[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF69516.1

[Show Plain Result]


## Summary of Sequence Search
    1::111
   19::94      7e-44 100%  111 aa  ARNE_SALSV RecName: Full=Probable
   19::94      7e-44 100%  111 aa  ARNE_SALPB RecName: Full=Probable
   19::94      7e-44 100%  111 aa  ARNE_SALHS RecName: Full=Probable
   19::94      3e-43  99%  111 aa  ARNE_SALTY RecName: Full=Probable
   19::94      3e-43  99%  111 aa  ARNE_SALNS RecName: Full=Probable
   19::94      3e-43  99%  111 aa  ARNE_SALG2 RecName: Full=Probable
   19::94      3e-43  99%  111 aa  ARNE_SALEP RecName: Full=Probable
   19::94      3e-43  99%  111 aa  ARNE_SALDC RecName: Full=Probable
   19::94      3e-43  99%  111 aa  ARNE_SALA4 RecName: Full=Probable
   19::94      6e-43  99%  111 aa  ARNE_SALPC RecName: Full=Probable
   19::94      6e-43  99%  111 aa  ARNE_SALCH RecName: Full=Probable
   19::94      1e-42  99%  111 aa  ARNE_SALTI RecName: Full=Probable
   19::94      1e-42  99%  111 aa  ARNE_SALPK RecName: Full=Probable
   19::94      1e-42  99%  111 aa  ARNE_SALPA RecName: Full=Probable
   19::94      5e-31  74%  111 aa  ARNE_SHIF8 RecName: Full=Probable
   19::89      1e-19  58%  107 aa  ARNE_ENT38 RecName: Full=Probable
   19::94      3e-19  54%  111 aa  ARNE_ESCF3 RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_SHISS RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_SHIFL RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_SHIBS RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_SHIB3 RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_ECOSM RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_ECOSE RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_ECOLU RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_ECOLI RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_ECOLC RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_ECOHS RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_ECODH RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_ECO8A RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_ECO7I RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_ECO5E RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_ECO57 RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_ECO55 RecName: Full=Probable
   19::94      1e-17  51%  111 aa  ARNE_ECO24 RecName: Full=Probable
   19::94      2e-17  50%  111 aa  ARNE_SHIDS RecName: Full=Probable
   19::94      6e-17  51%  111 aa  ARNE_ECOL6 RecName: Full=Probable
   19::94      6e-17  51%  111 aa  ARNE_ECO27 RecName: Full=Probable
   20::95      9e-17  49%  112 aa  ARNE_KLEP7 RecName: Full=Probable
   20::95      9e-17  49%  112 aa  ARNE_KLEP3 RecName: Full=Probable
   19::94      2e-16  50%  111 aa  ARNE_ECOUT RecName: Full=Probable
   19::94      2e-16  50%  111 aa  ARNE_ECOL5 RecName: Full=Probable
   19::94      2e-16  50%  111 aa  ARNE_ECOK1 RecName: Full=Probable
   19::94      2e-16  50%  111 aa  ARNE_ECO81 RecName: Full=Probable
   19::94      2e-16  50%  111 aa  ARNE_ECO45 RecName: Full=Probable
   19::90      1e-13  50%  108 aa  ARNE_ERWT9 RecName: Full=Probable
   19::96      2e-13  45%  113 aa  ARNE_PROMH RecName: Full=Probable
   20::96      2e-13  46%  113 aa  ARNE_PHOLL RecName: Full=Probable
   42::97      3e-11  41%  114 aa  ARNE_AERS4 RecName: Full=Probable
   19::93      3e-11  43%  111 aa  ARNE_SODGM RecName: Full=Probable
   42::97      1e-10  41%  114 aa  ARNE_AERHH RecName: Full=Probable
   41::97      5e-10  44%  114 aa  ARNE_PSE14 RecName: Full=Probable
