[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF69275.1

[Show Plain Result]


## Summary of Sequence Search
    1::292
  101::318     4e-45  45%  319 aa  FAHD2_XENLA RecName: Full=Fumarylacetoacetate hydrolase
   95::312     2e-44  44%  313 aa  FAHD2_RAT RecName: Full=Fumarylacetoacetate hydrolase
   95::313     2e-44  44%  314 aa  FAHD2_BOVIN RecName: Full=Fumarylacetoacetate hydrolase
   95::313     3e-44  44%  314 aa  FAH2A_HUMAN RecName: Full=Fumarylacetoacetate hydrolase
   93::313     8e-44  43%  314 aa  FAH2B_HUMAN RecName: Full=Fumarylacetoacetate hydrolase
   95::313     2e-43  44%  314 aa  FAHD2_PONAB RecName: Full=Fumarylacetoacetate hydrolase
   61::300     4e-40  43%  301 aa  YISK_BACSU RecName: Full=Uncharacterized protein yisK;
   95::312     9e-40  41%  313 aa  FAHD2_MOUSE RecName: Full=Fumarylacetoacetate hydrolase
   35::237     2e-39  44%  250 aa  Y2225_ARCFU RecName: Full=Uncharacterized protein AF_2225;
    1::282     2e-38  40%  282 aa  UGL_BURS3 RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
    1::282     2e-38  40%  282 aa  UGL_BURCM RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
    1::272     9e-38  41%  282 aa  UGL_BURCJ RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
    1::282     1e-37  39%  282 aa  UGL_BURA4 RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
    1::298     6e-36  37%  300 aa  Y973_STAAC RecName: Full=Uncharacterized protein SACOL0973;
    1::298     6e-36  37%  300 aa  Y968_STAAM RecName: Full=Uncharacterized protein SAV0968;
    1::298     6e-36  37%  300 aa  Y906_STAA8 RecName: Full=Uncharacterized protein SAOUHSC_00906;
    1::298     6e-36  37%  300 aa  Y871_STAA3 RecName: Full=Uncharacterized protein SAUSA300_0871;
    1::298     6e-36  37%  300 aa  Y850_STAAW RecName: Full=Uncharacterized protein MW0850;
    1::298     6e-36  37%  300 aa  Y838_STAAS RecName: Full=Uncharacterized protein SAS0838;
    1::298     6e-36  37%  300 aa  Y837_STAAB RecName: Full=Uncharacterized protein SAB0837;
    1::298     6e-36  37%  300 aa  Y829_STAAN RecName: Full=Uncharacterized protein SA0829;
    1::298     8e-36  37%  300 aa  Y930_STAAR RecName: Full=Uncharacterized protein SAR0930;
    9::305     1e-35  37%  305 aa  FAHD2_DICDI RecName: Full=Fumarylacetoacetate hydrolase
   73::298     1e-35  37%  301 aa  Y665_STAES RecName: Full=Uncharacterized protein SE_0665;
   73::298     1e-35  37%  301 aa  Y556_STAEQ RecName: Full=Uncharacterized protein SERP0556;
   80::300     1e-35  38%  301 aa  Y1806_STAS1 RecName: Full=Uncharacterized protein SSP1806;
   80::298     3e-35  37%  301 aa  Y1982_STAHJ RecName: Full=Uncharacterized protein SH1982;
    1::264     4e-35  41%  282 aa  UGL_BURM1 RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
   37::235     8e-34  41%  237 aa  Y1656_METJA RecName: Full=Uncharacterized protein MJ1656;
    1::282     2e-31  36%  282 aa  UGL_BURCH RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
