[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF68874.1

[Show Plain Result]


## Summary of Sequence Search
    1::286
    1::282     2e-98  60%  286 aa  Y2418_PSEAE RecName: Full=Pirin-like protein PA2418;
   17::252     1e-43  38%  261 aa  Y133_THEAC RecName: Full=Pirin-like protein Ta0133;
   25::281     2e-43  41%  291 aa  PIRL_SOLLC RecName: Full=Pirin-like protein;
   34::281     1e-41  41%  285 aa  Y3240_PSEAE RecName: Full=Pirin-like protein PA3240;
   32::276     2e-41  42%  276 aa  Y481_CAUCR RecName: Full=Pirin-like protein CC_0481;
   51::311     8e-41  39%  321 aa  PIRL2_ARATH RecName: Full=Pirin-like protein At2g43120;
   19::279     3e-40  38%  282 aa  Y3769_VIBCH RecName: Full=Pirin-like protein VC_A0969;
   34::277     3e-39  40%  291 aa  PIR_RAT RecName: Full=Pirin;
   34::277     4e-38  39%  290 aa  PIR_MOUSE RecName: Full=Pirin;
   34::277     1e-37  38%  290 aa  PIR_HUMAN RecName: Full=Pirin;
   57::281     3e-37  39%  287 aa  PRN1_ARATH RecName: Full=Pirin-1;AltName: Full=AtPirin1;
   37::261     3e-37  39%  271 aa  PIRL4_ARATH RecName: Full=Putative pirin-like protein At3g59260;
   46::292     6e-34  39%  310 aa  PIRL1_ARATH RecName: Full=Pirin-like protein At1g50590;
   16::272     1e-32  37%  288 aa  Y3178_CAUCR RecName: Full=Pirin-like protein CC_3178;
   34::295     2e-20  35%  315 aa  Y1205_PSEAE RecName: Full=Pirin-like protein PA1205;
   52::231     6e-17  32%  231 aa  YHHW_ECOLI RecName: Full=Protein yhhW;
   52::231     1e-16  32%  231 aa  YHHW_ECO57 RecName: Full=Protein yhhW;
   52::222     1e-16  34%  232 aa  Y1773_SYNY3 RecName: Full=Pirin-like protein sll1773;
   53::229     2e-15  32%  235 aa  Y1337_ZYMMO RecName: Full=Pirin-like protein ZMO1337;
   53::229     9e-14  31%  232 aa  Y1210_PSEAE RecName: Full=Pirin-like protein PA1210;
   56::122     4e-12  49%  244 aa  Y187_MYCBO RecName: Full=Pirin-like protein Mb0187c;
   56::122     4e-12  49%  244 aa  Y181_MYCTU RecName: Full=Pirin-like protein Rv0181c/MT0190;
   53::199     2e-10  28%  233 aa  Y1685_PASMU RecName: Full=Pirin-like protein PM1685;
   53::118     1e-09  41%  232 aa  Y1473_CAUCR RecName: Full=Pirin-like protein CC_1473;
    1::286

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKQITGVYTAPRPHWVGDGFPVRSLFSYQSHAQQLSPFLLLDYAGPHTFTPGNEKRGVGEHPHRGFETVT
