[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF69590.1

[Show Plain Result]


## Summary of Sequence Search
    1::419
    1::419       0.0 100%  419 aa  GLPB_SALTY RecName: Full=Anaerobic glycerol-3-phosphate
    1::419       0.0 100%  419 aa  GLPB_SALPK RecName: Full=Anaerobic glycerol-3-phosphate
    1::419       0.0 100%  419 aa  GLPB_SALPA RecName: Full=Anaerobic glycerol-3-phosphate
    1::419       0.0 100%  419 aa  GLPB_SALNS RecName: Full=Anaerobic glycerol-3-phosphate
    1::419       0.0 100%  419 aa  GLPB_SALHS RecName: Full=Anaerobic glycerol-3-phosphate
    1::419       0.0 100%  419 aa  GLPB_SALG2 RecName: Full=Anaerobic glycerol-3-phosphate
    1::419       0.0 100%  419 aa  GLPB_SALEP RecName: Full=Anaerobic glycerol-3-phosphate
    1::419       0.0 100%  419 aa  GLPB_SALA4 RecName: Full=Anaerobic glycerol-3-phosphate
    1::419       0.0 100%  419 aa  GLPB_SALCH RecName: Full=Anaerobic glycerol-3-phosphate
    1::419       0.0 100%  419 aa  GLPB_SALSV RecName: Full=Anaerobic glycerol-3-phosphate
    1::419       0.0 100%  419 aa  GLPB_SALPB RecName: Full=Anaerobic glycerol-3-phosphate
    1::419       0.0  99%  419 aa  GLPB_SALDC RecName: Full=Anaerobic glycerol-3-phosphate
    1::419       0.0  99%  419 aa  GLPB_SALTI RecName: Full=Anaerobic glycerol-3-phosphate
    1::419       0.0  97%  419 aa  GLPB_SALAR RecName: Full=Anaerobic glycerol-3-phosphate
    1::419       0.0  84%  419 aa  GLPB_CITK8 RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-172  76%  419 aa  GLPB_ECOUT RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-172  76%  419 aa  GLPB_ECOL5 RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-172  76%  419 aa  GLPB_ECOK1 RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-172  76%  419 aa  GLPB_ECO45 RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-172  76%  419 aa  GLPB_ECO81 RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-171  76%  419 aa  GLPB_ECO27 RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-171  76%  419 aa  GLPB_ECOL6 RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-171  76%  419 aa  GLPB_SHIF8 RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-171  76%  419 aa  GLPB_ECOLU RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-171  76%  419 aa  GLPB_ECOSM RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-171  76%  419 aa  GLPB_SHISS RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-171  76%  419 aa  GLPB_SHIB3 RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-171  76%  419 aa  GLPB_ECOSE RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-171  76%  419 aa  GLPB_ECOHS RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-171  76%  419 aa  GLPB_ECO8A RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-171  76%  419 aa  GLPB_ECO55 RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-171  76%  419 aa  GLPB_ESCF3 RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-170  76%  419 aa  GLPB_ECO24 RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-170  75%  419 aa  GLPB_SHIFL RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-170  76%  419 aa  GLPB_ECOLI RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-170  76%  419 aa  GLPB_ECOLC RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-170  76%  419 aa  GLPB_ECODH RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-170  76%  419 aa  GLPB_ECOBW RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-170  75%  419 aa  GLPB_ECO7I RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-169  75%  419 aa  GLPB_ECO5E RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-169  75%  419 aa  GLPB_ECO57 RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-169  78%  419 aa  GLPB_SHIBS RecName: Full=Anaerobic glycerol-3-phosphate
    1::405     e-168  75%  419 aa  GLPB_SHIDS RecName: Full=Anaerobic glycerol-3-phosphate
    1::419     e-147  63%  419 aa  GLPB_ENT38 RecName: Full=Anaerobic glycerol-3-phosphate
   27::416     e-115  56%  419 aa  GLPB_KLEP7 RecName: Full=Anaerobic glycerol-3-phosphate
    1::418     e-114  56%  419 aa  GLPB_KLEP3 RecName: Full=Anaerobic glycerol-3-phosphate
    1::414     2e-92  44%  420 aa  GLPB_PECCP RecName: Full=Anaerobic glycerol-3-phosphate
    1::414     6e-90  47%  420 aa  GLPB_ERWCT RecName: Full=Anaerobic glycerol-3-phosphate
   28::416     4e-89  45%  424 aa  GLPB_YERE8 RecName: Full=Anaerobic glycerol-3-phosphate
   28::416     6e-85  44%  424 aa  GLPB_YERPN RecName: Full=Anaerobic glycerol-3-phosphate
   28::416     6e-85  44%  424 aa  GLPB_YERPE RecName: Full=Anaerobic glycerol-3-phosphate
   28::416     6e-85  44%  424 aa  GLPB_YERPA RecName: Full=Anaerobic glycerol-3-phosphate
   28::416     2e-84  43%  424 aa  GLPB_YERPS RecName: Full=Anaerobic glycerol-3-phosphate
    1::424     3e-78  40%  428 aa  GLPB_ACTPJ RecName: Full=Anaerobic glycerol-3-phosphate
    1::424     3e-78  40%  428 aa  GLPB_ACTP7 RecName: Full=Anaerobic glycerol-3-phosphate
    1::424     3e-78  40%  428 aa  GLPB_ACTP2 RecName: Full=Anaerobic glycerol-3-phosphate
    1::424     3e-72  39%  428 aa  GLPB_PASMU RecName: Full=Anaerobic glycerol-3-phosphate
    1::429     1e-71  39%  430 aa  GLPB_ACTSZ RecName: Full=Anaerobic glycerol-3-phosphate
    1::423     3e-71  37%  442 aa  GLPB_PHOPR RecName: Full=Anaerobic glycerol-3-phosphate
   28::422     1e-70  39%  436 aa  GLPB_VIBCH RecName: Full=Anaerobic glycerol-3-phosphate
    1::424     1e-70  38%  431 aa  GLPB_MANSM RecName: Full=Anaerobic glycerol-3-phosphate