    1::282     2e-31  36%  282 aa  UGL_BURCA RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
    1::272     6e-31  37%  282 aa  UGL_BURCC RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
  207::422     1e-29  35%  429 aa  HPAG_SALDU RecName: Full=4-hydroxyphenylacetate degradation
   13::200     4e-29  40%  214 aa  YO23_CAEEL RecName: Full=Uncharacterized protein ZK688.3;
  216::399     7e-29  39%  427 aa  HPCE_ECOLX RecName: Full=Homoprotocatechuate catabolism
  216::399     7e-29  39%  429 aa  HPAG_ECOLX RecName: Full=4-hydroxyphenylacetate degradation
   15::194     2e-28  40%  221 aa  FAHD1_BOVIN RecName: Full=Fumarylacetoacetate hydrolase
   15::221     2e-27  37%  221 aa  FAHD1_RAT RecName: Full=Fumarylacetoacetate hydrolase
   15::204     3e-27  40%  225 aa  Y1397_PYRAB RecName: Full=Uncharacterized protein PYRAB13970;
   18::224     3e-27  37%  224 aa  FAHD1_PONAB RecName: Full=Fumarylacetoacetate hydrolase
   21::227     4e-27  36%  227 aa  FAHD1_MOUSE RecName: Full=Fumarylacetoacetate hydrolase
   20::218     3e-26  38%  230 aa  Y643_PYRHO RecName: Full=Uncharacterized protein PH0643;
   18::224     3e-26  36%  224 aa  FAHD1_HUMAN RecName: Full=Fumarylacetoacetate hydrolase
   11::210     1e-23  36%  219 aa  YCGM_ECOLI RecName: Full=Uncharacterized protein ycgM;
    9::189     1e-18  35%  218 aa  FAHD1_DICDI RecName: Full=Fumarylacetoacetate hydrolase
   10::233     4e-14  34%  259 aa  FMP41_YEAST RecName: Full=Uncharacterized mitochondrial hydrolase
    7::183     6e-13  31%  221 aa  YOS9_SCHPO RecName: Full=Uncharacterized hydrolase C21C3.09c;      
    1::292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKLVQYLVNGGKRYGIMQEIGIIDLSQRLGDKYPTLKSLLCANALTDAALWCDEPADYYYQEVTFLPVID
FAHD2_XENLA     --------------------------------------------------------------ISLLAPIT
FAHD2_RAT       -------------------------------------------------------------QVTFLAPVT
FAHD2_BOVIN     -------------------------------------------------------------EVTFLAPVT
FAH2A_HUMAN     -------------------------------------------------------------EVTFLAPVT
FAH2B_HUMAN     -----------------------------------------------------------WSEVTFLAPVT
FAHD2_PONAB     -------------------------------------------------------------EVTFLAPVT
YISK_BACSU      ------------------------------------------------AEWAKKPNDYSLSEVKLHAPIP
FAHD2_MOUSE     -------------------------------------------------------------QVTFLAPVT
Y2225_ARCFU     --------------------------------------------------------------VKFLPPVV
UGL_BURS3       MKLLRYGPSGQEKPGILDADGRIDLSAHVPD--------LSGDVLSDAGL-----ARLRAIDPATLPLVS
UGL_BURCM       MKLLRYGPSGQEKPGILDANGRIDLSAHVPD--------LAGDALSDAGLTRLRAID----PATLPLVSG
UGL_BURCJ       MKLLRYGPPGQEKPGILDAAGRIDLSAHVPD--------LAGEVLSDAGL-----ARLRAIDPATLPLVS
UGL_BURA4       MKLLRYGPSGQEKPGILDADGRIDLSAHVPD--------LAGDVLSDAAL-----ARLRAIDPATLPLVS