Y2418_PSEAE     MKKVLGIYGNANRHWVGDGFPVRSLFSYNTLGQHISPFLLLDYAGPADFPPAQQRRGVGQHPHRGFETVT
Y133_THEAC      ------------------------------------------------------------HPHRGIETIT
PIRL_SOLLC      ----------------GDGAIVRRSIG-RPELQNLDPFLMLDEFSV------SQPAGFPDHPHRGFETVT
Y3240_PSEAE     --------------------------------ERFDPFLMLDQFD--TQNPDDYVAGFPSHPHRGFETVT
Y481_CAUCR      -------------------------------AQMFDPFLMLDCFDNDQAS--DYLGGFPDHPHRGFETVT
PIRL2_ARATH     ----------------GDGAVVRRGIS-RSEQKLLDPFLMLD---EFSVSP---PAGFPDHPHRGFETVT
Y3769_VIBCH     ----------------GDGVKIQRIAGFQR--PNFSPFLMLDELKADS--QADYIGGFPPHPHRGIETLT
PIR_RAT         --------------------------------KMLDPFLLFDEF------KGGRPGGFPDHPHRGFETVS
PIR_MOUSE       --------------------------------KNLDPFLLFDEF------KGGKPGGFPDHPHRGFETVS
PIR_HUMAN       --------------------------------KNLDPFLLFDEF------KGGRPGGFPDHPHRGFETVS
PRN1_ARATH      --------------------------------------------------------GFPDHPHRGFESVT
PIRL4_ARATH     --------------------------------------------------------GFKDHPHRGFESVT
PIRL1_ARATH     ------------------------------------PFLVLDEFSV------SAPAGFPDHPHRGFETVT
Y3178_CAUCR     -------------------FEVGRVLPFHAH-RMVGPFTFLDHMGPAAFQPGFPKSAVRPHPHIGLSTLT
Y1205_PSEAE     ---------------IGGGITVSRLMPSRQR-RMIGAWCFLDHAGPAEFEPGGGL-AVGPHPHIGLQTFT
YHHW_ECOLI      -------------------------------------------------------QGFGTHPHKDMEILT
YHHW_ECO57      -------------------------------------------------------QGFGTHPHKDMEILT
Y1773_SYNY3     -------------------------------------------------------QGFATHGHKDMEIVT
Y1337_ZYMMO     --------------------------------------------------------GFGMHPHKDMEIVT
Y1210_PSEAE     --------------------------------------------------------GFPPHPHRDMEIIT
Y187_MYCBO      --------------------------------------------------------GFDPHPHRDMEIVT
Y181_MYCTU      --------------------------------------------------------GFDPHPHRDMEIVT
Y1685_PASMU     ------------------------------------------------------QHGFDMHPHQDMEILT
Y1473_CAUCR     --------------------------------------------------------GFPPHPHSDMEIIT


                         .         .         *         .         .         .         .:140
query           IVYSGEVEHRDSTGRGGVIGPGDVQWMTAGAGILHEEFHSDAFTRRGGELEMVQLWVNLPMKDKMTPPGY
Y2418_PSEAE     IVYQGEVEHHDSTGAGGRIGPGDVQWMTAASGILHEEYHSERFRSTGGTLEMVQLWVNLPSSDKMNPPRY
