HAEIN RecName: Full=Uncharacterized protein HI1625;
   43::238     1e-06  29%  341 aa  LR2BP_XENLA RecName: Full=LRP2-binding protein;
  308::434     1e-06  32%  515 aa  K0141_HUMAN RecName: Full=Uncharacterized protein KIAA0141,
  266::393     2e-06  34%  475 aa  ALGK_PSEAE RecName: Full=Alginate biosynthesis protein algK;Flags:
   86::241     2e-06  32%  347 aa  LR2BP_HUMAN RecName: Full=LRP2-binding protein;AltName:
  140::244     3e-06  34%  348 aa  LR2BP_MACFA RecName: Full=LRP2-binding protein;
  122::240     4e-06  28%  343 aa  LR2BP_DANRE RecName: Full=LRP2-binding protein;
  561::648     4e-06  34%  833 aa  HRD3_CANGA RecName: Full=ERAD-associated E3 ubiquitin-protein
   52::250     6e-06  31%  346 aa  LR2BP_MOUSE RecName: Full=LRP2-binding protein;
  263::396     6e-06  28%  484 aa  ALGK_PSEPK RecName: Full=Alginate biosynthesis protein algK;Flags:
  309::461     8e-06  30%  510 aa  K0141_MOUSE RecName: Full=Uncharacterized protein KIAA0141;
   18::165     1e-05  26%  229 aa  YJCO_SHIFL RecName: Full=Uncharacterized protein yjcO;Flags:
   18::165     1e-05  26%  229 aa  YJCO_ECOLI RecName: Full=Uncharacterized protein yjcO;Flags:
   18::165     1e-05  26%  229 aa  YJCO_ECO57 RecName: Full=Uncharacterized protein yjcO;Flags:
   43::133     1e-05  34%  366 aa  SETD7_XENTR RecName: Full=Histone-lysine N-methyltransferase SETD7;
  290::392     1e-05  33%  470 aa  ALGK_PSESM RecName: Full=Alginate biosynthesis protein algK;Flags:
  130::209     2e-05  34%  231 aa  CA163_HUMAN RecName: Full=Hcp beta-lactamase-like protein C1orf163;
   43::207     2e-05  28%  366 aa  SETD7_MOUSE RecName: Full=Histone-lysine N-methyltransferase SETD7;
    3::180     3e-05  29%  206 aa  YRRB_BACSU RecName: Full=TPR repeat-containing protein yrrB;
   43::133     3e-05  33%  366 aa  SETD7_HUMAN RecName: Full=Histone-lysine N-methyltransferase SETD7;
  130::209     3e-05  34%  231 aa  CA163_MOUSE RecName: Full=Hcp beta-lactamase-like protein C1orf163
  136::207     5e-05  34%  229 aa  CA163_DANRE RecName: Full=Hcp beta-lactamase-like protein C1orf163
  119::220     6e-05  31%  379 aa  FB76_ARATH RecName: Full=F-box protein At1g67340;
  322::434     8e-05  31%  456 aa  CHR1_SCHPO RecName: Full=Chitin synthase regulatory factor
  332::428     2e-04  34%  512 aa  CHR2_SCHPO RecName: Full=Chitin synthase regulatory factor
  662::809     2e-04  26% 1132 aa  K0746_HUMAN RecName: Full=SEL1-like repeat-containing protein
  425::556     2e-04  28%  633 aa  CHR4_SCHPO RecName: Full=Chitin synthase regulatory factor
  267::583     5e-04  20%  784 aa  RPTN_HUMAN RecName: Full=Repetin;
  216::264     7e-04  35%  516 aa  YR850_MIMIV RecName: Full=Putative sel1-like repeat-containing
  532::625     7e-04  26%  664 aa  YE1A_SCHPO RecName: Full=Uncharacterized Sel1-like
   72::201     7e-04  28%  267 aa  EXOR_RHILV RecName: Full=Exopolysaccharide production negative
   63::117     0.001  36%  373 aa  SETD7_DANRE RecName: Full=Histone-lysine N-methyltransferase SETD7;
    1::722

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YBEQ_ECOLI      ----------------------------------------------------------------------
YL018_MIMIV     ----------------------------------------------------------------------
SE1L1_RAT       ----------------------------------------------------------------------
SE1L1_MOUSE     ----------------------------------------------------------------------
SE1L1_MESAU     ----------------------------------------------------------------------
SE1L1_HUMAN     ----------------------------------------------------------------------
FB84_ARATH      ----------------------------------------------------------------------
YBET_ECOLI      ----------------------------------------------------------------------
Y1327_NEIMB     ----------------------------------------------------------------------
HCPA_HELPJ      ----------------------------------------------------------------------
YL021_MIMIV     ----------------------------------------------------------------------
HCPE_HELPJ      ----------------------------------------------------------------------
HCPC_HELPY      ----------------------------------------------------------------------
HCPC_HELPJ      ----------------------------------------------------------------------
HCPA_HELPY      ----------------------------------------------------------------------
HCPE_HELPY      ----------------------------------------------------------------------
SKT5_YEAST      ----------------------------------------------------------------------
PODJ_CAUCR      ----------------------------------------------------------------------
PODJ_CAUCN      ----------------------------------------------------------------------
HCPD_HELPJ      ----------------------------------------------------------------------
HCPD_HELPY      ----------------------------------------------------------------------
K0746_MOUSE     ----------------------------------------------------------------------
YWQK_BACSU      ----------------------------------------------------------------------
YR815_MIMIV     ----------------------------------------------------------------------
CHR3_SCHPO      ----------------------------------------------------------------------
SE1L2_RAT       ----------------------------------------------------------------------
SE1L2_MOUSE     ----------------------------------------------------------------------
MOTX_VIBPA      ----------------------------------------------------------------------
SE1L2_HUMAN     ----------------------------------------------------------------------
LR2BP_RAT       ----------------------------------------------------------------------
HCPB_HELPY      ----------------------------------------------------------------------
K0141_RAT       ----------------------------------------------------------------------
EXOR_RHIME      ----------------------------------------------------------------------
Y1625_HAEIN     ----------------------------------------------------------------------
LR2BP_XENLA     ----------------------------------------------------------------------
K0141_HUMAN     ----------------------------------------------------------------------
ALGK_PSEAE      ----------------------------------------------------------------------
LR2BP_HUMAN     ----------------------------------------------------------------------
LR2BP_MACFA     ----------------------------------------------------------------------
LR2BP_DANRE     ----------------------------------------------------------------------
HRD3_CANGA      ----------------------------------------------------------------------
LR2BP_MOUSE     ----------------------------------------------------------------------
ALGK_PSEPK      ----------------------------------------------------------------------
K0141_MOUSE     ----------------------------------------------------------------------
YJCO_SHIFL      ----------------------------------------------------------------------
YJCO_ECOLI      ----------------------------------------------------------------------
YJCO_ECO57      ----------------------------------------------------------------------
SETD7_XENTR     ----------------------------------------------------------------------
ALGK_PSESM      ----------------------------------------------------------------------
CA163_HUMAN     ----------------------------------------------------------------------
SETD7_MOUSE     ----------------------------------------------------------------------
YRRB_BACSU      ----------------------------------------------------------------------
SETD7_HUMAN     ----------------------------------------------------------------------
CA163_MOUSE     ----------------------------------------------------------------------
CA163_DANRE     ----------------------------------------------------------------------