   28::422     1e-69  39%  436 aa  GLPB_VIBC3 RecName: Full=Anaerobic glycerol-3-phosphate
   28::422     2e-69  39%  436 aa  GLPB_VIBCM RecName: Full=Anaerobic glycerol-3-phosphate
    3::429     1e-66  36%  434 aa  GLPB_HAES2 RecName: Full=Anaerobic glycerol-3-phosphate
    1::427     2e-66  36%  432 aa  GLPB_HAES1 RecName: Full=Anaerobic glycerol-3-phosphate
    1::411     6e-66  36%  427 aa  GLPB_HAEPS RecName: Full=Anaerobic glycerol-3-phosphate
   28::419     7e-65  40%  438 aa  GLPB_VIBVY RecName: Full=Anaerobic glycerol-3-phosphate
   28::419     7e-65  40%  438 aa  GLPB_VIBVU RecName: Full=Anaerobic glycerol-3-phosphate
    1::422     2e-64  37%  426 aa  GLPB_HAEDU RecName: Full=Anaerobic glycerol-3-phosphate
    1::437     3e-63  35%  455 aa  GLPB_VIBFM RecName: Full=Anaerobic glycerol-3-phosphate
    1::437     1e-62  35%  455 aa  GLPB_VIBF1 RecName: Full=Anaerobic glycerol-3-phosphate
    1::429     7e-60  35%  432 aa  GLPB_HAEIN RecName: Full=Anaerobic glycerol-3-phosphate
    1::429     3e-59  35%  432 aa  GLPB_HAEI8 RecName: Full=Anaerobic glycerol-3-phosphate
    1::429     2e-58  35%  432 aa  GLPB_HAEIG RecName: Full=Anaerobic glycerol-3-phosphate
    1::429     4e-58  35%  432 aa  GLPB_HAEIE RecName: Full=Anaerobic glycerol-3-phosphate
    1::419

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFDTVIMXXXXXXXXXXXXXXXXXXRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDITAGLDALCRQ
GLPB_SALTY      MKFDTVIMXXXXXXXXXXXXXXXXXXRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDITAGLDALCRQ
GLPB_SALPK      MKFDTVIMXXXXXXXXXXXXXXXXXXRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDITAGLDALCRQ
GLPB_SALPA      MKFDTVIMXXXXXXXXXXXXXXXXXXRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDITAGLDALCRQ
GLPB_SALNS      MKFDTVIMXXXXXXXXXXXXXXXXXXRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDITAGLDALCRQ
GLPB_SALHS      MKFDTVIMXXXXXXXXXXXXXXXXXXRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDITAGLDALCRQ
GLPB_SALG2      MKFDTVIMXXXXXXXXXXXXXXXXXXRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDITAGLDALCRQ
GLPB_SALEP      MKFDTVIMXXXXXXXXXXXXXXXXXXRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDITAGLDALCRQ
GLPB_SALA4      MKFDTVIMXXXXXXXXXXXXXXXXXXRCAIVTRGQSALHFSSGSLDLLSTLPDGQPVTDITAGLDALCRQ
GLPB_SALCH      MKFDTVIMXXXXXXXXXXXXXXXXXXRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDITAGLDALCRQ
GLPB_SALSV      MKFDTVIMXXXXXXXXXXXXXXXXXXRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDITAGLDALRRQ
GLPB_SALPB      MKFDTVIMXXXXXXXXXXXXXXXXXXRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDITAGLDALRRQ
GLPB_SALDC      MKFDTVIMXXXXXXXXXXXXXXXXXXRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDITAGLDALRRQ
GLPB_SALTI      MKFDTVIMXXXXXXXXXXXXXXXXXXRCAIVTRGQSALHFSSGSLDLLSALPNGQPVTDITAGLDALRRQ
GLPB_SALAR      MKFDTVIMXXXXXXXXXXXXXXXXXXRCAIVTRGQSALHFSSGSLDMLSALPDGQPVTEITAGLDTLCRQ
GLPB_CITK8      MKFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSTLPDGQPVTNITEGLNALREQ
GLPB_ECOUT      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_ECOL5      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTEIHSGLESLRQQ
GLPB_ECOK1      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_ECO45      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_ECO81      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_ECO27      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_ECOL6      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_SHIF8      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVADIHSGLESLRQQ
GLPB_ECOLU      MRFDTVIMXXXXXXXXXXXXXQKHGLRCTIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_ECOSM      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_SHISS      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_SHIB3      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVADIHSGLESLRQQ
GLPB_ECOSE      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_ECOHS      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVADIHSGLESLRQQ
GLPB_ECO8A      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_ECO55      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_ESCF3      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQAVTDIHSGLESLRQQ
GLPB_ECO24      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_SHIFL      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVADIHSGLESLRQQ
GLPB_ECOLI      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_ECOLC      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_ECODH      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_ECOBW      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_ECO7I      MRFDTVIMXXXXXXXXXXXXXQKHDLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVTDIHSGLESLRQQ
GLPB_ECO5E      MRFDTIIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQAVTDIHSGLESLRQQ
GLPB_ECO57      MRFDTIIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQAVTDIHSGLESLRQQ
GLPB_SHIBS      MRFDTVIMXXXXXXXXXXXXXQKHGLRCAIVTRGQSALHFSSGSLDLLSHLPDGQPVADIHSGLESLRQQ
GLPB_SHIDS      MRFDTVIMXXXXXXXXXXXXXQKHGLRSAIVTRGQSALHFSSGSLDLLSHLPDGQAVTDIHSGLESLRQQ
GLPB_ENT38      MKFDTVXXXXXXXXXXXXXKLTQRGLRCAIVSRGQSALHFSSGSLDLLGALPDGSAVDTPLMALQNPDAL
GLPB_KLEP7      --------------------------RSVIISRGQXXXXXXXXXXXXXXXXPNGDHVTDVAQGLQQLAEQ
GLPB_KLEP3      MKFDCAIVXXXXXXXXXXXXXNQYGLRSVIISRGQXXXXXXXXXXXXXXXXPNGDKVTDVAQGLQQLAEQ
GLPB_PECCP      MRYDVVIIGGGLAGLTCGIRLAEQGKRCAIVSAGQNALHFSSGALDLLSHLPDGQPVSQPLEALDELARQ