Y133_THEAC      YQIKGKTFHEDSEGHRGIIAPGEIQWMTAGSGIFHEEMEENKYRERNDSNAGIQLWLNMPASSKMADPAY
PIRL_SOLLC      YMLQGAFTHQDFAGHKGTIRTGDVQWMTAGRGIVHSEMPAGPGTQKG-----LQLWINLSSKDKMIEPRY
Y3240_PSEAE     YMLEGRMRHEDHLGNRGLLKPGGVQWMTAAHGIIHSEMPEQV----EGAMRGFQLWVNLPAKNKLAPAGY
Y481_CAUCR      YMLEGRMRHKDNTGREGVIGPGGIQWMRAGKGIVHSEMPE----QDQGRMRGFQLWVNLPARLKMSAPGY
PIRL2_ARATH     YVLEGGITHQDFKGHKGTIYAGDVQWMTAGRGIIHSEMPEEEVNKG------LQLWINLSSNEKMIEPNY
Y3769_VIBCH     YMLQGHFQHRDQMGNVGELRSGGAQWMAAGHGVIHSEMP----IMQEGQLHGFQIWINQPARNKMSPAKY
PIR_RAT         LLEGGSMAHEDFCGHVGKMNPGDLQWMTAGRGILHAEMPCSEEPAHG-----LQLWVNLKRSEKMVEPQY
PIR_MOUSE       LLEGGSMAHEDFCGHVGKMNPGDLQWMTAGRGILHAEMPCSEEPAHG-----LQLWVNLRRSEKMVAPQY
PIR_HUMAN       LLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHG-----LQLWVNLRSSEKMVEPQY
PRN1_ARATH      YMLQGGIIHKDPKGHKGTIQAGDVQWMTAGRGIIHSEFPEEEVNNG------LQLWINLPSTEKMTEPKY
PIRL4_ARATH     YMFQGGIIHQDCNGNKGTIHEGDVQWMTAGRGIIHSEMPEEQVNKG------LQLWINLPSSAKMIEPKN
PIRL1_ARATH     YMLEGEILHEDCEGHKGVIREGGLQWMTAGKGIVHSEMNSNGITHNKG----LQLWINLSSRQKLVEPSY
Y3178_CAUCR     YLFEGEITHRDSVGSLAVIKPHEVNWMTAGSGITHSE-RFEGLREHGGRMDGMQAWVALPTEFEEIDP--
Y1205_PSEAE     WMIQGEALHRDSLGNVQVIRPGQVNLMTAGHGIAHDERHAHA----------AQLWIALPYEQRDIAPAF
YHHW_ECOLI      YVLEGTVEHQDSMGNKEQVPAGEFQIMSAGTGIRHSEYNPSSTER----LHLYQIWI-MPEENGIT-PRY
YHHW_ECO57      YVLEGTVEHQDSMGNKEQVPAGEFQIMSAGTGIRHSEYNPSSTER----LHLYQIWI-MPEENGIT-PRY
Y1773_SYNY3     YVLEGELEHKDSIGNGSIIRPGDVQRMSAGTGILHSEFNPSP----DQPVHLLQIWIT-PNQFGVEPSYE
Y1337_ZYMMO     YIREGALTHEDSLGNKGRIEAGDVQVMSAGTGIVHSEYN-----REASDTRLFQIWI-MPNQSGHKPSGS
Y1210_PSEAE     YVREGAITHQDSLGNKGRTEAGDVQVMSAGTGIVHSEYNLEAETTR-----IFQIWIIPDRRGDQPRWGS
Y187_MYCBO      WVLRGALRHQDSAGNSGVIYPGLAQRMSAGTGILHSEMNDSATE----PVHFVQMWV-------------
Y181_MYCTU      WVLRGALRHQDSAGNSGVIYPGLAQRMSAGTGILHSEMNDSATE----PVHFVQMWV-------------
Y1685_PASMU     YILSGTIEHQDSMGNHTQLHAGEFQIMSAGSGVHHAEINPSS----EHDVHLYQIWI-LP-KSKGIAPRY
Y1473_CAUCR     YVRDGAITHQDNLGNKGRTVAGDVQVMSAGSGIRHAEYNLEPETTR-----IFQIWI-------------


                         +         .         .         .         .         *         .:210
query           QSITHDVIPTVTLPDNAGVVRVIAGRYEETKGPAHTFSPLNVWDMRLQRNRQLTLAQPEGWSTALVVLKG
Y2418_PSEAE     QTLLDADIPRVGLPDRAGELRVIAGRYGRHQGPALTHSPLAVWDVQLKAGKHLALDLPKGHTCAVVVLRG
Y133_THEAC      RSIRSDQIPQIS-DDYGNRIRIVAGTVNRVSGALNRIDPYYV-EILMEPDTRTSLSVPEGHRAIMAIVEG