FB76_ARATH      ----------------------------------------------------------------------
CHR1_SCHPO      ----------------------------------------------------------------------
CHR2_SCHPO      ----------------------------------------------------------------------
K0746_HUMAN     ----------------------------------------------------------------------
CHR4_SCHPO      ----------------------------------------------------------------------
RPTN_HUMAN      ----------------------------------------------------------------------
YR850_MIMIV     ----------------------------------------------------------------------
YE1A_SCHPO      ----------------------------------------------------------------------
EXOR_RHILV      ----------------------------------------------------------------------
SETD7_DANRE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YBEQ_ECOLI      ----------------------------------------------------------------------
YL018_MIMIV     ----------------------------------------------------------------------
SE1L1_RAT       ----------------------------------------------------------------------
SE1L1_MOUSE     ----------------------------------------------------------------------
SE1L1_MESAU     ----------------------------------------------------------------------
SE1L1_HUMAN     ----------------------------------------------------------------------
FB84_ARATH      ----------------------------------------------------------------------
YBET_ECOLI      ----------------------------------------------------------------------
Y1327_NEIMB     ----------------------------------------------------------------------
HCPA_HELPJ      ----------------------------------------------------------------------
YL021_MIMIV     ----------------------------------------------------------------------
HCPE_HELPJ      ----------------------------------------------------------------------
HCPC_HELPY      ----------------------------------------------------------------------
HCPC_HELPJ      ----------------------------------------------------------------------
HCPA_HELPY      ----------------------------------------------------------------------
HCPE_HELPY      ----------------------------------------------------------------------
SKT5_YEAST      ----------------------------------------------------------------------
PODJ_CAUCR      ----------------------------------------------------------------------
PODJ_CAUCN      ----------------------------------------------------------------------
HCPD_HELPJ      ----------------------------------------------------------------------
HCPD_HELPY      ----------------------------------------------------------------------
K0746_MOUSE     ----------------------------------------------------------------------
YWQK_BACSU      ----------------------------------------------------------------------
YR815_MIMIV     ----------------------------------------------------------------------
CHR3_SCHPO      ----------------------------------------------------------------------
SE1L2_RAT       ----------------------------------------------------------------------
SE1L2_MOUSE     ----------------------------------------------------------------------
MOTX_VIBPA      ----------------------------------------------------------------------
SE1L2_HUMAN     ----------------------------------------------------------------------
LR2BP_RAT       ----------------------------------------------------------------------
HCPB_HELPY      ----------------------------------------------------------------------
K0141_RAT       ----------------------------------------------------------------------
EXOR_RHIME      ----------------------------------------------------------------------
Y1625_HAEIN     ----------------------------------------------------------------------
LR2BP_XENLA     ----------------------------------------------------------------------
K0141_HUMAN     ----------------------------------------------------------------------
ALGK_PSEAE      ----------------------------------------------------------------------
LR2BP_HUMAN     ----------------------------------------------------------------------
LR2BP_MACFA     ----------------------------------------------------------------------
LR2BP_DANRE     ----------------------------------------------------------------------
HRD3_CANGA      ----------------------------------------------------------------------
LR2BP_MOUSE     ----------------------------------------------------------------------
ALGK_PSEPK      ----------------------------------------------------------------------
K0141_MOUSE     ----------------------------------------------------------------------
YJCO_SHIFL      ----------------------------------------------------------------------
YJCO_ECOLI      ----------------------------------------------------------------------
YJCO_ECO57      ----------------------------------------------------------------------
SETD7_XENTR     ----------------------------------------------------------------------
ALGK_PSESM      ----------------------------------------------------------------------
CA163_HUMAN     ----------------------------------------------------------------------
SETD7_MOUSE     ----------------------------------------------------------------------
YRRB_BACSU      ----------------------------------------------------------------------
SETD7_HUMAN     ----------------------------------------------------------------------
CA163_MOUSE     ----------------------------------------------------------------------
CA163_DANRE     ----------------------------------------------------------------------
FB76_ARATH      ----------------------------------------------------------------------
CHR1_SCHPO      ----------------------------------------------------------------------
CHR2_SCHPO      ----------------------------------------------------------------------
K0746_HUMAN     ----------------------------------------------------------------------
CHR4_SCHPO      ----------------------------------------------------------------------
RPTN_HUMAN      ----------------------------------------------------------------------
YR850_MIMIV     ----------------------------------------------------------------------
YE1A_SCHPO      ----------------------------------------------------------------------
EXOR_RHILV      ----------------------------------------------------------------------
SETD7_DANRE     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTGWYLESSEETGEVMQSKQIAFEGYTNEENFANRQRVS
YBEQ_ECOLI      ----------------------------------------------------------------------
YL018_MIMIV     ----------------------------------------------------------------------
SE1L1_RAT       ----------------------------------------------------------------------
SE1L1_MOUSE     ----------------------------------------------------------------------
SE1L1_MESAU     ----------------------------------------------------------------------
SE1L1_HUMAN     ----------------------------------------------------------------------
FB84_ARATH      ----------------------------------------------------------------------
YBET_ECOLI      ----------------------------------------------------------------------
Y1327_NEIMB     ----------------------------------------------------------------------
HCPA_HELPJ      ----------------------------------------------------------------------
YL021_MIMIV     ----------------------------------------------------------------------
HCPE_HELPJ      ----------------------------------------------------------------------
HCPC_HELPY      ----------------------------------------------------------------------
HCPC_HELPJ      ----------------------------------------------------------------------
HCPA_HELPY      ----------------------------------------------------------------------