GLPB_ERWCT      MRYDVVIIGGGLAGLTCGIRLAEQGKRCAIVSAGQNALHFSSGALDLLSHLPDGQPVSQPLDALDELARQ
GLPB_YERE8      ---------------------------CAIVSAGQNALHFSSGSLDLLAKLPNGQAVSQPLSALETLAEL
GLPB_YERPN      ---------------------------CAIVSSGQNALHFSSGSLDLLAKLPDGQAVSQXXXXXXXXXXX
GLPB_YERPE      ---------------------------CAIVSSGQNALHFSSGSLDLLAKLPDGQAVSQXXXXXXXXXXX
GLPB_YERPA      ---------------------------CAIVSSGQNALHFSSGSLDLLAKLPDGQAVSQXXXXXXXXXXX
GLPB_YERPS      ---------------------------CAIVSAGQNALHFSSGSLDLLAKLPDGRAVSQXXXXXXXXXXX
GLPB_ACTPJ      MNFDVVIIGGGLAGLTCGIALQEQGKRCVIINNGQAAIDFSSGSMDLLSRLPSGQKVENVYQSLDELKLQ
GLPB_ACTP7      MNFDVVIIGGGLAGLTCGIALQEQGKRCVIINNGQAAIDFSSGSMDLLSRLPSGQKVENVYQSLDELKLQ
GLPB_ACTP2      MNFDVVIIGGGLAGLTCGIALQEQGKRCVIINNGQAAIDFSSGSMDLLSRLPSGQKVENVYQSLDELKLQ
GLPB_PASMU      MNFDVVIIGGGLAGLTCGIALQTQGKQCVIINNGQAAIDFSSGSLDLLGQLPSGRQIQHFEQNYTALYQQ
GLPB_ACTSZ      MNFDVVIIGGGLAGLTCGIALQEQGKRCAIVNNGQAAMDFSTGSIDLLGRLPNGENVQKVDRALAGLSEQ
GLPB_PHOPR      MKFDSLIIGGGVAGLSCAIRCAEAGMKTAVIAAGQSALHFSSGSIDFLSRLPNGQPVYHPMAAFNELQQQ
GLPB_VIBCH      --------------------------KVVLINQGQSALHFSSGSIDVLGRLPDGSVVNQPFDALSALQQQ
GLPB_MANSM      MNFDVVIIGAGIAGLTCGLTLQEKGVRCAIINNGQAALDFSSGSMDLLSRLPNGSTVDSFAQSYAALAQQ
GLPB_VIBC3      --------------------------KVVLINQGQSALHFSSGSIDVLGRLPDGSVVNQPFDALSALQQQ
GLPB_VIBCM      --------------------------KVVLINQGQSALHFSSGSIDVLGRLPDGSVVNQPFDALSALQQQ
GLPB_HAES2      MKFDVVIIGGGLAGLTCGIMLQQKGKCCAIINNGQSAMNFSSGSMDLLSQLPNGEKINSFEQGYDSLEEQ
GLPB_HAES1      MKFDVVIIGGGLAGLTCGIMLQQKGKCCAIINNGQSAMNFSSGSMDLLSQLPNGEKINSFEQGYDSLEEQ
GLPB_HAEPS      MNFDVVIIGGGLAGLTCGVALQEQGKRCVIINNGQAAIDFSSGSMDLLSRLPSGEFVADFYKSYATFAKQ
GLPB_VIBVY      --------------------------KTVLISQGQSALHFSSGSIDVMAKTPSGERVEAPFSAMASLPQQ
GLPB_VIBVU      --------------------------KTVLISQGQSALHFSSGSIDVMAKTPSGERVEAPFSAMASLPQQ
GLPB_HAEDU      MNFDVVIIGGGLAGLTCGIALQKQGKQCAIINNGQAAIDFSSGSMDLLSCLPSGQKVHVFCEAFSELSQQ
GLPB_VIBFM      MNFDTIIIGGGMAGLSCALRCLEAGLKTAVIASGQSALHFSSGSIDVLAKTPSGEPVSNPMTCIDTFAKE
GLPB_VIBF1      MNFDTIIIGGGMAGLSCALRCLEAGLKTAVIASGQSALHFSSGSIDVLAKTPSGKHVINPMDSLETFSKE
GLPB_HAEIN      MNFDVAIIGGGLAGLTCAIALQQRGKRCVIINNGQAAIDFASGSLDLLSRMPENRAVENLKENITALRNE
GLPB_HAEI8      MNFDVAIIGGGLAGLTCGIALQQCGKRCVIINNGQAAIDFASGSLDLLSRMPENRAVENLKENITALRNE
GLPB_HAEIG      MNFDVAIIGGGLAGLTCGIAIQQRGKRCVIINNGQAAIDFASGSLDLLSRMPESRTVENLKENITALRNE
GLPB_HAEIE      MNFDVAIIGGGLAGLTCGIALQQRGKRCVIINNGQAAIDFASGSLDLLSRMPENRAVENLKENITALRNE


                         .         .         *         .         .         .         .:140
query           APEHPYSRLGXXXXXXXXXXXXXXXXXSGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
GLPB_SALTY      APEHPYSRLGXXXXXXXXXXXXXXXXXSGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
GLPB_SALPK      APEHPYSRLGXXXXXXXXXXXXXXXXXSGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
GLPB_SALPA      APEHPYSRLGXXXXXXXXXXXXXXXXXSGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
GLPB_SALNS      APEHPYSRLGXXXXXXXXXXXXXXXXXSGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
GLPB_SALHS      APEHPYSRLGXXXXXXXXXXXXXXXXXSGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
GLPB_SALG2      APEHPYSRLGXXXXXXXXXXXXXXXXXSGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
GLPB_SALEP      APEHPYSRLGXXXXXXXXXXXXXXXXXSGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
GLPB_SALA4      APEHPYSRLGXXXXXXXXXXXXXXXXXSGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
GLPB_SALCH      APEHPYSRLGXXXXXXXXXXXXXXXXXSGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
GLPB_SALSV      APEHPYSRLGXXXXXXXXXXXXXXXXXSGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
GLPB_SALPB      APEHPYSRLGXXXXXXXXXXXXXXXXXSGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
GLPB_SALDC      APEHPYSRLGXXXXXXXXXXXXXXXXXSGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
GLPB_SALTI      APEHPYSRLGXXXXXXXXXXXXXXXXXSGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
GLPB_SALAR      APEHPYSRLGXXXXXXXXXXXXXXXXXSGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLFAQRIC
GLPB_CITK8      APTHPYTTIGASAVXXXXXXXXXXXXXSGAHLQGDVQQSHQRVTPLGTLRATWLSSPEVPVWPLAAQRIC
GLPB_ECOUT      APAHPYTLLGPQRVLDLACQAQALIAESGAQLQGSVELAHQRITPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ECOL5      APAHPYTLLGPQRVLDLACQAQALIAESGAQLQGSVELAHQRITPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ECOK1      APAHPYTLLGPQRVLDLACQAQALIAESGAQLQGSVELAHQRITPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ECO45      APAHPYTLLGPQRVLDLACQAQALIAESGAQLQGSVELAHQRITPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ECO81      APAHPYTLLGPQRVLDLACQAQALIAESGAQLQGSVELAHQRITPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ECO27      APAHPYTLLGPQRVLDLACQAQALIAESGAQLQGSVELAHQRITPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ECOL6      APAHPYTLLGPQRVLDLACQAQALIAESGAQLQGSVELAHQRITPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_SHIF8      APAHPYSLLGPQRVLDLACQAQALIAESGAQLQGSVELAHQRITPLGTLRATWLSSPEVPVWPLPAKKIC
GLPB_ECOLU      APAHPYSVLGPQRVLDLACQAQALIAESGAQLQGSVELAHQRITPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ECOSM      APAHPYTLLGPQRVLDLACQAQALIAESGAQLQGSVELAHQRVTPLGTLRSTWLSAPEVPVWPLPAKKIC
GLPB_SHISS      APAHPYSLLEPQRVLDLACQAQALIAESGAQLQGSVELAHQRVTPLGTLRATWLSSPEVPVWPLPAKKIC
GLPB_SHIB3      APAHPYSLLGPQRVLDLACQAQALIAESGAQLQGSVELAHQRITPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ECOSE      APAHPYSLLEPQRVLDLACQAQALIAESGAQLQGSVELAHQRVTPLGTLRATWLSSPEVPVWPLPAKKIC