Y973_STAAC      MKFLSFKYNDKTSYGVKREDAVWDLTQVFGDFHPTLLAGLQQNHTLDAAEDSGKAEDYKFNDIEFLPPVT
Y968_STAAM      MKFLSFKYNDKTSYGVKREDAVWDLTQVFGDFHPTLLAGLQQNHTLDAAEDSGKAEDYKFNDIEFLPPVT
Y906_STAA8      MKFLSFKYNDKTSYGVKREDAVWDLTQVFGDFHPTLLAGLQQNHTLDAAEDSGKAEDYKFNDIEFLPPVT
Y871_STAA3      MKFLSFKYNDKTSYGVKREDAVWDLTQVFGDFHPTLLAGLQQNHTLDAAEDSGKAEDYKFNDIEFLPPVT
Y850_STAAW      MKFLSFKYNDKTSYGVKREDAVWDLTQVFGDFHPTLLAGLQQNHTLDAAEDSGKAEDYKFNDIEFLPPVT
Y838_STAAS      MKFLSFKYNDKTSYGVKREDAVWDLTQVFGDFHPTLLAGLQQNHTLDAAEDSGKAEDYKFNDIEFLPPVT
Y837_STAAB      MKFLSFKYNDKTSYGVKREDAVWDLTQVFGDFHPTLLAGLQQNHTLDAAEDSGKAEDYKFNDIEFLPPVT
Y829_STAAN      MKFLSFKYNDKTSYGVKREDAVWDLTQVFGDFHPTLLAGLQQNHTLDAAEDSGKAEDYKFNDIEFLPPVT
Y930_STAAR      MKFLSFKYNDKTSYGVKREDAVWDLTQVFGDFHPTLLAGLQQNHTLDAAEDSGKAEDYKFNDIEFLPPVT
FAHD2_DICDI     IKLVTYIPNVGKRLGALLENSIIDLCSADKSIPNDMRSFLSLNS-TDKXXXXXXXXXXXXXENCKIKAPI
Y665_STAES      ----------------------------------------------------DEEFKLLFTDIDFLPPVT
Y556_STAEQ      ----------------------------------------------------DEEFKLLFTDIDFLPPVT
Y1806_STAS1     -----------------------------------------------------------FSDIEFLPPVT
Y1982_STAHJ     -----------------------------------------------------------FNDIEFLPPVT
UGL_BURM1       MKLLRYGPPGQEKPGILDADGRIDLSAHVPD--------LAGDVLSDAGL-----ARLRALDPATLPLVS
Y1656_METJA     ----------------------------------------------------------------------
UGL_BURCH       MKLLRYGPSGQEKPGILDAAGRIDLSAHVPD--------LAGDVLSDAGL-----ARLRAIDPATLPLVS
UGL_BURCA       MKLLRYGPSGQEKPGILDAAGRIDLSAHVPD--------LAGDVLSDAGL-----ARLRAIDPATLPLVS
UGL_BURCC       MKLLRYGPSGQEKPGILDSAGRIDLSAHVPD--------LAGDVLSDAGL-----ARLRAIDPATLPLVS
HPAG_SALDU      --------------------------------------------------------DEFARNQTFTWPLS
YO23_CAEEL      ----------------------------------------------------------------------
HPCE_ECOLX      ------------------------------------------------------------------PTLP
HPAG_ECOLX      ------------------------------------------------------------------PTLP
FAHD1_BOVIN     ----------------------------------------------------------------------
FAHD1_RAT       ----------------------------------------------------------------------
Y1397_PYRAB     ----------------------------------------------------------------------
FAHD1_PONAB     ----------------------------------------------------------------------
FAHD1_MOUSE     ----------------------------------------------------------------------
Y643_PYRHO      ----------------------------------------------------------------------
FAHD1_HUMAN     ----------------------------------------------------------------------
YCGM_ECOLI      -------------------------------------------------------------------LLD
FAHD1_DICDI     ----------------------------------------------------------------------
FMP41_YEAST     ----------------------------------------------------------------------
YOS9_SCHPO      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DPQKIICVGMNYADKRIEFNETNPAPTLFVRFADSQTGHNGLLLKPENTNEFDYEGELAVVIGRRCSRVS