HCPE_HELPY      ----------------------------------------------------------------------
SKT5_YEAST      ----------------------------------------------------------------------
PODJ_CAUCR      ----------------------------------------------------------------------
PODJ_CAUCN      ----------------------------------------------------------------------
HCPD_HELPJ      ----------------------------------------------------------------------
HCPD_HELPY      ----------------------------------------------------------------------
K0746_MOUSE     ----------------------------------------------------------------------
YWQK_BACSU      ----------------------------------------------------------------------
YR815_MIMIV     ----------------------------------------------------------------------
CHR3_SCHPO      ----------------------------------------------------------------------
SE1L2_RAT       ----------------------------------------------------------------------
SE1L2_MOUSE     ----------------------------------------------------------------------
MOTX_VIBPA      ----------------------------------------------------------------------
SE1L2_HUMAN     ----------------------------------------------------------------------
LR2BP_RAT       ----------------------------------------------------------------------
HCPB_HELPY      ----------------------------------------------------------------------
K0141_RAT       ----------------------------------------------------------------------
EXOR_RHIME      ----------------------------------------------------------------------
Y1625_HAEIN     ----------------------------------------------------------------------
LR2BP_XENLA     ----------------------------------------------------------------------
K0141_HUMAN     ----------------------------------------------------------------------
ALGK_PSEAE      ----------------------------------------------------------------------
LR2BP_HUMAN     ----------------------------------------------------------------------
LR2BP_MACFA     ----------------------------------------------------------------------
LR2BP_DANRE     ----------------------------------------------------------------------
HRD3_CANGA      ----------------------------------------------------------------------
LR2BP_MOUSE     ----------------------------------------------------------------------
ALGK_PSEPK      ----------------------------------------------------------------------
K0141_MOUSE     ----------------------------------------------------------------------
YJCO_SHIFL      ----------------------------------------------------------------------
YJCO_ECOLI      ----------------------------------------------------------------------
YJCO_ECO57      ----------------------------------------------------------------------
SETD7_XENTR     ----------------------------------------------------------------------
ALGK_PSESM      ----------------------------------------------------------------------
CA163_HUMAN     ----------------------------------------------------------------------
SETD7_MOUSE     ----------------------------------------------------------------------
YRRB_BACSU      ----------------------------------------------------------------------
SETD7_HUMAN     ----------------------------------------------------------------------
CA163_MOUSE     ----------------------------------------------------------------------
CA163_DANRE     ----------------------------------------------------------------------
FB76_ARATH      ----------------------------------------------------------------------
CHR1_SCHPO      ----------------------------------------------------------------------
CHR2_SCHPO      ----------------------------------------------------------------------
K0746_HUMAN     ----------------------------------------------------------------------
CHR4_SCHPO      ----------------------------------------------------------------------
RPTN_HUMAN      --------------------------------SGSYCGQSERLGQELGCGQTDRQGQSSHYGQTDRQDQS
YR850_MIMIV     ----------------------------------------------------------------------
YE1A_SCHPO      ----------------------------------------------------------------------
EXOR_RHILV      ----------------------------------------------------------------------
SETD7_DANRE     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VFKSFYESGNLKSIYHYNAQNKRDGKAETYFDEKDKIAETLTFKDGQPEGEYIVYHENGAVESKRYFAQG
YBEQ_ECOLI      ----------------------------------------------------------------------
YL018_MIMIV     ----------------------------------------------------------------------
SE1L1_RAT       ----------------------------------------------------------------------
SE1L1_MOUSE     ----------------------------------------------------------------------
SE1L1_MESAU     ----------------------------------------------------------------------
SE1L1_HUMAN     ----------------------------------------------------------------------
FB84_ARATH      ----------------------------------------------------------------------
YBET_ECOLI      ----------------------------------------------------------------------
Y1327_NEIMB     ----------------------------------------------------------------------
HCPA_HELPJ      ----------------------------------------------------------------------
YL021_MIMIV     ----------------------------------------------------------------------
HCPE_HELPJ      ----------------------------------------------------------------------
HCPC_HELPY      ----------------------------------------------------------------------
HCPC_HELPJ      ----------------------------------------------------------------------
HCPA_HELPY      ----------------------------------------------------------------------
HCPE_HELPY      ----------------------------------------------------------------------
SKT5_YEAST      ----------------------------------------------------------------------
PODJ_CAUCR      ----------------------------------------------------------------------
PODJ_CAUCN      ----------------------------------------------------------------------
HCPD_HELPJ      ----------------------------------------------------------------------
HCPD_HELPY      ----------------------------------------------------------------------
K0746_MOUSE     ----------------------------------------------------------------------
YWQK_BACSU      ----------------------------------------------------------------------
YR815_MIMIV     ----------------------------------------------------------------------
CHR3_SCHPO      ----------------------------------------------------------------------
SE1L2_RAT       ----------------------------------------------------------------------
SE1L2_MOUSE     ----------------------------------------------------------------------
MOTX_VIBPA      ----------------------------------------------------------------------
SE1L2_HUMAN     ----------------------------------------------------------------------
LR2BP_RAT       ----------------------------------------------------------------------
HCPB_HELPY      ----------------------------------------------------------------------
K0141_RAT       ----------------------------------------------------------------------
EXOR_RHIME      ----------------------------------------------------------------------
Y1625_HAEIN     ----------------------------------------------------------------------
LR2BP_XENLA     ----------------------------------------------------------------------
K0141_HUMAN     ----------------------------------------------------------------------
ALGK_PSEAE      ----------------------------------------------------------------------
LR2BP_HUMAN     ----------------------------------------------------------------------
LR2BP_MACFA     ----------------------------------------------------------------------
LR2BP_DANRE     ----------------------------------------------------------------------