GLPB_ECOHS      APAHPYSLLGPQRVLDLACQAQALIAESGAQLQGSVELAHQRITPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ECO8A      APAHPYSLLEPQRVLDLACQAQALIAESGAQLQGSVELAHQRVTPLGTLRATWLSSPEVPVWPLPAKKIC
GLPB_ECO55      APAHPYSLLEPQRVLDLACQAQALIAESGAQLQGSVELAHQRVTPLGTLRATWLSSPEVPVWPLPAKKIC
GLPB_ESCF3      APAHPYSLLGPQRVLDLACQAQTLIAESGAQLQGSVEQAHQRITPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ECO24      APAHPYSLLEPQRVLDLACQAQALIAESGAQLQGSVELAHQRVTPLGTLRATWLSSPEVPVWPLPVKKIC
GLPB_SHIFL      APAHPYSLLGPQRVLDLACQAQALIAESGAQLQGSVELAHQRITPLGTLRATWLSSPEVPVWPLPAKKIC
GLPB_ECOLI      APAHPYSLLEPQRVLDLACQAQALIAESGAQLQGSVELAHQRVTPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ECOLC      APAHPYSLLEPQRVLDLACQAQALIAESGAQLQGSVELAHQRVTPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ECODH      APAHPYSLLEPQRVLDLACQAQALIAESGAQLQGSVELAHQRVTPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ECOBW      APAHPYSLLEPQRVLDLACQAQALIAESGAQLQGSVELAHQRVTPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ECO7I      APAHPYTLLGPQRVLDLACQAQALIAESGAQLQGSVELAHQRVTPLGTLRSTWLSAPEVPVWPLPAKKIC
GLPB_ECO5E      APAHPYSLLGPQRVLDLACQAQALIAESGAQLQGSVELPHQRITPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ECO57      APAHPYSLLGPQRVLDLACQAQALIAESGAQLQGSVELPHQRITPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_SHIBS      APAHPYSLLGPQRVLDLACQAQALIAESGAQLQGSVELAHQRITPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_SHIDS      APAHPYSLLGPQRVLDLACQAQALIAKSGAQLQGSVELPHQRITPLGTLRSTWLSSPEVPVWPLPAKKIC
GLPB_ENT38      PAEHPYRLVGTDNIARLADETETLLATCGPRLRGHARQNHQRVTPLGMLRPAWLSPEEVPVAPIQSQRVC
GLPB_KLEP7      LPEHPYSRLGAEAVLKYATQTEALLAACGAVMQGDARRPHRRVTPLGTLRPAWLSPLEVPVAPLPSQGAC
GLPB_KLEP3      LPEHPYSRLGAGAVLEYATQTEALLAACGANMQGEARQPHLRVTPLGTLRPAWLSPEEVLLAPFAQQHVC
GLPB_PECCP      APHHPYSRMGAAAVAALLPQVEALLERSTISLLGSYQQNHWRMTPLGKFRACWLSPVDGVTRGLPDSRFL
GLPB_ERWCT      APHHPYSRMGAAAVAALLPQVEALLERSNISLLGNHQQNHWRMTPLGKFRACWLSPADGVTRGLADSHFL
GLPB_YERE8      APEHPYSKMGQTGQVGELAQQAESLLSRGLSLVGSAAKNHLRLTPLGNCRPTWLSPADIPVAPLEGQKVA
GLPB_YERPN      XXXHPYSKMNITQLDELVQEAEALLRRCGLDIVGSSAENHLRLTPLGSCRPTWLSLADIPVAPLNGQRVA
GLPB_YERPE      XXXHPYSKMNITQLDELVQEAEALLRRCGLDIVGSSAENHLRLTPLGSCRPTWLSLADIPVAPLNGQRVA
GLPB_YERPA      XXXHPYSKMNITQLDELVQEAEALLRRCGLDIVGSSAENHLRLTPLGSCRPTWLSLADIPVAPLNGQRVA
GLPB_YERPS      XXXHPYSKMNITQLDELVQEAEALLRRCGLDIVGSSAENHLRLTPLGSCRPTWLSLADIPVAPLNGQRVA
GLPB_ACTPJ      APEHPYSILGKDQVLAKAQQFEQLAQSLNLHLEGSTVQNHERITPLGGLRATWLSPNSVPLTALADKQVA
GLPB_ACTP7      APEHPYSILGKDQVLAKAQQFEQLAQSLNLHLEGSTVQNHERITPLGGLRATWLSPNSVPLTALADKQVA
GLPB_ACTP2      APEHPYSILGKDQVLAKAQQFEQLAQSLNLHLEGSTVQNHERITPLGGLRATWLSPNSVPLTALADKQVA
GLPB_PASMU      AAQHPYALVGKDKVIEKARQFEQLAQTLNLGLVGTCDKNHFRVTPLGGLRPTWLSPNSVPIVTFPHRKIA
GLPB_ACTSZ      LPAHPYAKLGAERVLAKAKQFEGMAAKLNLGLAGSVEQNHARVTPLGGLRRTWLSPDSVPVRPNEANNIV
GLPB_PHOPR      SPEHPYCKLGKRKVQEALDWYQEMIKARGIYLSSQEDEAHLRLTPMGTFRSTWLSQQTVHQFPLTLNHIA
GLPB_VIBCH      APEHPYSKVGRKNSEKGLMWFKRTLDSAHVPLHHEPDGAHWRITPLGTLKNTWLSQPFVYPYRGNADRIM
GLPB_MANSM      SPNHPYVILGKDVVLDKIQQFETLAKSLNLSLVGSSDKNHKRVTALGGLRGTWLSPNSVPTVSLEGKNIV
GLPB_VIBC3      VPEHPYSKVGRKNSEKGLMWFKRTLDSAHVPLHHEPDGAHWRITPLGTLKNTWLSQPFVYPYRGNADRIV
GLPB_VIBCM      VPEHPYSKVGRKNSEKGLMWFKRTLDSAHVPLHHEPDGAHWRITPLGTLKNTWLSQPFVYPYRGNADRIM
GLPB_HAES2      LPNHPYCLFGKQHVLQKAKQFEQLIEKINLNVTGSYKQNHFRVTPLGGLHRTWLSADCIPTMDLGYQKIT
GLPB_HAES1      LPNHPYCLFGKQHVLQKAKQFEQLIEKINLNVTGSYKQNHFRVTPLGGLHRTWLSADCIPTMDLGYQKIT
GLPB_HAEPS      LPQHPYSLLGKEKVLAKATQFEQLATSLKLDLVGSTAQNHLRVTPLGGLRGAWLSPNSVPTVPFPHKTIA
GLPB_VIBVY      HPEHPYSKMSPNFVRQSLYWLVDQLKEQGLPLHCQQDESHHRITPLGTLKATWLSQPFVYQHRVAFKRLL
GLPB_VIBVU      HPEHPYSKMLPNFVRQSLYWLVDQLKEQGLPLHCQQDESHYRITPLGTLKATWLSQPFVYQHRVAFKRLL
GLPB_HAEDU      APEHPYCLLGQHQVVAKVQQFEQFMQELG--LVGSHKQNHLRVTPLGGLRHTWLSPKSVPVIAENERQIA
GLPB_VIBFM      YPNHPYATLGKETVERAIDWYRNTLSTIGVPLTSQNNGLHYRLTPLGAMKSTWLSQPFVHQFPMDTQKMV
GLPB_VIBF1      YPSHPYAALGKETVERAINWYKTTLSAIGVPLTSQKDGLHYRLTPLGTMKSTWLSQPFVHQFPMDTQKMV
GLPB_HAEIN      LPAHPYSLLGAEKVLAKAQDFERLANELHLDLIGSTEKNHWRVTGLGSLRGAWLSPNSVPTVPFPHKRIA
GLPB_HAEI8      LPAHPYSLLGAEKVLAKAQDFERLANELNLDLIGSTEKNHWRVTGLGSLRGAWLSPNSVPTVPFPHKRIA
GLPB_HAEIG      LPAHPYSLLGAEKVLAKAQDFERLANELHLDLIGSTEKNHWRVTGLGSLRGAWLSPNSVPTVQFPHKRIA
GLPB_HAEIE      LPAHPYSLLGAEKVLAKAQDFERLANELHLDLIGSTEKNHWRVTGLGSLRGAWLSPNSVPTVQFPHKRIA


                         +         .         .         .         .         *         .:210
query           VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
GLPB_SALTY      VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
GLPB_SALPK      VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
GLPB_SALPA      VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
GLPB_SALNS      VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
GLPB_SALHS      VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
GLPB_SALG2      VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
GLPB_SALEP      VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
GLPB_SALA4      VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
GLPB_SALCH      VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
GLPB_SALSV      VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
GLPB_SALPB      VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
GLPB_SALDC      VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
GLPB_SALTI      VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWQLLYDALSP
GLPB_SALAR      VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDILRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
GLPB_CITK8      VVGISGLLDFQAHLAAASLRQHHLTVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLHDALLP
GLPB_ECOUT      VVGISGLMDFQAHLAAASLRELDLAVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLIIDALIP
GLPB_ECOL5      VVGISGLMDFQAHLAAASLRELDLKVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ECOK1      VVGISGLMDFQAHLAAASLRELDLAVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLIIDALIP
GLPB_ECO45      VVGISGLMDFQAHLAAASLRELDLAVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLIIDALIP
GLPB_ECO81      VVGISGLMDFQAHLAAASLRELDLKVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ECO27      VVGISGLMDFQAHLAAASLRELDLKVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ECOL6      VVGISGLMDFQAHLAAASLRELDLAVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLIIDALIP
GLPB_SHIF8      VVGISGLMDFQAHLAAASLRELDLSVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ECOLU      VVGISGLMDFQAHLAAASLRELDLKVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWSLLLDALIP
GLPB_ECOSM      VVGISGLMDFQAHLAAASLRELDLAVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_SHISS      VVGISGLMDFQAHLAAASLRELDLSVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_SHIB3      VVGISGLMDFQAHLAAASLRELDLSVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ECOSE      VVGISGLMDFQAHLAAASLRELDLSVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ECOHS      VVGISGLMDFQAHLAAASLRELDLSVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ECO8A      VVGISGLMDFQAHLAAASLRELDLSVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ECO55      VVGISGLMDFQAHLAAASLRELDLSVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ESCF3      VVGISGLMDFQAHLAAASLRELDLSVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWSLLLDALIP
GLPB_ECO24      VVGISGLMDFQAHLAAASLRELDLSVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_SHIFL      VVGISGLMDFQAHLAAASLRELDLSVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ECOLI      VVGISGLMDFQAHLAAASLRELGLAVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ECOLC      VVGISGLMDFQAHLAAASLRELGLAVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ECODH      VVGISGLMDFQAHLAAASLRELGLAVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ECOBW      VVGISGLMDFQAHLAAASLRELGLAVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ECO7I      VVGISGLMDFQAHLAAASLRELDLAVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ECO5E      VVGISGLMDFQAHLAAASLRELDLAVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ECO57      VVGISGLMDFQAHLAAASLRELDLAVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_SHIBS      VVGISGLMDFQAHLAAASLHELDLSVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_SHIDS      VVGISGLMDFQAHLAAASLRELDLAVETAEIELPELDVLRNNATEFRAVNIARFLDNEENWPLLLDALIP
GLPB_ENT38      VVGISGFLDFQAHLAAASLRNQGISADTAEIELPELDVLRDNASEFRAVNIARFLDNDDKWPLLFDALQP
GLPB_KLEP7      LVGISGFADFQPHLAAAALGQHGVTAAAVEIELPLLDVLRDNPTEFRAANIARVLDDENMWXXXXXXXXX
GLPB_KLEP3      LVGISGFADFQPHLAAAALGQHGVTAAAVEIELPLLDVLRDNPTEFRAANIARVLDDENXXXXXXXXXXX
GLPB_PECCP      IAGIEGFLDFQSRIVAGTLQAQGIAARSDDLKLPVLDRLRQNPSEFRAVNIARVLDRPENRAALVEELSL
GLPB_ERWCT      IAGIEGFLDFQSRIVAGTLQTQGIAARSDELKLPVLDRLRQNPSEFRAVNIARLLDRPENRSALVEELSL
GLPB_YERE8      VIGIEGFLDFQPQMVASALQEQGVEVTSDYLHLPALDRLRDNPSEFRAVNIARVLDLPENLQPLADELAR
GLPB_YERPN      VIGIEGFLDFQPQMVASALQDQGIDATADYLHLPALDRLRDNPSEFRAVNIARILDLPENRQPLADELSR
GLPB_YERPE      VIGIEGFLDFQPQMVASALQDQGIDATADYLHLPALDRLRDNPSEFRAVNIARILDLPENRQPLADELSR
GLPB_YERPA      VIGIEGFLDFQPQMVASALQDQGIDATADYLHLPALDRLRDNPSEFRAVNIARILDLPENRQPLADELSR
GLPB_YERPS      VIGIEGFLDFQPQMVASALQDQGIDATADYLHLPALDRLRDNPSEFRAVNIARILDLPENRQPLADELSR
GLPB_ACTPJ      ILGIEGYHDFQPQLLADNLKQHDYEFTIGYLNIPELDYLRQNSREFRSVNIAQLLEHKLSFQDLVQEIKQ
GLPB_ACTP7      ILGIEGYHDFQPQLLADNLKQHDYEFTIGYLNIPELDYLRQNSREFRSVNIAQLLEHKLSFQDLVQEIKQ
GLPB_ACTP2      ILGIEGYHDFQPQLLADNLKQHDYEFTIGYLNIPELDYLRQNSREFRSVNIAQLLEHKLSFQDLVQEIKQ
GLPB_PASMU      VLGIEGYHDFQPQLLAENLVQHHCEVTTGYLNIPELDHLRHQSREFRSVNIAQLLEHKLAFSDLVREIRE
GLPB_ACTSZ      ILGIEGYHDFQPQLLADNLKLQPCEIKPGFLTIPELDFLRRQSREFRSVHIAQTLEQKVNPASLINEIRQ
GLPB_PHOPR      LVTVDGFRDFQPKLAADNLSKKDVKITTAAVELPDFEEMQRNPCEFRSIDISRVLRDERKLHAFAKSMIQ
GLPB_VIBCH      IVAIDGYRDFQPAMLRDNLAQRNTPMLTVNVSIPGFEGFRRNPNELRSIDIARLLRQESAWNALCDQLMR
GLPB_MANSM      LLGIEGYHDFQPQLLADNLKQNPCEITTNFLHIPELDHLRQNSREFRSVNIAQVLEYKLSFNNLVDEIKQ
GLPB_VIBC3      IVAIDGYRDFQPAMLRDNLAQRNTPMLTVNVSIPGFEGFRRNPNELRSIDIARLLRQESAWNALCDQLMR
GLPB_VIBCM      IVAIDGYRDFQPAMLRDNLAQRNTPMLTVNVSIPGFEGFRRNPNELRSIDIARLLRQESAWNALCDQLMR
GLPB_HAES2      VLGIEGYHDFQPHLLAENLIQHPCSITTALLHLPELDQLRLTSREFRSVNISQLLEHRLAFRELVQEIKQ
GLPB_HAES1      VLGIEGYHDFQPHLLAENLIQHHCSITTALLHLPELDQLRLTSREFRSVNISQLLEHRLAFRELVQEIKQ
GLPB_HAEPS      ILGIEGYHDFQPQLLADNLKQNPCELSTGYLNIPELDQLRNNAREFRSVNIAQVLEHKLAFRDLVAEIKT
GLPB_VIBVY      FVAVDGYRDFQPLLAKDNLKKQHCEIGEIQVTIPGCEALRRNPNELRSIDIARLLKQPQAFNSLCHQLMK
GLPB_VIBVU      FVAVDGYRDFQPLLAKDNLKKQHCEIGEIQVTIPGCEALRRNPNELRSIDIARLLKQPQAFNSLCHQLMK
GLPB_HAEDU      ILGIEGYHDFQPQILVDNLKQNHCDFSIGYLNIPELDYLRQNAREFRSVNIAQLLEHKLAFEDLVQEIKQ
GLPB_VIBFM      LITIDGFRDFQPKLAQDNLKQSDLEITTANISLSAFNDIQRNHCELRSIDLSRLLSKRANRQELAYALQQ
GLPB_VIBF1      LITIDGFRDFQPKLAQDNLKQSDLEIATASISLSAFNDIQRNHCELRSIDISRLLSKRANRQELAYALQQ
GLPB_HAEIN      VLGIEGYHDFQPQLLAANLQFEHCEVTSGFLNIPQLDELRKNAREFRSVNISQLLEHKLAFKDLVKEIIE
GLPB_HAEI8      VLGIEGYHDFQPQLLAANLQFEHCEVTSGFLNIPQLDELRKNAREFRSVNISQLLEHKLAFNDLVKEIIE