FAHD2_XENLA     NPEKIICIGMNYVDHCLEQNVPVPKPIIFNKFASSIVGPSDPIRIPEESQEVDWEAELAFVIGKKGKNIK
FAHD2_RAT       RPDKVICVGLNYADHCQEQNVRVPKPIIFSKFSSSIVGPYDSIILPPESKEVDWEVEMAVVIGKKGKHIK
FAHD2_BOVIN     RPDKVVCVGMNYADHCREQNVPVPKPIIFSKFASAIVGPYDNIILPPESQEVDWEVELAVVIGKRGKYIK
FAH2A_HUMAN     RPDKVVCVGMNYVDHCKEQNVPVPKPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIK
FAH2B_HUMAN     WPDKVVCVGMNYVDHCKEQNVPVPKPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIK
FAHD2_PONAB     RPDKVVCVRMNYVDHCKEQNVPVPKPFIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIK
YISK_BACSU      KPSKIICIGKNYRDHAIEMGDIPEHPMVFTKSPVTVTGHGDIVKSHEETSQLDYEGELAVVIGKSGTRIS
FAHD2_MOUSE     RPEKVICVGLNYADHCQEQNRVXXXXXXXXXXXXXXVGPYDEIILPPESKEVDWEVEMAVVIGKKGKHIK
Y2225_ARCFU     -PSKIIAVGLNYIDHAEELNMPVPEPILFMKPSTAVIGHDDCIILPQISQRVDYEGELAVVIAEDCRNVP
UGL_BURS3       EPRKFIGIGLNYADHAAEAGMPVPKPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGATCKDVD
UGL_BURCM       EPRKFIGIGLNYADHAAEAGMPVPKPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGTTCKDVD
UGL_BURCJ       EPRKFIGIGLNYADHAAEAGMPVPKPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGAKCKDVD
UGL_BURA4       EPRKFIGIGLNYADHAAEAGMPVPKPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGTTCKDVD
Y973_STAAC      PPNNVIAFGRNYKDHANELNHEVEKLYVFTKAASSLTGDNATIPNHKDTDQLDYEGELGIVIGKSGEKIP
Y968_STAAM      PPNNVIAFGRNYKDHANELNHEVEKLYVFTKAASSLTGDNATIPNHKDTDQLDYEGELGIVIGKSGEKIP
Y906_STAA8      PPNNVIAFGRNYKDHANELNHEVEKLYVFTKAASSLTGDNATIPNHKDTDQLDYEGELGIVIGKSGEKIP
Y871_STAA3      PPNNVIAFGRNYKDHANELNHEVEKLYVFTKAASSLTGDNATIPNHKDTDQLDYEGELGIVIGKSGEKIP
Y850_STAAW      PPNNVIAFGRNYKDHANELNHEVEKLYVFTKAASSLTGDNATIPNHKDTDQLDYEGELGIVIGKSGEKIP
Y838_STAAS      PPNNVIAFGRNYKDHANELNHEVEKLYVFTKAASSLTGDNATIPNHKDTDQLDYEGELGIVIGKSGEKIP
Y837_STAAB      PPNNVIAFGRNYKDHANELNHEVEKLYVFTKAASSLTGDNATIPNHKDTDQLDYEGELGIVIGKSGEKIP
Y829_STAAN      PPNNVIAFGRNYKDHANELNHEVEKLYVFTKAASSLTGDNATIPNHKDTDQLDYEGELGIVIGKSGEKIP
Y930_STAAR      PPNNVIAFGRNYKDHANELNHEVERLYVFTKAASSLTGDNAKIPNHKDTDQLDYEGELGIVIGKSGEKIP
FAHD2_DICDI     EPGKIICIGLNYKEHANEAKMAIPKPIVFSKFDNAICGPNDSIIKPXXXXXXXXXXXXXXXIGKQAKNVS
Y665_STAES      PPNNVIAFGRNYEDHASELNHEVDSLYVFTKAASSLTGDEATIPNHKDTEQLDYEGELGIVIGKSGEKIP
Y556_STAEQ      PPNNVIAFGRNYEDHASELNHEVDSLYVFTKAASSLTGDEATIPNHKDTEQLDYEGELGIVIGKSGEKIP
Y1806_STAS1     PTNNVIAFGRNYQDHANELNHEVQRLYVFTKAASSLTGDNSTIPNHKDTDQLDYEGELGIVIGKSGEKIP
Y1982_STAHJ     PPNNVIAFGRNYQDHASELNHEVQRLYVFTKAASSLTGDESTIPNHKDTDQLDYEGELGIVIGKSGEKIP
UGL_BURM1       EPRKFIGIGLNYADHAAEAGMPVPKPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGAPCKDVD
Y1656_METJA     -PTKIICVGLNYIDHAKELNMEIPEPIIFLKPTSAIIYNEDYIIRPRISKRVDYEVELAIVIGKKCKNIK
UGL_BURCH       EPRKFIGIGLNYADHAAEAGMPVPKPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGAKCKDVD
UGL_BURCA       EPRKFIGIGLNYADHAAEAGMPVPKPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGAKCKDVD
UGL_BURCC       EPRKFIGIGLNYADHAAEAGMPVPKPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGAKCKDVD
HPAG_SALDU      ATGTLFALGLNYADHASELAFTPPKPLVFIKAPNTFTEHHQTSVRPNNVEYMHYEAELVVVIGKTARKVS
YO23_CAEEL      ---KIVCVGRNYKDHALELGNAIPKPMLFVKTVNSFIVEGEPIVAPPGCQNLHQEVELGVVISKKASRIS
HPCE_ECOLX      HPHTLFALGLNYADHASELEFKPPEPLVFLKAPNTLTGDNQTSVRPNNIEYMHYEAELVVVIGKQARNVS
HPAG_ECOLX      HPHTLFALGLNYADHASELEFKPPEPLVFLKAPNTLTGDNQTSVRPNNIEYMHYEAELVVVIGKQARNVS
FAHD1_BOVIN     --KNIVCVGRNYADHVREMQSAAPSPVLFLKPSTAYAPEGSPVLVPAYTRNLHHELELAVVMGKRCRAVS
FAHD1_RAT       --KNIVCVGRNYADHVKEMRSTVLSPVLFLKPSTAYAPEGSPVLMPAYCRNLHHEVELGVLLGRRGEAVP
Y1397_PYRAB     -PTKIIALAKNYAEHAREMGSEPPEPVIFLKPPSALIGPNSVIVLPRRSKRVDHEVELAVIIGKRAKNVP
FAHD1_PONAB     --KNIVCVGRNYADHVREMRSAVLSPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGRRCRAVP
FAHD1_MOUSE     --KNIVCVGRNYADHVKEMRSTVLSPVLFLKPSTAYAPEGSPVLMPAYCRNLHHEVELGVLLGKRGEAIP
Y643_PYRHO      -PTKIVALAKNYAEHAREMGSEPPEPIIFLKPPSALIGPGSSIILPRRSKRVDHEVELAVIMGKRAKNVP
FAHD1_HUMAN     --KNIVCVGRNYADHVREMRSAVLSPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVP
YCGM_ECOLI      YPSKVVCVGSNYAKHIKEMGSAVPEPVLFIKPETALCDLRQPLAIPSDFGSVHHEVELAVLIGATLRQAT
FAHD1_DICDI     --RKIVAVGRNYAQHAKELNEIPSEPFFFLKPTSSYLLQGGPIEIPLESSDIHHEVELGIVIGKKGRDID
FMP41_YEAST     --RKIICIGRNYAAHIKELNNSTPKPFFFLKPTSSNSTFNGL--NEDGTNKVHHEIELALIVSKHLSNVT
YOS9_SCHPO      ---KVVCIGRNYAAHIREXXXXXXXXXXXXXXXXSEPGHGNLIIPPDVSAH--YEVELGLIMKDRLPAVS


                         +         .         .         .         .         *         .:210
query           AEDALDYVAGYSCYMDGSVRDWQHSWFTAGKNWPSTGSFGPCLVTTDDIPDPQMLRLLTRLNGREVQNES
FAHD2_XENLA     EEDAMDHVVGYTVAHDVSARDWQKQWLL-GKTFDTFCPLGPALVTKDVISDPHNLGIRCRVNGDLVQNSN
FAHD2_RAT       ATDVMAYVAGFTVAHDVSARDWQKQWLL-GKTFDTFCPLGPALVTKDTIADPHNLKISCRVNGEIVQSSN
FAHD2_BOVIN     ATDAMAHVAGFTVAHDVSARDWQKQWLL-GKTFDTFCPLGPALVTKDSVADPHNLKICCRVNGELMQSSN
FAH2A_HUMAN     ATDAMAHVAGFTVAHDVSARDWQKQWLL-GKTFDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQSGN
FAH2B_HUMAN     ATDAMAHVAGFTVAHDVSARDWNGKQWLLGKTFDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQSSN
FAHD2_PONAB     ATDAMAHVAGFTVAHDVSARDWQKQWLL-GKTFDTFCPLGPALVTKDSVADPHNLKICCRVNGELVQSSN
YISK_BACSU      KEDAYDHVFGYTIVNDITARDLQHKQFFIGKSLDTTCPMGPVLVHKSSIQEPERLKVETRVNGELRQSGS
FAHD2_MOUSE     ATDVMAHVAGFTVAHDVSARDWQKQWLL-GKTFDTFCPLGPALVTKDTIADPHNLKICCRVNGEVVQSSN
Y2225_ARCFU     ETNAADYILGYTCFNDVTARDLQDGQWTRAKSFDTFAPLGPYIA---EIDDPSKLGIQTRVNGKVVQKSN
UGL_BURS3       EARALDYVAGYCVVNDVSEREWQGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQRLDLWLEIDGHRYQNGN
UGL_BURCM       EARALDYVAGYCVVNDVSEREWQGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQRLDLWLEVDGHRYQNGN
UGL_BURCJ       EARALDYVAGYCVVNDVSEREWQGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQRLDLWLEIDGHRYQNGN
UGL_BURA4       EARALDYVAGYCVVNDVSEREWQGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQRVDLWLEIDGHRYQNGN
Y973_STAAC      KALALDYVYGYTIINDITDRKAQSEQDQAFLSKSLTGGMGPYIVTKDELPLPENVNIVTKVNNEIRQDGN