   61::98      3e-08  61%  115 aa  ARNE_SERP5 RecName: Full=Probable
   62::97      4e-08  56%  114 aa  ARNE_PSEF5 RecName: Full=Probable
   68::98      6e-08  68%  115 aa  ARNE_PSEFS RecName: Full=Probable
   20::97      8e-08  39%  114 aa  ARNE_YERPY RecName: Full=Probable
   20::97      8e-08  39%  114 aa  ARNE_YERPS RecName: Full=Probable
   20::97      8e-08  39%  114 aa  ARNE_YERPP RecName: Full=Probable
   20::97      8e-08  39%  114 aa  ARNE_YERPN RecName: Full=Probable
   20::97      8e-08  39%  114 aa  ARNE_YERPG RecName: Full=Probable
   20::97      8e-08  39%  114 aa  ARNE_YERPE RecName: Full=Probable
   20::97      8e-08  39%  114 aa  ARNE_YERPB RecName: Full=Probable
   20::97      8e-08  39%  114 aa  ARNE_YERPA RecName: Full=Probable
   20::97      8e-08  39%  114 aa  ARNE_YERP3 RecName: Full=Probable
   56::91      1e-07  58%  108 aa  ARNE_PSEU2 RecName: Full=Probable
   55::94      5e-07  48%  130 aa  ARNF_ERWCT RecName: Full=Probable
   47::99      1e-06  36%  120 aa  ARNE_SHESH RecName: Full=Probable
   21::94      2e-06  34%  111 aa  ARNE_HAMD5 RecName: Full=Probable
   63::97      6e-06  60%  115 aa  ARNE_PSEAE RecName: Full=Probable
   63::97      6e-06  60%  115 aa  ARNE_PSEAB RecName: Full=Probable
   63::97      6e-06  60%  115 aa  ARNE_PSEA8 RecName: Full=Probable
   56::95      1e-05  45%  133 aa  ARNF_PROMH RecName: Full=Probable
   68::97      1e-05  60%  114 aa  ARNE_YERE8 RecName: Full=Probable
   63::97      2e-05  57%  115 aa  ARNE_PSEA7 RecName: Full=Probable
   42::97      2e-05  38%  114 aa  ARNE_PSEPF RecName: Full=Probable
   42::92      2e-04  39%  130 aa  ARNF_SERP5 RecName: Full=Probable
   47::92      2e-04  37%  126 aa  ARNF_PHOLL RecName: Full=Probable
   68::97      2e-04  53%  113 aa  ARNE_ERWCT RecName: Full=Probable
   53::92      3e-04  45%  130 aa  ARNF_SODGM RecName: Full=Probable
   72::110     3e-04  38%  147 aa  ARNF_AERHH RecName: Full=Probable
   49::92      7e-04  42%  128 aa  ARNF_YERE8 RecName: Full=Probable
   73::111     7e-04  38%  148 aa  ARNF_AERS4 RecName: Full=Probable
    1::111

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxCQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
ARNE_SALSV      ------------------CQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
ARNE_SALPB      ------------------CQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
ARNE_SALHS      ------------------CQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
ARNE_SALTY      ------------------CQKQATRPLTAGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
ARNE_SALNS      ------------------CQKQATRPLTAGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
ARNE_SALG2      ------------------CQKQATRPLTVGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
ARNE_SALEP      ------------------CQKQATRPLTVGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
ARNE_SALDC      ------------------CQKQATRPLTVGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
ARNE_SALA4      ------------------CQKQATRPLTAGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
ARNE_SALPC      ------------------CQKQATRPLTTGRRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
ARNE_SALCH      ------------------CQKQATRPLTTGRRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
ARNE_SALTI      ------------------CQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
ARNE_SALPK      ------------------CQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
ARNE_SALPA      ------------------CQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