PIRL_SOLLC      QELLHQDIPKA---EKDGVVTILAGESMGKKSQVFTRTPTMYLDFTLKPGSEHHQPIPETWNAFLYIVEG
Y3240_PSEAE     RDIEPEDVPRL---ETAGGVKVIAGRFDD--GQAQQIGAVHYYDLQLPAGGRIAPRLPDGHRVLLYVYEG
Y481_CAUCR      QEFETDSIP-VEARDGGVTVKVISGATETTAGPIGGGADALYFDVALPAGTVFEEPVGDDRNAMLAVYEG
PIRL2_ARATH     QELSHSDIPKA--EQNGVEVKVIAGESMGIQSPVYTRTPTMFLDFTLQPGAQIHQNVPESWNAFAYILEX
Y3769_VIBCH     QDFQPESIVERHHPQQ-GLLRVIAGSVETITGPTDTGVPATVVDWRAEAGQDISINTPPHFNAMLYVYRG
PIR_RAT         QELKSEEIPK---PSKDGVVAVISGEALGIKSKVYTRTPTLYLDFKLDQGAKHSQPIPKGWTSFIYTISG
PIR_MOUSE       QELKSEEIPK---PTKDGVVAVISGEALGIKSKVYTRTPTLYLDFKLDQGAKHSQPIPKGWTSFIYTISG
PIR_HUMAN       QELKSEEIPK---PSKDGVVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISG
PRN1_ARATH      KELSSLDIPRA--EENGVEVKVIAGDSMGIKSPVYTRTPTMFLDFTLKPGSQTHQTVPESWTAFAYIIEG
PIRL4_ARATH     IEISSSEIPSA---DDYGVVKVIAGESMGVKSPFYTKTPIMFLDFTLDPKAQTHQAVPESWTAFAYIVEG
PIRL1_ARATH     QEISKDIAET----EKDGVVRVIAGEWNGVKSKICTRTPTMYLDFTLSPGSRISQPIPLHWNAFVYVLQG
Y3178_CAUCR     -SFTHHEGP-AELPENGGLARLIAGEAFGAKSSVPVYSPLFYWELEPGVTAALPAEYPE---RAAYIAAG
Y1205_PSEAE     -----DHHPDLPRWQEQGVTTLLAGALAGRQAPCRLYSPLLGADLACHSTLQLTL-DPHFXXXXXXXXXX
YHHW_ECOLI      EQRRFDAV--------QGKQLVLSPDARDGSLKVHQDMELYRWALKDEQSVHQIAAERRVW---IQVVKG
YHHW_ECO57      EQRRFDAV--------QGKQLVLSPDARDGSLKVHQDMELYRWALKDEQSVHQIAAERRVW---IQVVKG
Y1773_SYNY3     QKF-------FSPEDKQGQLRLVASP-DGRNGSVTIHQDACIYASVLGQGETVSLSNRRAW---LQIIRG
Y1337_ZYMMO     RSFPK--------KDHAGRFVVLASGYPEDKEALPIHADAAVLGATLNKGDVINYPLEEQRYGYLVVSKG
Y1210_PSEAE     KPFPK--------AERDGRFVTLASGDEQDSEALHIRADAEVAAVTLKAGQSAEYALENGRRAYLVPATG
Y187_MYCBO      ----------------------------------------------------------------------
Y181_MYCTU      ----------------------------------------------------------------------
Y1685_PASMU     EQ--------GCFADTEGATLILSPEAKDGAFYIHQDMSLWRWQLSLEQSAVKTIPLLPTRRYWLQLVKG
Y1473_CAUCR     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NITVNGTTPVNEAQLVVLSQQGKTLHLEASSDASVLLLSGEPLNEPIVGYGPFVMNTKQEIAEAVRDFNS
Y2418_PSEAE     TLAV-GDEIVREAQVAXXXXXXXXXXXXANNDVQLLVLSGEPLDEPIIGYGPFVMSSREEIDQAIEDFEN
Y133_THEAC      SIRVNGST-FNEKNVAVLSKEGTDIFIDSQANSRLIFLAGKPLNEPIAWYGPIVMNTRDQLIQAFNELQE
PIRL_SOLLC      GSSDSTTTPAHHC-LVLGPGEGLSVWNKSSKPLRFVLIGGQPINEPVVQYGPFVMNTKSEIMQAYQDYQL
Y3240_PSEAE     SLTVEGERPVEIANXXXXXXXXXXXXXXXXXXARVLVLAGKPLHEPIVQYGPFVMNSREEIEQALRDYRD