HRD3_CANGA      ----------------------------------------------------------------------
LR2BP_MOUSE     ----------------------------------------------------------------------
ALGK_PSEPK      ----------------------------------------------------------------------
K0141_MOUSE     ----------------------------------------------------------------------
YJCO_SHIFL      ----------------------------------------------------------------------
YJCO_ECOLI      ----------------------------------------------------------------------
YJCO_ECO57      ----------------------------------------------------------------------
SETD7_XENTR     ----------------------------------------------------------------------
ALGK_PSESM      ----------------------------------------------------------------------
CA163_HUMAN     ----------------------------------------------------------------------
SETD7_MOUSE     ----------------------------------------------------------------------
YRRB_BACSU      ----------------------------------------------------------------------
SETD7_HUMAN     ----------------------------------------------------------------------
CA163_MOUSE     ----------------------------------------------------------------------
CA163_DANRE     ----------------------------------------------------------------------
FB76_ARATH      ----------------------------------------------------------------------
CHR1_SCHPO      ----------------------------------------------------------------------
CHR2_SCHPO      ----------------------------------------------------------------------
K0746_HUMAN     ----------------------------------------------------------------------
CHR4_SCHPO      ----------------------------------------------------------------------
RPTN_HUMAN      --------------YHYG-QTDRQGQS-SHYSQTDRQGQSSHYSQPDRQGQSSHY---GQMDRK------
YR850_MIMIV     ----------------------------------------------------------------------
YE1A_SCHPO      ----------------------------------------------------------------------
EXOR_RHILV      ----------------------------------------------------------------------
SETD7_DANRE     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KIKDGECPHFYDNGVLKQKHSYLNQKLEGPAFEYFPDXXXXXXXXXXXXTIVGTSTEYYSTGKIRGVYHR
YBEQ_ECOLI      ----------------------------------------------------------------------
YL018_MIMIV     ----------------------------------------------------------------------
SE1L1_RAT       ----------------------------------------------------------------------
SE1L1_MOUSE     ----------------------------------------------------------------------
SE1L1_MESAU     ----------------------------------------------------------------------
SE1L1_HUMAN     ----------------------------------------------------------------------
FB84_ARATH      ----------------------------------------------------------------------
YBET_ECOLI      ----------------------------------------------------------------------
Y1327_NEIMB     ----------------------------------------------------------------------
HCPA_HELPJ      ----------------------------------------------------------------------
YL021_MIMIV     ----------------------------------------------------------------------
HCPE_HELPJ      ----------------------------------------------------------------------
HCPC_HELPY      ----------------------------------------------------------------------
HCPC_HELPJ      ----------------------------------------------------------------------
HCPA_HELPY      ----------------------------------------------------------------------
HCPE_HELPY      ----------------------------------------------------------------------
SKT5_YEAST      ----------------------------------------------------------------------
PODJ_CAUCR      ----------------------------------------------------------------------
PODJ_CAUCN      ----------------------------------------------------------------------
HCPD_HELPJ      ----------------------------------------------------------------------
HCPD_HELPY      ----------------------------------------------------------------------
K0746_MOUSE     ----------------------------------------------------------------------
YWQK_BACSU      ----------------------------------------------------------------------
YR815_MIMIV     ----------------------------------------------------------------------
CHR3_SCHPO      ----------------------------------------------------------------------
SE1L2_RAT       ----------------------------------------------------------------------
SE1L2_MOUSE     ----------------------------------------------------------------------
MOTX_VIBPA      ----------------------------------------------------------------------
SE1L2_HUMAN     ----------------------------------------------------------------------
LR2BP_RAT       ----------------------------------------------------------------------
HCPB_HELPY      ----------------------------------------------------------------------
K0141_RAT       ----------------------------------------------------------------------
EXOR_RHIME      ----------------------------------------------------------------------
Y1625_HAEIN     ----------------------------------------------------------------------
LR2BP_XENLA     ----------------------------------------------------------------------
K0141_HUMAN     ----------------------------------------------------------------------
ALGK_PSEAE      ----------------------------------------------------------------------
LR2BP_HUMAN     ----------------------------------------------------------------------
LR2BP_MACFA     ----------------------------------------------------------------------
LR2BP_DANRE     ----------------------------------------------------------------------
HRD3_CANGA      ----------------------------------------------------------------------
LR2BP_MOUSE     ----------------------------------------------------------------------
ALGK_PSEPK      ----------------------------------------------------------------------
K0141_MOUSE     ----------------------------------------------------------------------
YJCO_SHIFL      ----------------------------------------------------------------------
YJCO_ECOLI      ----------------------------------------------------------------------
YJCO_ECO57      ----------------------------------------------------------------------
SETD7_XENTR     ----------------------------------------------------------------------
ALGK_PSESM      ----------------------------------------------------------------------
CA163_HUMAN     ----------------------------------------------------------------------
SETD7_MOUSE     ----------------------------------------------------------------------
YRRB_BACSU      ----------------------------------------------------------------------
SETD7_HUMAN     ----------------------------------------------------------------------
CA163_MOUSE     ----------------------------------------------------------------------
CA163_DANRE     ----------------------------------------------------------------------
FB76_ARATH      ----------------------------------------------------------------------
CHR1_SCHPO      ----------------------------------------------------------------------
CHR2_SCHPO      ----------------------------------------------------------------------
K0746_HUMAN     ----------------------------------------------------------------------
CHR4_SCHPO      ----------------------------------------------------------------------
RPTN_HUMAN      ----GQCYHYDQTNRQGQGSHYSQPNRQGQSSHYGPDTQDQ-------------SSHYGQTDRQDQSSHY
YR850_MIMIV     ----------------------------------------------------------------------
YE1A_SCHPO      ----------------------------------------------------------------------
EXOR_RHILV      ----------------------------------------------------------------------