GLPB_HAEIG      VLGIEGYHDFQPQLLAANLQFEHCEVTSGFLNIPQLDELRKNAREFRSVNISQLLEHKLAFKDLVKEIIE
GLPB_HAEIE      VLGIEGYHDFQPQLLAANLQFEYCEVTSGFLNIPQLDELRKNAREFRSVNISQLLEHKLAFKDLVKEIIE


                         .         .         .         +         .         .         .:280
query           IATNCDMIIMPACFGLANDTLWRWLNERXXXXXXXXXXXXXSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
GLPB_SALTY      IATNCDMIIMPACFGLANDTLWRWLNERXXXXXXXXXXXXXSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
GLPB_SALPK      IATNCDMIIMPACFGLANDTLWRWLNERXXXXXXXXXXXXXSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
GLPB_SALPA      IATNCDMIIMPACFGLANDTLWRWLNERXXXXXXXXXXXXXSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
GLPB_SALNS      IATNCDMIIMPACFGLANDTLWRWLNERXXXXXXXXXXXXXSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
GLPB_SALHS      IATNCDMIIMPACFGLANDTLWRWLNERXXXXXXXXXXXXXSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
GLPB_SALG2      IATNCDMIIMPACFGLANDTLWRWLNERXXXXXXXXXXXXXSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
GLPB_SALEP      IATNCDMIIMPACFGLANDTLWRWLNERXXXXXXXXXXXXXSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
GLPB_SALA4      IATNCDMIIMPACFGLANDTLWRWLNERXXXXXXXXXXXXXSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
GLPB_SALCH      IATNCDMIIMPACFGLANDTLWRWLNERXXXXXXXXXXXXXSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
GLPB_SALSV      IATNCDMIIMPACFGLANDTLWRWLNERXXXXXXXXXXXXXSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
GLPB_SALPB      IATNCDMIIMPACFGLANDTLWRWLNERXXXXXXXXXXXXXSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
GLPB_SALDC      IATNCDMIIMPACFGLANDTLWRWLNERXXXXXXXXXXXXXSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
GLPB_SALTI      IATNCDMIIMPACFGLANDTLWRWLNERXXXXXXXXXXXXXSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
GLPB_SALAR      MATNCDMIIMPACFGLANDTLWRWLNERLSCAXXXXXXXXXSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
GLPB_CITK8      IAKTCDMIIMPACFGLADDSLWRWLNERLPCSLNLLPTLPPSVPGIRLHNRLQRQFVRQGGIWMPGDEVK
GLPB_ECOUT      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECOL5      VANTCEMILMPACFGLANDKLWHWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECOK1      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECO45      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECO81      VANTCEMILMPACFGLADDKLWHWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECO27      VANTCEMILMPACFGLADDKLWHWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECOL6      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_SHIF8      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLAPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECOLU      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECOSM      VANTCEMILMPACFGLADDKLWHWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_SHISS      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_SHIB3      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECOSE      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECOHS      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVHQGGVWMPGDEVK
GLPB_ECO8A      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECO55      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ESCF3      VANTCEMILMPACFGLADDKLWYWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECO24      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_SHIFL      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECOLI      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECOLC      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECODH      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECOBW      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECO7I      VANTCEMILMPACFGLADGKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECO5E      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ECO57      VANTCEMILMPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_SHIBS      VANTCEMILMPACFGLADDKLWRWLNEKXXXXXXXXXXXXXXXXGIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_SHIDS      VANTCEMILIPACFGLADDKLWRWLNEKLPCSLMLLPTLPPSVLSIRLQNQLQRQFVRQGGVWMPGDEVK
GLPB_ENT38      LSQGCDALYMPACFGLADNRLWRWLSDRLACALYLLPTLPPSVPGIRLHNQLQRQFIAQGGVWMAGDEVK
GLPB_KLEP7      XXQQYDLLIMPACFGLADDRLYHWLQARXXXXXXXXXXXXXSVPGMRLHSQLQRQFIREGGAWLAGDEVV
GLPB_KLEP3      XXXXXXXXIMPACFGLADDRLYRWLQXXXXXXXXXXXXXXXSVPGMRLHSQLQRQFIREGGTWLAGDEVV
GLPB_PECCP      LANGNDAIIMPACLGLDSPEVVGELAEALGKPISLLPTLPPSVLGLRLHQALSQRFRQLGGMVMPGDRAV
GLPB_ERWCT      LANGNDAIIMPACLGLDSPEIVSELADAXXXXXXXXXXXXXXXXXXRLHQALSQRFRQLGGMVMPGDRAV
GLPB_YERE8      LSSTAEMILLPACIGLDESAPLEALRAAVGKPIQLLPTLPPSLLGMRLHQALRHRFQQLGGIVMPGDAVL
GLPB_YERPN      LSSTAEMILLPACIGLDKSAPLDALRAVVGKPIQLLPTLPPSLLGMRLHQALRHRFQQLGGLVMPGDAVL
GLPB_YERPE      LSSTAEMILLPACIGLDKSAPLDALRAVVGKPIQLLPTLPPSLLGMRLHQALRHRFQQLGGLVMPGDAVL
GLPB_YERPA      LSSTAEMILLPACIGLDKSAPLDALRAVVGKPIQLLPTLPPSLLGMRLHQALRHRFQQLGGLVMPGDAVL
GLPB_YERPS      LSSTAEMILLPACIGLDKSAPLDALRAVVGKPIQLLPTLPPSLLGMRLHQALRHRFQQLGGLVMPGDAVL
GLPB_ACTPJ      AAGNAKAVFLPACFGLDNQDFFNSLQQATGLALFELPTLPPSLLGIRQHRQLRSRFEQLGGMMMNGDRAV
GLPB_ACTP7      AAGNAKAVFLPACFGLDNQDFFNSLQQATGLALFELPTLPPSLLGIRQHRQLRSRFEQLGGMMMNGDRAV
GLPB_ACTP2      AAGNAKAVFLPACFGLDNQDFFNSLQQATGLALFELPTLPPSLLGIRQHRQLRSRFEQLGGMMMNGDRAV
GLPB_PASMU      AVNGASAVFLPACFGLETQEFFSALKQATQLELFELPTLPPSLLGMRQHKQLTQHFKQLGGLMMNGDKVI
GLPB_ACTSZ      AASGADVVFLPACFGQNSQAFFNELQAATDFMLFELPTLPPSLLGGRQHNILRQYFERLGGVMMNGDRAL
GLPB_PHOPR      AVGKADLVVLPAVFGNGDGAATKLLEGLTGFTICELPTMPPSLLGIRLEEAMKSHFKMLGGIILVGDEVQ
