[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF68589.1

[Show Plain Result]


## Summary of Sequence Search
    1::157
    1::160     2e-84  93%  160 aa  YBEL_ECOLI RecName: Full=Uncharacterized protein ybeL;
    1::160     2e-84  93%  160 aa  YBEL_ECOL6 RecName: Full=Uncharacterized protein ybeL;
    1::160     2e-84  93%  160 aa  YBEL_ECO57 RecName: Full=Uncharacterized protein ybeL;
 1027::1142    2e-04  22% 1153 aa  CING_SORAR RecName: Full=Cingulin;
  199::237     4e-04  38%  286 aa  PANC_EDWI9 RecName: Full=Pantothenate synthetase;         Short=PS;
  499::601     6e-04  18%  776 aa  MUTS2_LACLA RecName: Full=MutS2 protein;
  394::466     8e-04  33%  848 aa  CLPB_MYCLE RecName: Full=Chaperone protein clpB;
  199::237     0.001  36%  284 aa  PANC_SERP5 RecName: Full=Pantothenate synthetase;         Short=PS;
  396::502     0.001  24%  508 aa  ATPA_NATTJ RecName: Full=ATP synthase subunit alpha;       
    1::157

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNKVAQYYRELVASLSERLRNGERDIDALVEQARQRVMQTGELTRTEVDELTRAVRRDLEEFAMSYEESQ
YBEL_ECOLI      MNKVAQYYRELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEESE
YBEL_ECOL6      MNKVAQYYRELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEESE
YBEL_ECO57      MNKVAQYYRELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEESE
CING_SORAR      --KLERRVKELSIQIDDERQNDQKDQLSLKVKALKRQVDEAEEEIERLDGLRKKAQRELEE---QHEANE
PANC_EDWI9      --RLAPRLYNIMMQLASQLENGERDLEALLEQTASRLRQAG-----------------------------
MUTS2_LACLA     ----------IISVASQQISDSEHDVNQMIEKLEEKTREVIESSRNKIERENQSLHKDLTKVYNQINRER
CLPB_MYCLE      ----------------------------LVDEAASRLRMEIDSRPVEIDEVERLVRREIEEMALVNEEDE
PANC_SERP5      --KIAPQLSKIMNALAEQLSNGERHVDELLEQTAEHLRNAG-----------------------------
ATPA_NATTJ      ----AQFGTDLDKSTQQKLARGKRTFEILKQDQYQPMPVADQITHGLLDDLEVEQIKEFEKFLLSYVKDN


                         .         .         *         .         .         .         .:140
query           EDSVFLRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCEKCHYHLAVYTPDVLP
YBEL_ECOLI      SDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLT
YBEL_ECOL6      SDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLT
YBEL_ECO57      SDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLT
CING_SORAR      QLQARIRALEKDSWRKAARSAAESSLQQEGLSSDEEFDGVYNPNSIASL---------------------
PANC_EDWI9      ----------------------------------------------------------------------
MUTS2_LACLA     EFEL------EKAQKEAQEVVKKASLEAQEILKNLNDKAALKPHEII-----------------------
CLPB_MYCLE      ASKERLETLRAELKERLAELTARWQNE-------------------------------------------
PANC_SERP5      ----------------------------------------------------------------------
ATPA_NATTJ      EPGIYQQVISDELEDQLKEVINKAKEQFKE----------------------------------------


                         +         .         .         .         .         *         .:210
query           LCPKCGHDQFQRRPFEP
YBEL_ECOLI      LCPKCGHDQFQRRPFEP
YBEL_ECOL6      LCPKCGHDQFQRRPFEP
YBEL_ECO57      LCPKCGHDQFQRRPFEP
CING_SORAR      -----------------
PANC_EDWI9      -----------------
MUTS2_LACLA     -----------------
CLPB_MYCLE      -----------------
PANC_SERP5      -----------------
ATPA_NATTJ      -----------------