SETD7_DANRE     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NNQGENDGTFEQYSEEGKLLSKATYKNGKQLSAQSWYENGHPKEESSFDSEGRKHGAVKEWFSNGKPASS
YBEQ_ECOLI      ----------------------------------------------------------------------
YL018_MIMIV     ----------------------------------------------------------------------
SE1L1_RAT       ----------------------------------------------------------------------
SE1L1_MOUSE     ----------------------------------------------------------------------
SE1L1_MESAU     ----------------------------------------------------------------------
SE1L1_HUMAN     ----------------------------------------------------------------------
FB84_ARATH      ----------------------------------------------------------------------
YBET_ECOLI      ----------------------------------------------------------------------
Y1327_NEIMB     ----------------------------------------------------------------------
HCPA_HELPJ      ----------------------------------------------------------------------
YL021_MIMIV     ----------------------------------------------------------------------
HCPE_HELPJ      ----------------------------------------------------------------------
HCPC_HELPY      ----------------------------------------------------------------------
HCPC_HELPJ      ----------------------------------------------------------------------
HCPA_HELPY      ----------------------------------------------------------------------
HCPE_HELPY      ----------------------------------------------------------------------
SKT5_YEAST      ----------------------------------------------------------------------
PODJ_CAUCR      ----------------------------------------------------------------------
PODJ_CAUCN      ----------------------------------------------------------------------
HCPD_HELPJ      ----------------------------------------------------------------------
HCPD_HELPY      ----------------------------------------------------------------------
K0746_MOUSE     ----------------------------------------------------------------------
YWQK_BACSU      ---------FSSVSDE--ILDNPEDENGQPFTGLAYYPNGQIIYFTKYKN-GLAHGLTCEFYENGNKKSE
YR815_MIMIV     ----------------------------------------------------------------------
CHR3_SCHPO      ----------------------------------------------------------------------
SE1L2_RAT       ----------------------------------------------------------------------
SE1L2_MOUSE     ----------------------------------------------------------------------
MOTX_VIBPA      ----------------------------------------------------------------------
SE1L2_HUMAN     ----------------------------------------------------------------------
LR2BP_RAT       ----------------------------------------------------------------------
HCPB_HELPY      ----------------------------------------------------------------------
K0141_RAT       ----------------------------------------------------------------------
EXOR_RHIME      ----------------------------------------------------------------------
Y1625_HAEIN     ----------------------------------------------------------------------
LR2BP_XENLA     ----------------------------------------------------------------------
K0141_HUMAN     ----------------------------------------------------------------------
ALGK_PSEAE      ----------------------------------------------------------------------
LR2BP_HUMAN     ----------------------------------------------------------------------
LR2BP_MACFA     ----------------------------------------------------------------------
LR2BP_DANRE     ----------------------------------------------------------------------
HRD3_CANGA      ----------------------------------------------------------------------
LR2BP_MOUSE     ----------------------------------------------------------------------
ALGK_PSEPK      ----------------------------------------------------------------------
K0141_MOUSE     ----------------------------------------------------------------------
YJCO_SHIFL      ----------------------------------------------------------------------
YJCO_ECOLI      ----------------------------------------------------------------------
YJCO_ECO57      ----------------------------------------------------------------------
SETD7_XENTR     ---------------------------------------------------GEKNGRGKFYFFDGSTLEG
ALGK_PSESM      ----------------------------------------------------------------------
CA163_HUMAN     ----------------------------------------------------------------------
SETD7_MOUSE     ---------------------------------------------------GEKNGRGKFFFFDGSTLEG
YRRB_BACSU      ----------------------------------------------------------------------
SETD7_HUMAN     ---------------------------------------------------GEKNGRGKFFFFDGSTLEG
CA163_MOUSE     ----------------------------------------------------------------------
CA163_DANRE     ----------------------------------------------------------------------
FB76_ARATH      ----------------------------------------------------------------------
CHR1_SCHPO      ----------------------------------------------------------------------
CHR2_SCHPO      ----------------------------------------------------------------------
K0746_HUMAN     ----------------------------------------------------------------------
CHR4_SCHPO      ----------------------------------------------------------------------
RPTN_HUMAN      G-QTERQGQSSHYSQMDRQGQGSHYGQTDRQGQSSHYGQPDRQGQNSHYGQTDRQGQSSHYGQTDRQGQS
YR850_MIMIV     ----------------------------------------------------------------------
YE1A_SCHPO      ----------------------------------------------------------------------
EXOR_RHILV      ----------------------------------------------------------------------
SETD7_DANRE     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KMYKHDVLDGDFEKWYENGHRESVYPYKNGMLNGDAKHWNEQGKLTYTTEYKDDKKQGADRRWSERTGKL
YBEQ_ECOLI      ----------------------------------------------------------------------
YL018_MIMIV     ----------------------------------------------------------------------
SE1L1_RAT       ----------------------------------------------------------------------
SE1L1_MOUSE     ----------------------------------------------------------------------
SE1L1_MESAU     ----------------------------------------------------------------------
SE1L1_HUMAN     ----------------------------------------------------------------------
FB84_ARATH      ----------------------------------------------------------------------
YBET_ECOLI      ----------------------------------------------------------------------
Y1327_NEIMB     ----------------------------------------------------------------------
HCPA_HELPJ      ----------------------------------------------------------------------
YL021_MIMIV     ----------------------------------------------------------------------
HCPE_HELPJ      ----------------------------------------------------------------------
HCPC_HELPY      ----------------------------------------------------------------------
HCPC_HELPJ      ----------------------------------------------------------------------
HCPA_HELPY      ----------------------------------------------------------------------
HCPE_HELPY      ----------------------------------------------------------------------
SKT5_YEAST      ----------------------------------------------------------------------
PODJ_CAUCR      ----------------------------------------------------------------------
PODJ_CAUCN      ----------------------------------------------------------------------
HCPD_HELPJ      ----------------------------------------------------------------------
HCPD_HELPY      ----------------------------------------------------------------------
K0746_MOUSE     ----------------------------------------------------------------------
YWQK_BACSU      KEYRYGQLHGISIIWFENGRKKSEQQYEHSILISE-KNWDEEGNLLNKYEIDTD----------------