ARNE_SHIF8      ------------------CQKQATCFVAINKRRKHIVLWLGLALACIGLAMMLWLLVLQNVPVGIAYPML
ARNE_ENT38      ------------------CQKQAAHTRA----RQRVWGWLALSLVLLGCAMLLWLFVLQTVPVSVAYPML
ARNE_ESCF3      ------------------CQKQATRPVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQTVPVGIAYPML
ARNE_SHISS      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_SHIFL      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_SHIBS      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_SHIB3      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECOSM      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECOSE      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECOLU      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECOLI      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECOLC      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECOHS      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECODH      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECO8A      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECO7I      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECO5E      ------------------CQKQATCFVAISKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECO57      ------------------CQKQATCFVAISKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECO55      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECO24      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_SHIDS      ------------------CQKQATCFVAINKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECOL6      ------------------CQKQATCFATVNKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECO27      ------------------CQKQATCFATVNKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_KLEP7      ------------------CQKQATXXXXXXXXXXHILFXXXXXXXXXXXXXXXXXSVLQSIPVSIAYPML
ARNE_KLEP3      ------------------CQKQATXXXXXXXXXXHILFXXXXXXXXXXXXXXXXXSVLQSIPVSIAYPML
ARNE_ECOUT      ------------------CQKQATCFAAVNKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECOL5      ------------------CQKQATCFAAVNKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECOK1      ------------------CQKQATCFAAVNKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECO81      ------------------CQKQATCFAAVNKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ECO45      ------------------CQKQATCFAAVNKRRKHIXXXXXXXXXXXXXXXXXXXXXXQNVPVGIAYPML
ARNE_ERWT9      ------------------CQKQAT---TVSXXXXXXXXXXXXXXXXXXMAMLVWLRVLQTVPVGVAYPML
ARNE_PROMH      ------------------CQKQAVVSWQNNSKARKTIFWLITAIAMLGFGMLFWLRLLQILPLSIAYPML
ARNE_PHOLL      ------------------CQKQAVMCWRSDVYQRASALWLIGAVILLAVGMLFWLRLLQILPLGIAYPML
ARNE_AERS4      --------------------------------------WLIASVVALGSGMLLWIYLLQRLPLSMAYPML
ARNE_SODGM      ------------------CQKHAAGASSGAGELRHRVRWXXXXXXXXXXXXXXXXXXXQRVPVGIAYPMF
ARNE_AERHH      --------------------------------------WLIASVAALGCGMLLWIYLLQRLPLSMAYPML
ARNE_PSE14      -------------------------------------MWLWLAIACXXXXXXXXXXXXQRMDVGIAYPML
ARNE_SERP5      --------------------------------------------------------VLQRLPLSLAYPTL
ARNE_PSEF5      ----------------------------------------------------------QRMEVGVAYPML
ARNE_PSEFS      ---------------------------------------------------------------GIAYPML
ARNE_YERPY      ------------------CQKQAAQCWEQPARRLNLTLWLAIAVVSXXXXXXXXXXXXXXXXXSVAYPML
ARNE_YERPS      ------------------CQKQAAQCWEQPARRLNLTLWLAIAVVSXXXXXXXXXXXXXXXXXSVAYPML
ARNE_YERPP      ------------------CQKQAAQCWEQPARRLNLTLWLAIAVVSXXXXXXXXXXXXXXXXXSVAYPML