Y968_STAAM      KALALDYVYGYTIINDITDRKAQSEQDQAFLSKSLTGGMGPYIVTKDELPLPENVNIVTKVNNEIRQDGN
Y906_STAA8      KALALDYVYGYTIINDITDRKAQSEQDQAFLSKSLTGGMGPYIVTKDELPLPENVNIVTKVNNEIRQDGN
Y871_STAA3      KALALDYVYGYTIINDITDRKAQSEQDQAFLSKSLTGGMGPYIVTKDELPLPENVNIVTKVNNEIRQDGN
Y850_STAAW      KALALDYVYGYTIINDITDRKAQSEQDQAFLSKSLTGGMGPYIVTKDELPLPENVNIVTKVNNEIRQDGN
Y838_STAAS      KALALDYVYGYTIINDITDRKAQSEQDQAFLSKSLTGGMGPYIVTKDELPLPENVNIVTKVNNEIRQDGN
Y837_STAAB      KALALDYVYGYTIINDITDRKAQSEQDQAFLSKSLTGGMGPYIVTKDELPLPENVNIVTKVNNEIRQDGN
Y829_STAAN      KALALDYVYGYTIINDITDRKAQSEQDQAFLSKSLTGGMGPYIVTKDELPLPENVNIVTKVNNEIRQDGN
Y930_STAAR      KALALDYVYGYTIINDITDRKAQSEQDQAFLSKSLTGGMGPYIVTKDELPLPENVNIVTKVNNEIRQDGN
FAHD2_DICDI     ESDALQYVAGYTVGNDVSARDWQNSQWLLGKTFDTFAPIGPSIVINPEVADPNNLSIKCTLNGQVVQNST
Y665_STAES      RGLALDYIYGYTIINDITDRTAQSSHDQAFLSKSLTGAMGPYIVTKDELPAPENVNIVTKVNNEIRQDGN
Y556_STAEQ      RGLALDYIYGYTIINDITDRTAQSSHDQAFLSKSLTGAMGPYIVTKDELPAPENVNIVTKVNNEIRQDGN
Y1806_STAS1     KGLALDYVYGYTIINDITDRKAQNAQDQAFLSKSLTGGVGPYIVTKDELPTPEDVNIVTKVNNDIRQDGN
Y1982_STAHJ     KALALDYIYGYTIINDITDRKAQNEQDQAFLSKSLTGGMGPYIVTKDELPTPENVNIVTKVNNDIRQDGN
UGL_BURM1       EARALDYVAGYCVVNDVSEREWQGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQSLDLWLEVDGHRYQNGN
Y1656_METJA     KDEANDYIMGYTILNDVTARDLQQGQWTRAKSFDTFCPIGPRIV--KDI-DPMNLNIECRVNGEIKQKSN
UGL_BURCH       EARALDYVAGYCVVNDVSEREWQGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQRLDLWLEIDGHRYQNGN
UGL_BURCA       EARALDYVAGYCVVNDVSEREWQGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQRLDLWLEIDGHRYQNGN
UGL_BURCC       EARALDYVAGYCVVNDVSEREWQGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQRLDLWLEIDGHRYQNGN
HPAG_SALDU      EAEAMEYVAGYTVCNDYAIRDYLENYYRPNKSRDGLTPIGPWIVDKEAVSDPHNLTLRTFVNGELRQEGT
YO23_CAEEL      KSDAMDYIGGYTVALDMTARDFQDEAKKAGAPWFLAKSFGSCFLPVSDIPNPHDVELFCKINGKDQQRCR
HPCE_ECOLX      EADAMDYVAGYTVCNDYAIRDYLENYYRPNLRVKSRDGLTPMLVPKEAIPDPHNLTLRTFVNGELRQQGT
HPAG_ECOLX      EADAMDYVAGYTVCNDYAIRDYLENYYRPNLRVKSRDGLTPMLVPKEAIPDPHNLTLRTFVNGELRQQGT
FAHD1_BOVIN     EAAAMDYVAGYALCLDMTARDVQDECKKKGLPWTLAKSFTSAFVPKEKIPDPHNLKLWLKVNGELRQEGE
FAHD1_RAT       EAAAMDYVAGYALCLDMTARDVQDECKKKGLPWTLAKSFTSAFVPKEKIPDPHALRLWLKVNGELRQEGK
Y1397_PYRAB     AEKAFDYILGYTILLDITARDLQYPW-TVSKGFDTFAPIGPRIVDKREL-DPSDLEIGLKVNGKVRQLGR
FAHD1_PONAB     EAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTAAFVPKEKIPDPHKLKLWLKVNGELRQEGE
FAHD1_MOUSE     EAAAMDYVAGYALCLDMTARDVQEECKKKGLPWTLAKSFTSAFVPKEKIPDPHALRLWLKVNGELRQEGK
Y643_PYRHO      ASKAFDYILGYTIILDITARDLQYPW-TISKGFDTFAPIGPRVVDSREL-DPSDLEIGLKVNGKIRQLGR
FAHD1_HUMAN     EAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTAAFVPKEKIPDPHKLKLWLKVNGELRQEGE
YCGM_ECOLI      EEHVRKAIAGYGVALDLTLRDVQGKMKKAGQPWEKAKAFDNSCPLSGFIPDPQNTTLSLSVNGEQRQQGT
FAHD1_DICDI     LKSAMDYVSGYTLALDMTSRDQQS--IAKAKSLPWTVSKGSGFIPKDKIKDLNNVELWCSVDGQIKQKGN
FMP41_YEAST     KEEVYDSISGVALALDLTARNVQDEAKKKGLPWTISKGFDTAIVSREKFSSQDIFRVKCSVNGQLRQDGG