YR815_MIMIV     ----------------------------------------------------------------------
CHR3_SCHPO      ----------------------------------------------------------------------
SE1L2_RAT       ----------------------------------------------------------------------
SE1L2_MOUSE     ----------------------------------------------------------------------
MOTX_VIBPA      ----------------------------------------------------------------------
SE1L2_HUMAN     ----------------------------------------------------------------------
LR2BP_RAT       ----------------------------------------------------------------------
HCPB_HELPY      ----------------------------------------------------------------------
K0141_RAT       ----------------------------------------------------------------------
EXOR_RHIME      ----------------------------------------------------------------------
Y1625_HAEIN     ----------------------------------------------------------------------
LR2BP_XENLA     ----------------------------------------------------------------------
K0141_HUMAN     ----------------------------------------------------------------------
ALGK_PSEAE      ----------------------------------------------------------------------
LR2BP_HUMAN     ----------------------------------------------------------------------
LR2BP_MACFA     ----------------------------------------------------------------------
LR2BP_DANRE     ----------------------------------------------------------------------
HRD3_CANGA      ----------------------------------------------------------------------
LR2BP_MOUSE     ----------------------------------------------------------------------
ALGK_PSEPK      ----------------------------------------------------------------------
K0141_MOUSE     ----------------------------------------------------------------------
YJCO_SHIFL      ----------------------------------------------------------------------
YJCO_ECOLI      ----------------------------------------------------------------------
YJCO_ECO57      ----------------------------------------------------------------------
SETD7_XENTR     -FYVDDALQGQGIYTYEDGG--SLHTYVEGELNGPAQEYDTDGRLIFKGQYKDNVRHGVCWIYYPDGGSL
ALGK_PSESM      ----------------------------------------------------------------------
CA163_HUMAN     ----------------------------------------------------------------------
SETD7_MOUSE     -YYVDDALQGQGVYTYEDGGVLQG-TYVDGELNGPAQEYDSDGRLIFKGQYKDNNRHGVCWIHYPDGGSL
YRRB_BACSU      ----------------------------------------------------------------------
SETD7_HUMAN     -YYVDDALQGQGVYTYEDGGVLQG-TYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSL
CA163_MOUSE     ----------------------------------------------------------------------
CA163_DANRE     ----------------------------------------------------------------------
FB76_ARATH      ----------------------------------------------------------------------
CHR1_SCHPO      ----------------------------------------------------------------------
CHR2_SCHPO      ----------------------------------------------------------------------
K0746_HUMAN     ----------------------------------------------------------------------
CHR4_SCHPO      ----------------------------------------------------------------------
RPTN_HUMAN      SHYSQPDKQGQSSHYGKIDRQDQSYHYGQPDGQGQSSHYGQTDRQGQSFHYGQPDRQGQSSHYSQ-MDRQ
YR850_MIMIV     ----------------------------------------------------------------------
YE1A_SCHPO      ----------------------------------------------------------------------
EXOR_RHILV      ----------------------------------------------------------------------
SETD7_DANRE     --YVDDALQGQGVYTYEDGGALHGF-YVDGELNGPAQEFNSDGQLVFRGRYKDNIRYG------------


                         *         .         .         .         .         +         .:560
query           VEEVMFANDERNGLKREFNDRTGKVLSALPYVDGDKEGTEEAYDEDGIKYIRCYHNDEELSELYAPTDVT
YBEQ_ECOLI      --------------------------------------------ESGMSYAQMYRNGNGVAKDYALAFFW
YL018_MIMIV     ----------------------------------------------------------------------
SE1L1_RAT       ----------------------------------------------------------------------
SE1L1_MOUSE     ----------------------------------------------------------------------
SE1L1_MESAU     ----------------------------------------------------------------------
SE1L1_HUMAN     ----------------------------------------------------------------------
FB84_ARATH      ----------------------------------------------------------------------
YBET_ECOLI      ----------------------------------------------------------------------
Y1327_NEIMB     ----------------------------------------------------------------------
HCPA_HELPJ      ----------------------------------------------------------------------
YL021_MIMIV     ---------------------------------------------------------------------T
HCPE_HELPJ      ----------------------------------------------------------------------
HCPC_HELPY      ----------------------------------------------------------------------
HCPC_HELPJ      ----------------------------------------------------------------------
HCPA_HELPY      ----------------------------------------------------------------------
HCPE_HELPY      ----------------------------------------------------------------------
SKT5_YEAST      ----------------------------------------------------------------------
PODJ_CAUCR      ----------------------------------------------------------------------
PODJ_CAUCN      ----------------------------------------------------------------------
HCPD_HELPJ      ----------------------------------------------------------------------
HCPD_HELPY      ----------------------------------------------------------------------
K0746_MOUSE     --------------------------------------------------------DDEILKVQTKEDLK
YWQK_BACSU      ----------------------------------------------------------------------
YR815_MIMIV     ----------------------------------------------------------------------
CHR3_SCHPO      ----------------------------------------------------------------------
SE1L2_RAT       ----------------------------------------------------------------------
SE1L2_MOUSE     ----------------------------------------------------------------------
MOTX_VIBPA      ----------------------------------------------------------------------
SE1L2_HUMAN     ----------------------------------------------------------------------
LR2BP_RAT       ----------------------------------------------------------------------
HCPB_HELPY      ----------------------------------------------------------------------
K0141_RAT       ----------------------------------------------------------------------
EXOR_RHIME      ----------------------------------------------------------------------
Y1625_HAEIN     ----------------------------------------------------------------------
LR2BP_XENLA     ----------------------------------------------------------------AETFLK
K0141_HUMAN     ----------------------------------------------------------------------
ALGK_PSEAE      ----------------------------------------------------------------------
LR2BP_HUMAN     ----------------------------------------------------------------------
LR2BP_MACFA     ----------------------------------------------------------------------
LR2BP_DANRE     ----------------------------------------------------------------------
HRD3_CANGA      ----------------------------------------------------------------------
LR2BP_MOUSE     ----------------------------------------------------------------------
ALGK_PSEPK      ----------------------------------------------------------------------
K0141_MOUSE     ----------------------------------------------------------------------
YJCO_SHIFL      -------------------------------------------------------NDSEPGSQYLKA---
YJCO_ECOLI      -------------------------------------------------------NDSEPGSQYLKA---