ARNE_YERPN      ------------------CQKQAAQCWEQPARRLNLTLWLAIAVVSXXXXXXXXXXXXXXXXXSVAYPML
ARNE_YERPG      ------------------CQKQAAQCWEQPARRLNLTLWLAIAVVSXXXXXXXXXXXXXXXXXSVAYPML
ARNE_YERPE      ------------------CQKQAAQCWEQPARRLNLTLWLAIAVVSXXXXXXXXXXXXXXXXXSVAYPML
ARNE_YERPB      ------------------CQKQAAQCWEQPARRLNLTLWLAIAVVSXXXXXXXXXXXXXXXXXSVAYPML
ARNE_YERPA      ------------------CQKQAAQCWEQPARRLNLTLWLAIAVVSXXXXXXXXXXXXXXXXXSVAYPML
ARNE_YERP3      ------------------CQKQAAQCWEQPARRLNLTLWLAIAVVSXXXXXXXXXXXXXXXXXSVAYPML
ARNE_PSEU2      ----------------------------------------------------------QRLDVGIAYPML
ARNF_ERWCT      -----------------------------------------VGIICYGLSMVCWFMVLRYLPLSRAYPLI
ARNE_SHESH      -----------------------------------------LSVFFLGVGAMTWLGVLSVWDVSMAYPLL
ARNE_HAMD5      -------------------QKQATHSWKENAKRQTL-IWLGLSVIFXXXXXXXXXXXXXXXXXSQAYPFL
ARNE_PSEAE      ----------------------------------------------------------QRVEVGSAYPML
ARNE_PSEAB      ----------------------------------------------------------QRVEVGSAYPML
ARNE_PSEA8      ----------------------------------------------------------QRVEVGSAYPML
ARNF_PROMH      -----------------------------------------VGLIGYVLSMVCWLLTLRTIPLNKAYPLI
ARNE_YERE8      ----------------------------------------------------------------VAYPIL
ARNE_PSEA7      ----------------------------------------------------------QRVEVGSAYPML
ARNE_PSEPF      --------------------------------------WLWLAXXXXXXXXXXXXXXXXXXXXSVAYPML
ARNF_SERP5      -----------------------------------MQYWLPLVVVSGGISMLCWFFALHHLPLNRAYPLL
ARNF_PHOLL      ---------------------------------RHSLVAVMAGLAGYLLSMLCWLFTLKYLPLNKAYPLI
ARNE_ERWCT      ----------------------------------------------------------------VAYPLL
ARNF_SODGM      -----------------------------------------LAYVC---SMGCWFMALRRLPLNKAYPLL
ARNF_AERHH      ---------------------------------------------CYALSLLCWLAALHSTPLNIAYPLL
ARNF_YERE8      -----------------------------------------IAVICYALSMLCWFFALRYLPLNRAYPLL
ARNF_AERS4      ---------------------------------------------CYALSLLCWLAALHFTPLNIAYPLL


                         .         .         *         .         .         .         .:140
query           SLNFVWVTLAAWKIWHEQVPPRHWxxxxxxxxxxxxxxxxx
ARNE_SALSV      SLNFVWVTLAAWKIWHEQVPPRHW-----------------
ARNE_SALPB      SLNFVWVTLAAWKIWHEQVPPRHW-----------------
ARNE_SALHS      SLNFVWVTLAAWKIWHEQVPPRHW-----------------
ARNE_SALTY      SLNFVWVTLAAWKIWHEQVPPRHW-----------------
ARNE_SALNS      SLNFVWVTLAAWKIWHEQVPPRHW-----------------
ARNE_SALG2      SLNFVWVTLAAWKIWHEQVPPRHW-----------------
ARNE_SALEP      SLNFVWVTLAAWKIWHEQVPPRHW-----------------
ARNE_SALDC      SLNFVWVTLAAWKIWHEQVPPRHW-----------------
ARNE_SALA4      SLNFVWVTLAAWKIWHEQVPPRHW-----------------
ARNE_SALPC      SLNFVWVTLAAWKIWHEQVPPRHW-----------------
ARNE_SALCH      SLNFVWVTLAAWKIWHEQVPPRHW-----------------
ARNE_SALTI      SLNFVWVTLAAWKIWHEQVLPRHW-----------------
ARNE_SALPK      SLNFVWVTLAAWKIWHEQVLPRHW-----------------
ARNE_SALPA      SLNFVWVTLAAWKIWHEQVLPRHW-----------------
ARNE_SHIF8      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_ENT38      SLNFIFITLAARFIWHEPIALRH------------------
ARNE_ESCF3      SLNFVWVTLAATKLWHEPVSFRHW-----------------