YOS9_SCHPO      SNSWLDSIGAYFVGIDMTARNIQNEAKKKGLPWSFAKGYGP-IIPKHLIPDPHNVILELSLNGKVVQKDS


                         .         .         .         +         .         .         .:280
query           TANMIHPIASLIAYISTFTLLSPGDTILTGSPGGVGKKRVPPLFLHDGDVIEVEIEHIGTLRNVVRDSRY
FAHD2_XENLA     TNQMVFKTEALIAWASKFVTLNPGDVFLTGTPPGVGVFRKPPVFLKAGDVVRCEIDELGAISNPV-----
FAHD2_RAT       TNQMVFKTEDLIAWVSQFVTLYPGDILLTGTPPGVGMFRKPPVFLKKGDEVQCEIEELGVIINKV-----
FAHD2_BOVIN     TNQMVFKTEELITWVSQFVTLYPGDIILTGTPPGVGVFRKPPVFLKKGDEVQCEIEELGVIINKV-----
FAH2A_HUMAN     TNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPPGVGVFRKPPVFLKKGDEVQCEIEELGVIINKV-----
FAH2B_HUMAN     TNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPPGVGVFRKPPVFLKKGDEVQCEIEELGVIINKV-----
FAHD2_PONAB     TNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPPGVGVFRKPPVFLKKGDEVQCEIEELGVIINKV-----
YISK_BACSU      ASDMIFSIPELIETLSKGMTLEAGDIIATGTPSGVGKGFTPPKFLRSGDKIDITIDPIGTLSNQI-----
FAHD2_MOUSE     TNQMVFKTEYLIAWVSQFVTLYPGDLLLTGTPPGVGMFRKPPVFLKKGDEVQCEIEELGVIINKV-----
Y2225_ARCFU     TSNLIFDVFQLVSFVSSVMTLKAGDVIATGTPAGVG-------MLKDGDVVEVEIEKIGILRN-------
UGL_BURS3       TRTMVFTVAQLIAYLSSCMTLQPGDVITTGTPPGVGMGIKPPVFLKAGQMVRLGVEGLGEQLQHTRDAR-
UGL_BURCM       TRTMVFTVAQLVAYLSTCMTLQPGDVITTGTPPGVGMGIKPPVFLKAGQTVRLGIDGLGEQLQSTRNAR-
UGL_BURCJ       TRTMVFTVAQLIAYLSTCMTLQPGDVITTGTPPGVGMGIKPPVFLKAGQMVRLGIDGLG-----------
UGL_BURA4       TRTMVFTVAQLVAYLSTCMTLQPGDVITTGTPPGVGMGIKPPVFLKAGQTVRLGIDGLGEQLQSTRNAQ-
Y973_STAAC      TGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGTLTTYI-----
Y968_STAAM      TGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGTLTTYI-----
Y906_STAA8      TGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGTLTTYI-----
Y871_STAA3      TGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGTLTTYI-----
Y850_STAAW      TGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGTLTTYI-----
Y838_STAAS      TGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGTLTTYI-----
Y837_STAAB      TGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGTLTTYI-----
Y829_STAAN      TGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGTLTTYI-----
Y930_STAAR      TGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGTLTTYI-----
FAHD2_DICDI     TKEFIFNIQTVVSYLSKLFTLNPGDIIFTGTPSGVGFIRKPPIFLKSGDVIKCEIEELGSLVNNVK----
Y665_STAES      TGEMILKIDELIEKISKYVALHPGDIIATGTPAGVGAGLQPPQFLQPGDEVKVTIDNIGTLTTYI-----
Y556_STAEQ      TGEMILKIDELIEKISKYVALHPGDIIATGTPAGVGAGLQPPQFLQPGDEVKVTIDNIGTLTTYI-----
Y1806_STAS1     TGQMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMNPPQFLQPGDEIKVTIDNIGTLTNFIAD---
Y1982_STAHJ     TSQMINKIDDLIEEISKYVALHPGDIIATGTPAGVGAGLQPPQFLQPGDEVKVTIDNIGTLTTYI-----
UGL_BURM1       TRTMVFTVAQLIAYLSSCMTLQPGDVITTGTPPGVGMGIKPPVYLKAGQMV-------------------
Y1656_METJA     TKNMIFDVYELVEFVASIMTLYPGDIISTGTPPGVGE-------LKAGDVVECEIEGIGILRNYVKD---
UGL_BURCH       TRTMVFTVAQLVAYLSTMTLQXXXXXXXXXXXXXXXXXKPSPVFLKAGQTVRLGIEGLGEQLQRTRDAQ-