Y481_CAUCR      KVRVAHDTV--DALSGVFLGRGDTVRVEAVTDARVLLLAGRPIGEPVFWHGPFVMDTREGLMQAFDDFQR
PIRL2_ARATH     XXXXXXXXPIPAHSVVVFGPGNDGVSVSSSKQLRFVLIAGEPIGEPVVQYGPFVMNTQAEIDMTIEDYHY
Y3769_VIBCH     SLNV-GKQSVKTGHMAMLTA-GEQLTLRAEQPCGSLLLMGQPIDEPVVHYGPFVMNSMAEIEQAIRDYNA
PIR_RAT         DVYIDAQQKIEPHRTAVLGE-GDTVQLENKDPSHFVLIAGEPLREPVVQHGPFVMNTNEEISEAILDFRN
PIR_MOUSE       DVYIDAQQKIEPHHTAVLGE-GDAVQLENKDPSHFVLIAGEPLREPVVQHGPFVMNTNEEISQAILDFRN
PIR_HUMAN       DVYIDAQQKIEPHHTAVLGE-GDSVQVENKDPSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRN
PRN1_ARATH      DEGVFGSSSAISAHHVVVFGPGDLVSVSTSRSLRFLLIAGEPIGEPVVQCGPFVMNSQAEIDMAFDDYQN
PIRL4_ARATH     DVFSSSDSSTVQAHNVVVFGTGDEVSVWNTSNSRFLLIAGEPIGEPVVQHGPFVMNSQDEIEMTIGDYRN
PIRL1_ARATH     HGHFGDSXXXXXXXXXXXXXXXDMLEAWNGSDSGLILVAGEPIGEPMVQFGPFVMNTQEEIDETIDDFEN
Y3178_CAUCR     RVEVDGRELV-EAQMAVFA-PGETVVFKALERSTVMLLGGEPVGPRFIEWN-FVSSSKDRIEQAKADWKA
Y1205_PSEAE     XXXXXXHFAVNE--LAYXXXXXXXXXXXXXXXARVLLLGGAPFGAEIFMWWNFVGHSKGEIARAQKAWEE
YHHW_ECOLI      NVTINGVKASTSDGLAIWDEQAISIH--ADSDSEVLLFDLPPV---------------------------
YHHW_ECO57      NVTINGVKASISDGLAIWDEQAISIH--ADSDSEVLLFDLPPV---------------------------
Y1773_SYNY3     NLTLNGKTGINEEQAITCTGQGE-----------------------------------------------
Y1337_ZYMMO     IIAIENCT-LQEGDAAGLAEV-ETISIEAKEDSEIVMV--------------------------------
Y1210_PSEAE     SIEVNGVRA--EARDGLAVRDEPTLKVTALEDSEVLLV--------------------------------
Y187_MYCBO      ----------------------------------------------------------------------
Y181_MYCTU      ----------------------------------------------------------------------
Y1685_PASMU     QLRVN-----------------------------------------------------------------
Y1473_CAUCR     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GRFGQI
Y2418_PSEAE     GRF---
Y133_THEAC      GKF---
PIRL_SOLLC      GKNG--
Y3240_PSEAE     G-----
Y481_CAUCR      GRF---
PIRL2_ARATH     GKNG--
Y3769_VIBCH     GHF---
PIR_RAT         AKNG--
PIR_MOUSE       AKNG--
PIR_HUMAN       AKNG--
PRN1_ARATH      AKNG--
PIRL4_ARATH     GMNG--
PIRL1_ARATH     FRNG--
Y3178_CAUCR     GR----
Y1205_PSEAE     GRFGRL
YHHW_ECOLI      ------
YHHW_ECO57      ------
Y1773_SYNY3     ------
Y1337_ZYMMO     ------
Y1210_PSEAE     ------
Y187_MYCBO      ------
Y181_MYCTU      ------
Y1685_PASMU     ------
Y1473_CAUCR     ------