[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF68745.1

[Show Plain Result]


## Summary of Sequence Search
    1::408
   26::330     2e-19  32%  335 aa  GCAT_AERHY RecName: Full=Phosphatidylcholine-sterol
  144::409     1e-17  32%  418 aa  HLT_VIBPA RecName: Full=Thermolabile hemolysin;       
   46::287     5e-07  32%  356 aa  GDL45_ARATH RecName: Full=GDSL esterase/lipase At2g36325;       
    1::143     7e-07  33%  336 aa  SIFA_SALTY RecName: Full=Protein sifA;
   34::302     7e-07  31%  394 aa  GDL40_ARATH RecName: Full=GDSL esterase/lipase At2g27360;       
  121::359     3e-06  30%  381 aa  GDL57_ARATH RecName: Full=GDSL esterase/lipase At3g48460;       
   34::347     7e-06  29%  368 aa  GDL64_ARATH RecName: Full=GDSL esterase/lipase At4g16230;       
   37::357     2e-05  31%  384 aa  GDL29_ARATH RecName: Full=GDSL esterase/lipase At1g71691;       
   24::349     5e-05  27%  350 aa  GDL34_ARATH RecName: Full=GDSL esterase/lipase At2g04570;       
  193::354     1e-04  21%  360 aa  GDL43_ARATH RecName: Full=GDSL esterase/lipase At2g31540;       
  558::670     2e-04  25% 1341 aa  RPOA1_METJA RecName: Full=DNA-directed RNA polymerase subunit A';  
   62::112     2e-04  39%  205 aa  HEM2_CLOJO RecName: Full=Delta-aminolevulinic acid dehydratase;    
  193::354     3e-04  21%  360 aa  GDL44_ARATH RecName: Full=GDSL esterase/lipase At2g31550;       
  155::245     4e-04  40%  294 aa  ALF1_OCEIH RecName: Full=Fructose-bisphosphate aldolase class 1;   
  207::358     9e-04  22%  358 aa  GDL41_ARATH RecName: Full=GDSL esterase/lipase At2g30220;       
   39::351     9e-04  28%  374 aa  GDL28_ARATH RecName: Full=GDSL esterase/lipase At1g71250;       
    1::408

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPLSVGQGYFTSFISSEKFNAIKESARLPELSLWEKIKAYFFTTHHAEALECIFNLYHHQELNLTPVQVR
GCAT_AERHY      ----------------------------------------------------------------------
HLT_VIBPA       ----------------------------------------------------------------------
GDL45_ARATH     ----------------------------------------------------------------------
SIFA_SALTY      MPITIGNGFLKSEILTNSPRNTKEAWWKV---LWEKIKDFFFSTGKAKADRCLHEML-FAERAPTRERLT
GDL40_ARATH     ----------------------------------------------------------------------
GDL57_ARATH     ----------------------------------------------------------------------
GDL64_ARATH     ----------------------------------------------------------------------
GDL29_ARATH     ----------------------------------------------------------------------
GDL34_ARATH     ----------------------------------------------------------------------
GDL43_ARATH     ----------------------------------------------------------------------
RPOA1_METJA     ----------------------------------------------------------------------
HEM2_CLOJO      ----------------------------------------------------------------------
GDL44_ARATH     ----------------------------------------------------------------------
ALF1_OCEIH      ----------------------------------------------------------------------
GDL41_ARATH     ----------------------------------------------------------------------
GDL28_ARATH     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GAYIKLRALASQGCKEQFIIESQEHADKLIIKDDNGENILSIEVECHPEAFGLAKEINKSHPKPKNISLG
GCAT_AERHY      ----------------------------------------------------------------------
HLT_VIBPA       ----------------------------------------------------------------------
GDL45_ARATH     ----------------------------------------------------------------------
SIFA_SALTY      EIFFELKELACASQRDRFQVHNPHENDATIIMDQNEENELTFSCEVMGNLYFLMKDILKSHPQ-------
GDL40_ARATH     ----------------------------------------------------------------------
GDL57_ARATH     ----------------------------------------------------------------------
GDL64_ARATH     ----------------------------------------------------------------------
GDL29_ARATH     -----------------------------------------------------------SAPPPPLVDLG
GDL34_ARATH     ---------------------------------------------------------------------G
GDL43_ARATH     ----------------------------------------------------------------------
RPOA1_METJA     ----------------------------------------------------------------------
HEM2_CLOJO      ----------------------------------------------------------------------
GDL44_ARATH     ----------------------------------------------------------------------
ALF1_OCEIH      ----------------------------------------------------------------------
GDL41_ARATH     ----------------------------------------------------------------------
GDL28_ARATH     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DITRLVFFGDSLSDSLGRMFEKTHHILPSYGQYFGGRFTNGFTWTEFLSSPHFLGKEMLNFAEGGSTSAS
GCAT_AERHY      --SRIVMFGDSLSDT-GKMYSKMRGYLPSSPPYYEGRFSNGPVWLEQLTN-EFPGLTIANEAEGGPTAVA
HLT_VIBPA       -INKVVALGDSLSDT-GNIFNASQWRFPNPNSWFLGHFSNGFVWTEYIAKAKNL--PLYNWAVGGAAGEN
GDL45_ARATH     --TKLFVFGDSYADTGNTPFL----IVPSWRFPNGGRFSDGRVSTDYLAKPRLAVKRGMNFAYGGA-GAF
SIFA_SALTY      ----------------------------------------------------------------------
GDL40_ARATH     ----IISFGDSITDTLSSPNDLPESAFPPYGETFSGRFSDGRLIAEFLGIPHFYGSKNVNFAVGGATALE
GDL57_ARATH     ----------------------------------------------------------VNFAVSGSTVIK
GDL64_ARATH     -------FGDSLVDAGNNNYLATANYVPN-GIDFGGRFTNGRTIVDIVYTPPYLAPTTVNYASGGSGILN
GDL29_ARATH     IVPALFVFGDSLIDNGNNSFAKANYF--PYGIDFNGRFCNGLTMVDGIAQSEATGDQVLRGVNYASAAAG
GDL34_ARATH     KIPAIIVFGDSSVDAGNNNYIPTRSNFEPYGRDFTGRFCNGKIATDFMSEPAYLDPSISDFATGVTASAA
GDL43_ARATH     ----------------------------------------------------------------------
RPOA1_METJA     ----------------------------------------------------------------------
HEM2_CLOJO      ----------------------------------------------------------------------
GDL44_ARATH     ----------------------------------------------------------------------
ALF1_OCEIH      ----------------------------------------------------------------------
GDL41_ARATH     ----------------------------------------------------------------------
GDL28_ARATH     -VPAMFVLGDSLVDAGNNNFLQTANFLP-YGIDMNGRFSNGLTFIDLLADPTTSGNRILNYASAAAGILD