UGL_BURCA       TRTMVFTVAQLVAYLSTMTLQXXXXXXXXXXXXXXXXXKPSPVFLKAGQTVRLGIEGLGEQLQRTRDAQ-
UGL_BURCC       TRTMVFTVAQLVAYLSTMTLQXXXXXXXXXXXXXXXXXKPSPVFLKAGQTVRLGIEGLG-----------
HPAG_SALDU      TADLIFSIPFLISYLSEFMTLQPGDMIATGTPKGLSDV-VP------GDEVVLEIKGVGRLVNQI-----
YO23_CAEEL      TDVMIFDIPTLLEYTTQFFTLEVGDVVLTGTPAGVTK-------INSGDVIE------------------
HPCE_ECOLX      TADLIFSVPFLIAYLSEFMTLNPGDMIATGTPKGL-----------------------------------
HPAG_ECOLX      TADLIFSVPFLIAYLSEFMTLNPGDMIATGTPKGL-----------------------------------
FAHD1_BOVIN     TSSMIFSIPYIISYVSKIMTLEEGDIILTGTPKGVG----------------------------------
FAHD1_RAT       TSSMIFSIPYIISYVSKIITLEEGDLILTGTPKGVGA-------VKENDEIEAGIDGVVSMRFKVERSKY
Y1397_PYRAB     TSEMIFKIPELIEYISSIMTLEPGDIIATGTPPGVGP-------LRHGDKIE------------------
FAHD1_PONAB     TSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGP-------VKENDEIEAGIHGLVSMRFKVEKPEY
FAHD1_MOUSE     TSSMIFSIPYIISYVSKIITLEEGDLILTGTPKGVGP-------VKENDEIEAGIDGVVSMRFKVKRSEY
Y643_PYRHO      TSQMIFKIPELIEYISHIMTLEPGDIIATGTPPGVGP-------LRHGDRIEAWIEGIGKM---------
FAHD1_HUMAN     TSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGP-------VKENDEIEAGIHGLVSMTFKVEKPEY
YCGM_ECOLI      TADMIHKIVPLIAYMSKFFTLKAGDVVLTGTPDGVGP-------LQSGDELTVTFD--------------
FAHD1_DICDI     TNQMIFDVPHLIQYISSIMTLESGDLILTGTPSGVG----------------------------------
FMP41_YEAST     TNLMLHPLHKILQHISTMISLEPGDIILTGTPAGVGE-------LKPGDRVHCEL---------------
YOS9_SCHPO      TSLMLNKIPKIFSSITEAMSLNPGDLVLTGT---------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxx
FAHD2_XENLA     ------------
FAHD2_RAT       ------------
FAHD2_BOVIN     ------------
FAH2A_HUMAN     ------------
FAH2B_HUMAN     ------------
FAHD2_PONAB     ------------
YISK_BACSU      ------------
FAHD2_MOUSE     ------------
Y2225_ARCFU     ------------
UGL_BURS3       ------------
UGL_BURCM       ------------
UGL_BURCJ       ------------
UGL_BURA4       ------------
Y973_STAAC      ------------
Y968_STAAM      ------------
Y906_STAA8      ------------
Y871_STAA3      ------------
Y850_STAAW      ------------
Y838_STAAS      ------------
Y837_STAAB      ------------
Y829_STAAN      ------------
Y930_STAAR      ------------
FAHD2_DICDI     ------------
Y665_STAES      ------------
Y556_STAEQ      ------------
Y1806_STAS1     ------------
Y1982_STAHJ     ------------
UGL_BURM1       ------------
Y1656_METJA     ------------
UGL_BURCH       ------------
UGL_BURCA       ------------
UGL_BURCC       ------------
HPAG_SALDU      ------------
YO23_CAEEL      ------------
HPCE_ECOLX      ------------
HPAG_ECOLX      ------------
FAHD1_BOVIN     ------------
FAHD1_RAT       ------------
Y1397_PYRAB     ------------
FAHD1_PONAB     ------------
FAHD1_MOUSE     ------------
Y643_PYRHO      ------------
FAHD1_HUMAN     ------------
YCGM_ECOLI      ------------
FAHD1_DICDI     ------------
FMP41_YEAST     ------------
YOS9_SCHPO      ------------