YJCO_ECO57      -------------------------------------------------------NDSEPGSQYLKA---
SETD7_XENTR     VGEV------------------------------------------------------------------
ALGK_PSESM      ----------------------------------------------------------------------
CA163_HUMAN     ----------------------------------------------------------------------
SETD7_MOUSE     VGEV-----------NEDGEMTGEKIA---YVYPDQRTALYG------KFIDGEMLEGKLATLMATEEGR
YRRB_BACSU      --------------------------------EGDYEKAAEAFTEDAIPYINFANLLSSVNELERALAFY
SETD7_HUMAN     VGEV------------------------------------------------------------------
CA163_MOUSE     ----------------------------------------------------------------------
CA163_DANRE     ----------------------------------------------------------------------
FB76_ARATH      ----------------------------------------------------------------------
CHR1_SCHPO      ----------------------------------------------------------------------
CHR2_SCHPO      ----------------------------------------------------------------------
K0746_HUMAN     --------------------------------------------------------DDEILKVQTKEDLK
CHR4_SCHPO      ----------------------------------------------------------------------
RPTN_HUMAN      GQSSHYGQTDRQGQSSHYTDRQGQ---SYHYGQTDRQGQSSHY---------------------------
YR850_MIMIV     ----------------------------------------------------------------------
YE1A_SCHPO      ----------------------------------------------------------------------
EXOR_RHILV      ----------------------------------------------------------------------
SETD7_DANRE     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           NKAKQGDSTAQYHLGKYEFECTNYDAAMKWLTQSAEQNHPGALLFLAYAYNDGDGVAQDSKKYLSYLFKA
YBEQ_ECOLI      YKALQGHSDAQNNLADLYEDAQNKTLAAFWYLKSAQQGNRHAQFQIAWDYNAGEGVDQDYKQAMYWYLKA
YL018_MIMIV     --AKTGDSMAQYNLGQMYYRGINIQKAIKWITKSADQNNKYGLINLARFYEYGDGVLLDIDKATQLLEQA
SE1L1_RAT       ----------------------NHQRAFDYFNLAANAGNSHAMAFLGKMYSEGDIVPQSNETALHYFKKA
SE1L1_MOUSE     ----------------------NHQRAFDYFNLAANAGNSHAMAFLGKMYSEGDIVPQSNETALHYFKKA
SE1L1_MESAU     ----------------------NHQRAFDYFNLAANAGNSHAMAFLGKMYSEGDIVPQSNETALHYFKKA
SE1L1_HUMAN     ----------------------NHQRAFDYFNLAANAGNSHAMAFLGKMYSEGDIVPQSNETALHYFKKA
FB84_ARATH      -----GDAVGQCNLGYLQVQPSNPKEAMKWLKQSAENGYVRAQYQLALCLHHGRVVQTNLLEATKWYLKA
YBET_ECOLI      --AIHGHSTSQYRLGEFYLHGSDYTQARYWYEQSAEQENPRAQSKLGWIYLKGLGVKPDTRKAILWYKEA
Y1327_NEIMB     ----------------------------------------------AQALHYGLQCAPEYAAALKLYTEA
HCPA_HELPJ      --------------------------ASQYYSKSCELNHAEGCTVLGSLHHYGVGTPKDLRKALDLYEKA
YL021_MIMIV     LSANQGLSFAQYNLGYYYYNKAKYEKSINYFQKSAQSGYYLSNFMLAETYLKLS-IPNFNEAIKNYLL-A
HCPE_HELPJ      -----------YEKGFLEVKQSNHKAVIYYL-KACRLNEGQACRALGSLFENGDGLDEDFEVAFDYLQKA
HCPC_HELPY      ----------------------NTNKALQYYSKACDLKYAEGCASLGGIYHDGKVVTRDFKKAVEYFTKA
HCPC_HELPJ      ----------------------NTNKALQYYSKACDLKYAEGCASLGGIYHDGKVVTRDFKKAVEYFTKA
HCPA_HELPY      --------------------------ASQYYSKACDLNHAEGCMVLGSLHHYGVGTPKDLRKALDLYEKA
HCPE_HELPY      -----------YEKGFLEVKQSNHKAVIYYL-KACRLDDGQACRALGSLFENGDGLDEDFEVAFDYLQKA
SKT5_YEAST      -----------YHEGFLDVVIPDEKYAMELYIQAASLGHVPSATLLAQIYETGDTVGQDTSLSVHYYTQA
PODJ_CAUCR      -------------------------SGVELLKRAANGGYPAAQFYLSKMYEGGNGVKVDMAEARRWSERA
PODJ_CAUCN      -------------------------SGVELLKRAANGGYPAAQFYLSKMYEGGNGVKVDMAEARRWSERA
HCPD_HELPJ      ----------------------NYAKALSFSKYACSLNYGISCNFVGYMYKSAKGVEKDLKKALANFKRG
HCPD_HELPY      ----------------------NYAKALFLSKYACSLNYGISCNFVGYMYRNAKGVQKDLKKALANFKRG
K0746_MOUSE     HEATRGNAAAQQRLAQMLFVAKNPEAAIEWYAKGALETEDPALIYYAIVLFKGQGVKKNRRLALELMKKA
YWQK_BACSU      ----------------------------------------------------------------------
YR815_MIMIV     ------------------------------------------LLFLGSLYERGYGVSCDKHMAFNLYEKA
CHR3_SCHPO      --------------------------------QSAVYGYAAAQCKLGECYEHGLGCLAEPRRSIFWYTRA
SE1L2_RAT       --------------------------------------------FIGKMYLEGNAAAQNNATAFKYFSMA
SE1L2_MOUSE     --------------------------------------------FIGKMYFEGNAAAQNNATAFKYFSMA
MOTX_VIBPA      ------------------------ELGLYYMENAAQQGLPAALEQIGRYYSRGTLVQQDKERAIPYLREA
SE1L2_HUMAN     --AERGDVQIQVSLGQLHLIGRDYYKALHYFLKXXXXXXXXXXXFIGKMYLEGNAVPQNNATAFKYFSMA
LR2BP_RAT       -RIRKGDAMAYFLRGQLYFEEGWYEEALAQFEEIQEKDHQ-AIYQLGVMYYDGLGTVADAEKGVGYMKKA
HCPB_HELPY      ----------------------NKQKLFQYLSKACELNSGNGCRFLGDFYENGKYVKKDLRKAAQYYSKA
K0141_RAT       --AVQGHSLAQYRYARCLLQSPGSQRAVSLLKQAADSGLTEAQAFLGVLFTKEPHL--DEQKAVKYFWLA
EXOR_RHIME      ---KESGPFALFKFGFSAYKSGRKDEAVEAYRYAAEKGHTGSRWALANMYAYGDGVAENDLEAFKIYSEI
Y1625_HAEIN     ------------------------------------------------------------------MYPM
LR2BP_XENLA     SRIKEGDVQANFLLGQLFFEEGWYEDALLQFEKVKDEDNQ-ALYQAGVMYYDGLGTQEDHRKGVKYMFEG
K0141_HUMAN     --ASQGHSLAQYRYAR----CLLRDPASSWLKQAADSGLREAQAFLGVLFTKEPYL--DEQRAVKYLWLA
ALGK_PSEAE      ------------------------------LLEEIAPSYPAAWVSLAYDYPDQG----DLEKMLGYLKNA
LR2BP_HUMAN     ---KEKDHQATYQLGVYDGLGTTLDAEMKKILDSARHLKFAAAYNLGRAYYEGKGVKRSNEEAERLWLIA
LR2BP_MACFA     ---------------------------------------------LGRAYYEGKGVKRSNEEAERLWLFA
LR2BP_DANRE     -----------------------------WDSSEAGSVRYAALYNLGQAYLEGFGVQASSSEAERLWLLA
HRD3_CANGA      ---------------------------------------------LPYKFDDPPETTIERKTMISYYTRA
LR2BP_MOUSE     -RIRRGDAMAYFLRGQLYFEEGWYEEALAQFEEIQEKDHQ-AIYQLGVMYYDGLGTIANAEKGVNYMRKA
ALGK_PSEPK      ---------------------TDEKTAKELLEQVAPAN-PASWVSLAQLVYDFPELG-DTDQLMAYIDKG
K0141_MOUSE     --AVQGHSLAQYRYARCLLQSPGSERAVSLLKQAADSGLTEAQAFLGVLFTKEPHL--DEQRAVKYLWLA
YJCO_SHIFL      --AEAGDRRAQYFLADSWFSSGDLSKAEYWAQKAADSGDADACALLA-QIKITNPVSLDYPQAKVLAEKA
YJCO_ECOLI      --AEAGDRRAQYFLADSWFSSGDLSKAEYWAQKAADSGDADACALLA-QIKITNPVSLDYPQAKVLAEKA
YJCO_ECO57      --AEAGDRRAQYFLADSWFSSGDLSKAEYWAQKAADSGDADACALLA-QIKITNPVSLDYPQAKVLAEKA
SETD7_XENTR     ----------------------------------------------------------------------
ALGK_PSESM      ----------------------------------------------------------DVNKMMEYLNNG
CA163_HUMAN     ----------------------------------------------------------DLGKARDYYTRA
SETD7_MOUSE     PHFEVTSGSSVYHFDKSTSSCISSDALL------------------------------------------
YRRB_BACSU      DKALELDSTAYYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDLF--YMLGTVLVKLEQPKLALPYLQRA
SETD7_HUMAN     ----------------------------------------------------------------------
CA163_MOUSE     ----------------------------------------------------------DLGKARDYYSRA
CA163_DANRE     -----------------------------------------------------------------YFEKA
FB76_ARATH      -----GSLEACYTLGMIRFYCLNRGNGASLMAKAAISSHAPALYSLAVIQFNGSGGSKNDKDLVALCARA
CHR1_SCHPO      ---------------------------------AASLGHDRSSFLVGEAFFYGTYGARENKRALQYYHLA
CHR2_SCHPO      ----------------------------------ADHEFPQALYDLAELYEHGDGLLELSPRKAFVLYHA
K0746_HUMAN     HEATRGNAAAQQRLAQMLFVAKNPEAAIEWYAKGALETEDPALIYYAIVLFKGQGVKKNRRLALELMKKA
CHR4_SCHPO      --------------------------ALKSFAKAAFLGHSSAQLRMGAVYEFGKYGCPVVPRYLFYYSAA
RPTN_HUMAN      ----------------------------------------------------------------------
YR850_MIMIV     ----------------------------------------------------------------------
YE1A_SCHPO      -------------------------------------------VFRYFNYTQSEQEAAHDKFAYEFYSRA
EXOR_RHILV      ------------------------------------KGHTGSRWALANMYADGDGVTQDDFEAFKIYSEI
SETD7_DANRE     ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           AELGESDAQLEVGYLNLIGEGMPKNLPEAYKWIKKSADQGNAQAHYNLGLMYRNGDGVEKDLNKAKLHLT
YBEQ_ECOLI      AAQGSVGAYVNIGYMYKHGQGVEKDYQAAFEWFTKAAECNDATAWYNLAIMYHYGEGRPVDLRQA-----
YL018_MIMIV     SCQNFSKAQFYLGRIYMYKD--PPDYKLAFKYYXXXXXXXXXXXXYFIAVFYKTGKCVAQDYKKAVHWLT
SE1L1_RAT       ADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQGWVDGQLQLGSMYYNGIGVKRDYKQALKYFN
SE1L1_MOUSE     ADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQGWVDGQLQLGSMYYNGIGVKRDYKQALKYFN