ARNE_SHISS      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_SHIFL      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_SHIBS      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_SHIB3      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_ECOSM      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_ECOSE      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_ECOLU      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_ECOLI      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_ECOLC      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_ECOHS      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_ECODH      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_ECO8A      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_ECO7I      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_ECO5E      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_ECO57      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_ECO55      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_ECO24      SLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_SHIDS      NLNFVWVTLAAVKLWHEPVSPRHW-----------------
ARNE_ECOL6      SLNFVWVTLAAVKLWHEPVSLRHW-----------------
ARNE_ECO27      SLNFVWVTLAAVKLWHEPVSLRHW-----------------
ARNE_KLEP7      SLNFVWVTLAGWGIWHEPVARRHW-----------------
ARNE_KLEP3      SLNFVWVTLAGWGIWHEPVARRHW-----------------
ARNE_ECOUT      SLNFVWVTLAAVKLWHEPVSLRHW-----------------
ARNE_ECOL5      SLNFVWVTLAAVKLWHEPVSLRHW-----------------
ARNE_ECOK1      SLNFVWVTLAAVKLWHEPVSLRHW-----------------
ARNE_ECO81      SLNFVWVTLAAVKLWHEPVSLRHW-----------------
ARNE_ECO45      SLNFVWVTLAAVKLWHEPVSLRHW-----------------
ARNE_ERWT9      SLNFIFVTLAARWLWRETLSLRH------------------
ARNE_PROMH      SINFIVVTLIGQFIYKETVNVKHW-----------------
ARNE_PHOLL      SINFIMVTLAGKFFYQEKAGIKHW-----------------
ARNE_AERS4      SINLVLVLIGSRLFFHEQISYHNW-----------------
ARNE_SODGM      SLNFVLVTLAARWLWREPVSLRH------------------
ARNE_AERHH      SINLVLVLVGSRLFFHEQISYHNW-----------------
ARNE_PSE14      GLNFVLITLVGRYVFKEPVDPQHW-----------------
ARNE_SERP5      SLNFVLVTLAARWLFNEPTTARHW-----------------
ARNE_PSEF5      SLNFVFITLIAHFVFREHIDRRHW-----------------
ARNE_PSEFS      SLNFVLVTLVARFVFHEPIDARHW-----------------
ARNE_YERPY      SFNFVLVTLAAQLFYGEKATLRHW-----------------
ARNE_YERPS      SFNFVLVTLAAQLFYGEKATLRHW-----------------
ARNE_YERPP      SFNFVLVTLAAQLFYGEKATLRHW-----------------
ARNE_YERPN      SFNFVLVTLAAQLFYGEKATLRHW-----------------
ARNE_YERPG      SFNFVLVTLAAQLFYGEKATLRHW-----------------
ARNE_YERPE      SFNFVLVTLAAQLFYGEKATLRHW-----------------
ARNE_YERPB      SFNFVLVTLAAQLFYGEKATLRHW-----------------
ARNE_YERPA      SFNFVLVTLAAQLFYGEKATLRHW-----------------
ARNE_YERP3      SFNFVLVTLAAQLFYGEKATLRHW-----------------
ARNE_PSEU2      GVNFVLITLAGRYVFNEPVDVRHW-----------------
ARNF_ERWCT      SLSYAVVYLAA------------------------------
ARNE_SHESH      SINFVIMLLLSHYVFNEPISVRQW-----------------
ARNE_HAMD5      SINLILVTLSGHFFFKEKVTLQHW-----------------
ARNE_PSEAE      ALNFVLVTLAARFVFDEPVDRRH------------------
ARNE_PSEAB      ALNFVLVTLAARFVFDEPVDRRH------------------
ARNE_PSEA8      ALNFVLVTLAARFVFDEPVDRRH------------------
ARNF_PROMH      SLSYVFVYILA------------------------------
ARNE_YERE8      SFNFVLVTLAAQFFYGEQATSRHW-----------------
ARNE_PSEA7      ALNFVLVTLVARFVFDEPVDRRH------------------
ARNE_PSEPF      SLNFVIITLIARFVFKEPVDVQHW-----------------
ARNF_SERP5      SVSYALVYLAA------------------------------
ARNF_PHOLL      SLSYVFVYL--------------------------------
ARNE_ERWCT      SINFVLVTLLAHYGFGERVDRHHW-----------------
ARNF_SODGM      SLSYVLVAACALMI---------------------------
ARNF_AERHH      STSYALVYLLAVNI---------------------------
ARNF_YERE8      SLSYALVYLGA------------------------------
ARNF_AERS4      STSYALVYLLAVSI---------------------------