GLPB_VIBCH      VARPDDLVIMPAIMGNGDGLLMSKLQQVTQLRFHEVPTMPPSLLGIRIEEALHRSFIQGGGVQLKGDKVI
GLPB_MANSM      AVGNAKAAFLPACFGLDDQSFFESLKQATGIELYELPTLPPSLLGIRQHRQLRHRFEKLGGVMFNGDRAL
GLPB_VIBC3      VARPDDLVIMPAIMGNGDGLLMTKLQQVTQLRFHEVPTMPPSLLGIRIEEALHRSFIQGGGVQLKGDKVI
GLPB_VIBCM      VARPDDLVIMPAIMGNGDGLLMSKLQQVTQLRFHEVPTMPPSLLGIRIEEALHRSFIQGGGVQLKGDKVI
GLPB_HAES2      ASGDGEAIFLPACFGLDNQDFFNKLTLETGLNLYELPTLPPSLVGLRQHKKLKTYFEKLGGFILNGDKAL
GLPB_HAES1      ASGDGEAIFLPACFGLDNQDFFNKLTLETGLNLYELPTLPPSLVGLRQHKKLKTYFEKLGGFILNGDKAL
GLPB_HAEPS      ATKGAEAIFLPACFGLDDQSFFNQLQQAVEATIFELPTLPPSLLGIRQHKQLRHRFERLGGLMLNGDRAL
GLPB_VIBVY      HATQEDLVIMPAIMGNGDGXXXXXXXXXXXXXXXHEVPTMPSLLGIRIEEALQKRFLKQGGVLLKGDQVL
GLPB_VIBVU      HATQEDLVIMPAIMGNGDGXXXXXXXXXXXXXXXHEVPTMPSLLGIRIEEALQKRFLKQGGVLLKGDQVL
GLPB_HAEDU      AAGNAQAVFLLACFGLDDQRFFDSLKQATALALFELPTLPPSLIGIRQYRTLRDQFEKLGGLLLNGDRAV
GLPB_VIBFM      HAQPGDLVVIPSIFGNGTGTYLKEIEQLTKLTLCEVPTMPPSLLGIRLEESMKHAFIELGGTMLNGDHVV
GLPB_VIBF1      HANPGDLVVLPSIFGNGTGLSYREIEQLTKLTLCEVPTMPPSLLGIRLEESMKHAFIELGGTMLNGDHVV
GLPB_HAEIN      SAQGAEAVFLPACFGLENQEFMTALRDATKLALFELPTLPPSLLGMRQRIQLRHKFESLGGLMINGDSAL
GLPB_HAEI8      SAQGAEAVFLPACFGLENQEFMTALRDATKLALFELPTLPPSLLGMRQRIQLRHKFESLGGLMINGDSAL
GLPB_HAEIG      SSQGAEAVFLPACFGLENQEFMTALRDATKLALFELPTLPPSLLGMRQRIQLRHKFESLGGLMINGDSAL
GLPB_HAEIE      SSQGAEAVFLPACFGLENQEFMTALRDATKLALFELPTLPPSLLGMRQRIQLRHKFESLGGLMINGDSAL


                         .         *         .         .         .         .         +:350
query           KVTCRRGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
GLPB_SALTY      KVTCRRGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
GLPB_SALPK      KVTCRRGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
GLPB_SALPA      KVTCRRGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
GLPB_SALNS      KVTCRRGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
GLPB_SALHS      KVTCRRGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
GLPB_SALG2      KVTCRRGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
GLPB_SALEP      KVTCRRGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
GLPB_SALA4      KVTCRRGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
GLPB_SALCH      KVTCRHGIVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
GLPB_SALSV      KVTCRRGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
GLPB_SALPB      KVTCRHGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
GLPB_SALDC      KVTCRHGIVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
GLPB_SALTI      KVTCRRGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
GLPB_SALAR      KVTCRHGIVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQNFF
GLPB_CITK8      KVTCRNGVVSEVWTRNHADIPLRPRFAVLASGSFFSSGLVAERDGIREPIMGLDVQQTATRAEWYQRDFF
GLPB_ECOUT      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERDGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECOL5      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERDGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECOK1      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERDGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECO45      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERDGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECO81      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERDGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECO27      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECOL6      KVTCKNGVVNEIWTRNHADIPLRPRFVVLASGSFFSGGLVAERDGIREPILGLDVLQTATRGEWYKGDFF
GLPB_SHIF8      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECOLU      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERDGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECOSM      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_SHISS      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_SHIB3      KVTCKNGVVNEIWTRNHADIPLRPHFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECOSE      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECOHS      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECO8A      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECO55      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ESCF3      KVTCKNGMVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAEREGIREPIVGLDVLQTATRGEWYKGDFF
GLPB_ECO24      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_SHIFL      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIRETILGLDVLQTATRGEWYKGDFF
GLPB_ECOLI      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECOLC      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECODH      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECOBW      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECO7I      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERDGILEPILGLDVLQTATRSEWYKGDFF
GLPB_ECO5E      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_ECO57      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_SHIBS      KVTCKNGVVNEIWTRNHADIPLRPHFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKGDFF
GLPB_SHIDS      KVTCKNGVVNEIWTRNHADIPLRPRFAVLASGSFFSGGLVAERNGIREPILGLDVLQTATRGEWYKEDFF
GLPB_ENT38      KVTLDNGVVSALWTRNHGDIPLRPRFVVLASGSFFSNGLISTREGIREAVLGLDVRQNPSRADWYQSDFF
GLPB_KLEP7      KISHRQDAVEAVWTRNHGDIALRPRFTVLASGSFFSNGLVATRDSVREPILGLDLHQTLPRESWYQRDFF
GLPB_KLEP3      KISHRQGAVEAVWTRNHGDVALRPRFTVLASGSFFSNGLVATRDSVREPILGLDLQQTLPRESWYQRDFF
GLPB_PECCP      RASLSAQEIA-VHSHHHRDIPLRAKYAVLASGSFFSNGLVTQFDRVTEPVFGLDVRFAEQREGWSQQDVF