SE1L1_MESAU     ADMGNPVGQSGLGMAYLYGRGIQVNYDLALKYFQKAAEQGWVDGQLQLGSMYYNGIGVKRDYKQALKYFN
SE1L1_HUMAN     ADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQGWVDGQLQLGSMYYNGIGVKRDYKQALKYFN
FB84_ARATH      AEGGYVRAMYNISLCYSVGEGLPQNRKLARKWMKRAADHGHSKAQFEHGL--------------------
YBET_ECOLI      AEQGYAHAQYTLGLIYRNGSGINVNHYESQKWLKLTAKQ-------------------------------
Y1327_NEIMB     AELGHSKAQTNLGSMYYFGQGMTADYNEARKWFEKAAAKKDSMAFYNLACIHYSGHGVEPDKEKACRYLQ
HCPA_HELPJ      CDLKDSPGCINAGYMY----GVAKNFKEAIVRYSKACELKDGRGCYNLGVMQYNAQGTAKDEKQAVENFK
YL021_MIMIV     ANQGCNISQYRLGMIYFEGKYVNTDMNQAYKWFKLSAKQGNYFSQYGLGRVYYSMDSTKYNCQKA-----
HCPE_HELPJ      CALNNSGGCASLGSMYMLGRYVKKDPQKAFNYFKQACDMGSAVSCSRMGFMYSQGDTVSKDLRKA-----
HCPC_HELPY      CDLNDGDGCTILGSLYDAGRGTPKDLKKALASYDKACDLKDSPGCFNAGNMYHHGEGATKNFKEA-----
HCPC_HELPJ      CDLNDGDGCTILGSLYDAGRGTPKDLKKALASYDKACDLKDSPGCFNAGNMYHHGEGAAKNFKEA-----
HCPA_HELPY      CDLKDSPGCINAGYIYSV----TKNFKEAIVRYSKACELKDGRGCYNLGVMQYNAQGTAKDEKQAVENFK
HCPE_HELPY      CGLNNSGGCASLGSMYMLGRYVKKDPQKAFNFFKQACDMGSAVSCSRMGFMYSQGDAVPKDLRKA-----
SKT5_YEAST      ALKGDSVAMLGLCAWYLLGAAFEKDENEAFQWALRAANAGLPKAQFTLGYFYEHGKGCDRNMEYA-----
PODJ_CAUCR      ANGGDPRAMHNLALYYFKGEGGPRNSTTAASWFRKAADMGLVDSQFNLAQLYESGLGVSQNPAEAYKWYV
PODJ_CAUCN      ANGGDPRAMHNLALYYFKGEGGPRNSTTAASWFRKAADMGLVDSQFNLAQLYESGLGVSQNPAEAYKWYV
HCPD_HELPJ      CHLKDGASCVSLGYLYEAGMDVKQNEEQALNLYKKGCSLKEGSGCHNVAVMYYTGKGAPKDLEKA-----
HCPD_HELPY      CHLKDGASCVSLGYMYEVGMDVKQNGEQALNLYKKGCYLKRGSGCHNVAVMYYTGKGVPKDLDKAISYYK
K0746_MOUSE     ASKGLHQAVNGLGWYY---HKFRKNYAKAAKYWLKAEEMGNPDASYNLGVLYLDGPGVPRNLTLAGEYFH
YWQK_BACSU      ----------------------------------------------------------------------
YR815_MIMIV     TKHNYPAVKRQLAFMYRTGSGTTKNINKSHELYREAANQGYPLAQYALALQCKYGHGCIKNYKEAETWLI
CHR3_SCHPO      AEQDYGEAELGLSGWYLTGEGLPKNGEEALLWAHKAACKGLAKAQYAVGFMMEQGIGVAADPSSAHNWYI
SE1L2_RAT       ASKGNAIXXXXXXXXXXXXXXVPVNYGEALKYFQKAAEKGWPNAQFHLGFMYYSGSGVWKDYKLAFKYFY
SE1L2_MOUSE     ASKGNAIXXXXXXXXXXXXXXVPVNYGEALKYFQKAAEKGWPNAQFQLGFMYYSGSGVWKDYKLAFKYFY
MOTX_VIBPA      ASMGNLNARIHLAELLLRDYGSPLDYEDAYRWLYNSVTADQRQ-HKRIAVLRR-----------------
SE1L2_HUMAN     ASKGNAIXXXXXXXXXXXXXXVPLNYAEALKYFQKAAEKGWPDAQFQLGFMYYSGSGIWKDYKLAFKYFY
LR2BP_RAT       YNLGRSDEEAERLWLYAADNGNPKDLEKAFFWHSEACGNGNLESQGALGLMYLYGQGIRQDTDAALHCLR
HCPB_HELPY      CGLNDQDGCLILGYKQYAGKGVVKNEKQAVKTFEKACRLGSEDA--------------------------
K0141_RAT       ASNGDSQSRFHLGICYEKGLGVQRNLGEAVKCYQKSAAMGNEPAQERLRTLF----NVEA---AGPSHLA
EXOR_RHIME      AQQGVEPGSEDTGYISLAGRGIPSDLSQARQYFQAASTFGVAEAQFQLARMLLSGEGGSVNVQQAKKWLN
Y1625_HAEIN     ALEGNITAQSNLGMLYNLGRGTVRDYEKAYWWFSEAAEKGSVKGLNNLGVMYLRGDYVKQNTEQA-----
LR2BP_XENLA     YGIPHSDKEAERWWLFAADNGNPKDLQKAFLWHSEACGNGSLESQGALGVMYLYGNGIKKNVQAAIECLK
K0141_HUMAN     ANNGDSQSRYHLGICYEKGLGVQRNLGEALRCYQQSAALGNEAAQERLRALFSMG---------------
ALGK_PSEAE      QDAAQPRAELLLGRLYYDGKWAPQDPRKAERHLLKAA-ASEPQANYYLGQIYRRGFLGKVYPQKAVDHLI
LR2BP_HUMAN     ADNGNPKASVKASMLGLYSTKEPKELEKAFYWHSEACGNGNLESQGALGLMYLYGQGIRQDTEAALQCLR
LR2BP_MACFA     ADNGNPKASVKASMLGLYSTKEPKELEKAFYWHSEACGNGNLESQGALGLMYLYGQGIRQD-TEAALHCE
LR2BP_DANRE     ADNGNPNASVKAQSALGMFYSRPESLDKAFFWHSQACGNGSLESQAALGLMYLYGHGVQRDSDSALFCLK
HRD3_CANGA      FKQGNTDAAVVAGDIYF----QMKNYTKALSLYQSAALKFSAQALWNIGYMYEHGLGVEKDFHLAK----
LR2BP_MOUSE     YNLGRSDEEAERLWLLAADNGNPKELEKAFFWHSEACGNGSLESQGALGLMYFYGQGIRQDTDAALHCLR
ALGK_PSEPK      REAEQPRAELLLGRLYYEGKTLPADAQKAEQHLQAAAEAGEISAHXXXXXXXXXXXXXNVEPQKAVDHLL
K0141_MOUSE     ASNGDSQSRFHLGICYEKGLGAQRNLGEAVKCYQQAAAMGNEPARERLRTLF----NVEA---AGPSHLT
YJCO_SHIFL      AQAGSKEGEVTLAHILVNTQAGKPDYPKAISLLENASEDSAVDAQMLLGLIYANGVGIKADDDKA-----
YJCO_ECOLI      AQAGSKEGEVTLAHILVNTQAGKPDYPKAISLLENASEDSAVDAQMLLGLIYANGVGIKADDDKA-----
YJCO_ECO57      AQAGSKEGEVTLAHILVNTQAGKPDYPKAISLLENASEDSAVDAQMLLGLIYANGVGIKADDDKA-----
SETD7_XENTR     ----------------------------------------------------------------------
ALGK_PSESM      RAADQPRAELLLGRLYYEGKWVPADAVKAEEHLKK-ATATEISAHYYLGQIYRRGYLGQVYPQKAVDELL
CA163_HUMAN     CDGGYTSSCFNLSAMFLQGAGFPKDMDLACKYSMKACDLGHIWACANASRMYKLGDGVDKDEAKAEV---
SETD7_MOUSE     ----------------------------------------------------------------------
YRRB_BACSU      VELNENDTEARFQFMCLANEGMLDEALSQFAAVTEQ-DPGHADAFYNAGVTYAYKENREKAL--------
SETD7_HUMAN     ----------------------------------------------------------------------
CA163_MOUSE     CDGGYAASCFNLSAMFLQGAGFPKDMGLACKYSMKACDLGHVWACANASRMYKLGDGVDKDEAKAEV---
CA163_DANRE     CEGGFAPSCFNLSTLYIQGPGLDKSMPLALKYALKACDLGHVWGCANASRMYKLGDGTDKDEQRAE----
FB76_ARATH      AFLGHVDALRELGHCLQDGYGVPQNVSEGRRFL-------------------------------------
CHR1_SCHPO      NDKGNADAMLALCKLYL--RGLPGHIRRAFEYAHRAAMLGHAPACYVLGKFYETGVGCVKDLAKSEAGFR
CHR2_SCHPO      AKYGLKDAQLRVARCFELGQECDINLVRSFVWYRRLARKRNPEAMWKLSQFYLNG---------------
K0746_HUMAN     ASKGLHQAVNGLGWXXXXXXXXXXXXXXXXXXXE---EMGNPDASYNLGVLHLDG---------------
CHR4_SCHPO      AKRGETEADLAVAKWYLNGDGIPVDEDLAFMHAERASMAGNANAQFLMGYLFDTRGNTE----QATYWYN
RPTN_HUMAN      ----------------------------------------------------------------------
YR850_MIMIV     ---------------------------ERDKWLKKSAKNGLSISQYSIGTKYLGGDVTNRKYQKGIIYLK
YE1A_SCHPO      AAQGDIDAIFKLGDYYYYGIGTPKDYSKAYTCYKIAYEQSSGMGLWNMAYMHEYGIGRDQDIYIAR----
EXOR_RHILV      AQQGVEPGSEDTGFFGIAGSPVRIDLSQARQYFQVASTFGVPEAQFQLAQMMLAGEGGNASPQQAKKWLN
SETD7_DANRE     ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           AAVKGGVKPALAALKELTPQTK
YBEQ_ECOLI      ----------------------
YL018_MIMIV     LAASQGLNSAKIKLAEM-----
SE1L1_RAT       LASQGG----------------
SE1L1_MOUSE     LASQGG----------------
SE1L1_MESAU     LASQGG----------------
SE1L1_HUMAN     LASQGG----------------
FB84_ARATH      ----------------------
YBET_ECOLI      ----------------------
Y1327_NEIMB     EAINNGYGQK-SVLQELLQQ--
HCPA_HELPJ      KGCKSSVKEACDALKEL-----
YL021_MIMIV     ----------------------
HCPE_HELPJ      ----------------------
HCPC_HELPY      ----------------------
HCPC_HELPJ      ----------------------
HCPA_HELPY      KGCKSSVKEACDALKEL-----
HCPE_HELPY      ----------------------
SKT5_YEAST      ----------------------
PODJ_CAUCR      IAGRAGDSTARGRATALRSQ--
PODJ_CAUCN      IAGRAGDSTARGRATALRSQ--
HCPD_HELPJ      ----------------------
HCPD_HELPY      KGCTLGFSGSCKVLEEV-----
K0746_MOUSE     KAAQGG----------------
YWQK_BACSU      ----------------------
YR815_MIMIV     RSYNNGCLYATYSLARLYIETK
CHR3_SCHPO      RAAKQGFPKAKKRLEEQALSSK
SE1L2_RAT       LASQSGQPLAIYYLAEM-----
SE1L2_MOUSE     LASQSGQPLAIYYLAEM-----
MOTX_VIBPA      ----------------------
SE1L2_HUMAN     LASQSGQPLAIYYLAKM-----
LR2BP_RAT       EAAERG----------------
HCPB_HELPY      ----------------------
K0141_RAT       IGLKSFSSPSLCSL--------
EXOR_RHIME      RARKNG----------------
Y1625_HAEIN     ----------------------
LR2BP_XENLA     EAAERG----------------
K0141_HUMAN     ----------------------
ALGK_PSEAE      LAARAGQASADMALAQLWSQ--
LR2BP_HUMAN     EAAERG----------------
LR2BP_MACFA     AAERGNV---------------
LR2BP_DANRE     EAAERG----------------
HRD3_CANGA      ----------------------
LR2BP_MOUSE     EAAERGNVYAQGTLVE------
ALGK_PSEPK      AAARGGQNSADYALAQL-----
K0141_MOUSE     TGLKSFSSPSLCSLNTL-----
YJCO_SHIFL      ----------------------
YJCO_ECOLI      ----------------------
YJCO_ECO57      ----------------------
SETD7_XENTR     ----------------------
ALGK_PSESM      TAARGGQNSADFALAQLFSQGK
CA163_HUMAN     ----------------------
SETD7_MOUSE     ----------------------
YRRB_BACSU      ----------------------
SETD7_HUMAN     ----------------------
CA163_MOUSE     ----------------------
CA163_DANRE     ----------------------
FB76_ARATH      ----------------------
CHR1_SCHPO      AGL-------------------
CHR2_SCHPO      ----------------------
K0746_HUMAN     ----------------------
CHR4_SCHPO      EAAKAGHSEAIERLALLENQ--
RPTN_HUMAN      ----------------------
YR850_MIMIV     NSAKQG----------------
YE1A_SCHPO      ----------------------
EXOR_RHILV      QARKSGHPGAMA----------
SETD7_DANRE     ----------------------