                         .         .         .         +         .         .         .:280
query           YSCFNCIGDFVSNTDRQVASYTPSHQDLAIFLLGANDYMTLHKDNVIMVVEQQIDDIEKIISGGVNNVLV
GCAT_AERHY      YNSWNPKYQVINNLDYEVTQFLQKDDDLVILWVGANDYLAYTEQDAKRVRDAISDAANRMVLNGAKEILL
HLT_VIBPA       YIALTGVGEQVSSTYAKLAKNYKPANTLFTLEFGLNDFMNYNR-GVPEVKADYAEALIRLTDAGAKNFML
GDL45_ARATH     ETMFKLIDSFEQLLMRNVYSPADLNSSVAFFSIIGNDYLTYDRRNTRKVVKQILLDVKRIKDLGVRKVLV
SIFA_SALTY      ----------------------------------------------------------------------
GDL40_ARATH     CSVLEEKGTHCSQSNISLGNQLKSFKESLPYLIGGNDYIEEVKELVPLVITTISSAISELVDMGARTFLV
GDL57_ARATH     HAFFVKNNLSLDMTPQSIET------ELAWFTLGTNQKVSLFKDSLFWIGEIGVNDLETLLNKGVKYMLV
GDL64_ARATH     -STGKLFGERI-NVDAQLDNFATTRQDIAIFSVGSNDLINNYFTPVISTLQRKVVQLTRLYQLGARKIVV
GDL29_ARATH     ILP-DTGGNFVGRIDQQIHNFETTLDQVAFFIMGSNDYL----NNYLMLVQHYTDQLTRLYNLGGRKFVV
GDL34_ARATH     TGYDNATSDVLSVLPKQLEYYKEYQSSLYLISIGTNDFLSLYQDFLAGIAKEFV---KKLHGLGARKISL
GDL43_ARATH     ------------------------------FISGYQDFILKRLENFV----------RELYSLGVRNVLV
RPOA1_METJA     -----------------------------------NDFPMFEDDNRVIVDEEKIKKVINNIGGTYKNKII
HEM2_CLOJO      --------------------------------------------------------IEAALKADVKSVLL
GDL44_ARATH     ------------------------------FISGYQDFILKRLENFV----------RELYSLGVRNVLV
ALF1_OCEIH      ------------------------------------------------VVDQQFDIGKKIIAAGLVPIIE
GDL41_ARATH     --------------------------------------------------------VRELYSLGCRNILV
GDL28_ARATH     VSGYNYGGRFSLNQQMVNLETTLSQRSLVVLVFGSNDYINNYPDFANLLLSQYARQLLTLYSLGLRKIFI


                         .         *         .         .         .         .         +:350
query           MGIPDLSLTPYGKHSDEKRKLKDESIAHNALLKTNVEELKEKYPQHKICYYETADAFKVIMEAASNIGYD
GCAT_AERHY      FNLPDLGQNPSARSQKVVEAASHVSAYH---XXXXXXXXXXXXPTGMVKLFEIDKQFAEMLRDPQNFGLD
HLT_VIBPA       MTLPDATKAPQFKYSEEIDKIRAKVLEMNEFIK--AQAMYYKAQGYNITLFDTHALFETLTSAPE-----
GDL45_ARATH     ALSPPQKVTPKGCDTND-----TSTYLHNSLLRKGLIKLNDKEINNNDKSFMTLDLYNAFVTIFKNKG--
SIFA_SALTY      ----------------------------------------------------------------------
GDL40_ARATH     PGNFPLGLTLYETPNKEEYNLNDFSVYHNEQLQAELKRLRNLYPHVNIIYGDYYNTLLRLMQEPSKFG--
GDL57_ARATH     QGHPALTLAMSLAAEDDRDSLNNQSYTHNLALQSKLKQLRIKYPSATIVYADYWNAYRAVIKHPSKYGIT
GDL64_ARATH     INIGPIGCIPFERESDPAAEPNEVAQMYNLKLKTLVEELNKNLQGSRFVYGDVFRIVDDIIQNYSSYGFE
GDL29_ARATH     AGLGRMGCIPSGKCSEEVNQLV---LPFNTNVKTMISNLNQNLPDAKFIYLDIAHMFEDIVANQAAYGLT
GDL34_ARATH     GGLPPMGCMPLGTGGECVGRYNDIAVQFNSKLDKMVEKLSKELPGSNLVFSNPYEPFMRIIKNPSSFGFE
GDL43_ARATH     GGLPPMGCLPIHMTAKFRNIFRKDSVLYNEKLQNLLPQIEASLPGSKFLYADVYNPMMEMIQNPSKYGFE
RPOA1_METJA     NELKDRKLIPL-TYNDQKASILARIVGHGSLIINN--------KNSRVVFRGDIEDLKTIKEDLKELGYD
HEM2_CLOJO      FGLP--------KHKDEKGS---EAYNENGVLQQGIREIKQRYPQMQV----------------------
GDL44_ARATH     GGLPPMGCLPIHMTAKFRNIFRKDSVLYNEKLQKLLPQIEASLPGSKFLYADVYNPMMEMIQNPSKYGFE
ALF1_OCEIH      ---PEVDI-----HSPEKEKLKAEIINHNQLSEDENVMLKLTIPTKKNLYKELIDHPRVVRVVALSGGYS
GDL41_ARATH     GGLPPMGCLPIQLTAKLRTILNKDSILYNQKLVKKLPEIQASLPGSKFLYANVYDPVMDMIRNPSKYGFE
GDL28_ARATH     PGVAPLGISPPDRCVDSVNQILG---TFNQGLKSLVDQLNQRSPGAIYVYGNTYSAIGDILNNPAAYGFS


                         .         .         .         .         *         .         .:420
query           TENPYTHHGYVHVPGAKDPQLDICPQYVFNDLVHPTQEVHHCFAIMLESFIAHHYSTx
GCAT_AERHY      TENACYGGSYVWKPFASDSQLSACEGKMFWDQVHPTTVVHAALSEPAATFIESQY---
HLT_VIBPA       ------EHGFVN---ASDPCLDIAEKFVFWDVTHPTTATHRYVAKMLES---------
GDL45_ARATH     ----------------------------------------------------------
SIFA_SALTY      ----------------------------------------------------------
GDL40_ARATH     ----------------------------------------------------------
GDL57_ARATH     EKEPYNFQGTDAATVCKDPN-----QYINWDGVHLTEAMYKVMADM------------
GDL64_ARATH     SEKIPCCSLVGKVGGPCGPPSKVCSKYVFWDPYHPTEAANIIIARRLLS---------
GDL29_ARATH     TMDKGCNRGQITCLPFETP----CPQYVFWDAFHPTEKVN------------------
GDL34_ARATH     VVGAACEMGY----GCQRNNPFTCTKYVFWDSFHPTQKTNHIMANALMNSTFPHF---
GDL43_ARATH     TKRGCCGTGFLETSFMCNVFSPVCSEFLFFDSIHPSEATYNVIGNLLDPLI-------
RPOA1_METJA     GEEIKLHEGETEI---------------------------------------------
HEM2_CLOJO      ----------------------------------------------------------
GDL44_ARATH     TKRGCCGTGFLETSFMCNVFSPVCSEFMFFDSIHPSEATYNVIGNRLDPLI-------
ALF1_OCEIH      TD--------------------------------------------------------
GDL41_ARATH     TKKGCCGTGYLETSFLCTSLSKTCPDHLFWDSIHPSEAAYKYLGNFIDAQIQEWLKT-
GDL28_ARATH     VVDRACNQGQITCLPLQTP----CPQYVFWDAFHPTQTANSILA--------------