GLPB_ERWCT      RASLSSQEIA-VHSHHHRDIPLRAKHAVLASGSFFSNGLVTQFDRVTEPVFGLDVRFAEQREGWSQQDVF
GLPB_YERE8      RAELVGNRITGLYSRNHGDIPLRAAQMVLASGSFFSNGLVATFEHVYEPILDLDILSLPNRADWSNSNMF
GLPB_YERPN      RAELVDNRITGLYSRNHGDIPLRAAQMVLASGSFFSNGLVATFDKIYEPILDLDILSLPHRADWSHSNLF
GLPB_YERPE      RAELVDNRITGLYSRNHGDIPLRAAQMVLASGSFFSNGLVATFDKIYEPILDLDILSLPHRADWSHSNLF
GLPB_YERPA      RAELVDNRITGLYSRNHGDIPLRAAQMVLASGSFFSNGLVATFDKIYEPILDLDILSLPHRADWSHSNLF
GLPB_YERPS      RAELVDNRITGLYSRNHGDIPLRAAQMVLASGSFFSNGLVATFDKVYEPILDLDILSLPHRADWSHSNLF
GLPB_ACTPJ      KAEFEGKNVARIFTTSHQEEPISADYFVLAAGSFFSNGLVAEFERVKEPVFDLDIFDSSDRFTWTNNRFA
GLPB_ACTP7      KAEFEGKNVARIFTTSHQEEPISADYFVLAAGSFFSNGLVAEFERVKEPVFDLDIFDSSDRFTWTNNRFA
GLPB_ACTP2      KAEFEGKNVARIFTTSHQEEPISADYFVLAAGSFFSNGLVAEFERVKEPVFDLDIFDSSDRFTWTNNRFA
GLPB_PASMU      AADVHHQRVTQVYTQLHQEIPIQAKDVVLASGSFFSKGLVAEFEKIREPIFALDLVENQDRMTWTHSRFS
GLPB_ACTSZ      RAEFEGNRVVKLFTRIHEDEPLAADNYVLASGSFFSNGLVAEFERIYEPVFGADIVQTSDHFTWTTRRFS
GLPB_PHOPR      RGDIEDGELKRIFTRNHRDMPLIADNYLIATGSFFSRGMAAQRLSIDEPIFNLDTVAIPDRDQWYQPEFF
GLPB_VIBCH      GGNFAGSRLTAIHTQNLRDFPISAEHYVMATGSYFSQGLQASQHAIQEPIFALDVQQNPDRAQWRHAQFI
GLPB_MANSM      RSEFEGNKVARIFTQLHLENAVTAKYFVLASGGFFSNGLVSEFEEIYEPLFRSDIVKTTDRFSWISKRFA
GLPB_VIBC3      GGDFAGSRLTAIHTQNLRDFPISAEHYVMATGSYFSQGLQASQHAIQEPTFALDVQQNPDRAQWRHAQFI
GLPB_VIBCM      DGDFAGSRLTAIHTQNLRDFPISAEHYVMATGSYFSQGLQASQHAIQEPTFALDVQQNPDRAQWRHAQFI
GLPB_HAES2      RAVIEDQQVKQIYTQLHQEHGIFAEHFVLASGSFFSNGLVSVFDRLLEPIFDVDMIGNSNRLTWTARRFS
GLPB_HAES1      RAVIEDQQVKQIYTQLHQEHGIFAEHFVLASGSFFSNGLVSVFDRLLEPIFDVDMIGNSNRLTWTARRFS
GLPB_HAEPS      KADIENGKVQRIYTQLHQDNAISAEHLVLATGSYFSNGLKADFDRIFEPVFQADIVNETDRLSWTANRFS
GLPB_VIBVY      SGEWAQGHLVSISTRNLGDIPLHANAYILASGSYFSQGLKASLDKIVEPIFGLDMVAKPHRRQWRNDQFF
GLPB_VIBVU      SGEWEQGHLTSISTRNLGDIPLHAQAYILASGSYFSQGLKASLDKIVEPIFGLDMVAKPHRRQWRNDQFF
GLPB_HAEDU      RAEFDGDRVARIFTTLHQEESINAAHFVLASGSFFSNGLVAEFERVKEPIFDLDIIGNSERVSWTDKRFA
GLPB_VIBFM      QGEFSYVDKSDIFTKNHGDFPLQAKQFVLATGSFFSQGLKANVDSMIEPIFGLDIAQSDKRTDWYSHDFF
GLPB_VIBF1      QGEFSYVDKSDLFTKNHGDFPLQAKQFVLATGSFFSQGLKANVDSMIEPIFGLDIAQSDKRTDWYSHDFF
GLPB_HAEIN      NATFEGNQVRCINTRLLEDEEITADNFVLASGSFFSKGLISEFDKIYEPIIGVEGFNNKDRFTWTAHRFA
GLPB_HAEI8      NATFEGNKVRCINTRLLENEEITADNFVLASGSFFSKGLISEFDKIYEPIIGVEGFNQKDRFTWTVHRFA
GLPB_HAEIG      NATFEGNKVRCINTRLLEDEEITADNFVLASGSFFSKGLISEFDKIYEPIIGVEGFNQKDRFTWTVHRFA
GLPB_HAEIE      NATFEGNKVRCINTRLLEDEEITADNFVLASGSFFSKGLISEFDKIYEPIIGVEGFNQKDRFTWTVHRFA


                         .         .         .         .         *         .         .:420
query           DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ
GLPB_SALTY      DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ
GLPB_SALPK      DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ
GLPB_SALPA      DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ
GLPB_SALNS      DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ
GLPB_SALHS      DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ
GLPB_SALG2      DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ
GLPB_SALEP      DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ
GLPB_SALA4      DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ
GLPB_SALCH      DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ
GLPB_SALSV      DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ
GLPB_SALPB      DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ
GLPB_SALDC      DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ
GLPB_SALTI      DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ
GLPB_SALAR      DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAQGCGGGVCAVSALQAAHHIAERAGEQQ
GLPB_CITK8      DAQPWQQFGVTTDDALRPSLAGQTVENLFAIGSVLGGFDPIAQGCGGGVCAVSALHAARHIAERAGGQQ
GLPB_ECOUT      APQPWQQFGVTTDEALRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECOL5      APQPWQQFGVTTDEALRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECOK1      APQPWQQFGVTTDEALRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECO45      APQPWQQFGVTTDEALRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECO81      APQPWQQFGVTTDEALRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECO27      APQPWQQFGVTTDEALRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECOL6      APQPWQQFGVTTDEALRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_SHIF8      APQPWQQFGVTTDETLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECOLU      APQPWQQFGVTTDEALRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECOSM      APQPWQQFGVTTDEALRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_SHISS      APQPWQQFGVTTDETLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_SHIB3      APQPWQQFGVTTDETLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECOSE      APQPWQQFGVTTDETLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECOHS      APQPWQQFGVTTDETLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECO8A      APQPWQQFGVTTDETLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECO55      APQPWQQFGVTTDETLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ESCF3      APQPWQQFGVTTDEALRPSQAGKTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECO24      APQPWQQFGVTTDETLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_SHIFL      APQPWQQFGVTTDETLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECOLI      APQPWQQFGVTTDETLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECOLC      APQPWQQFGVTTDETLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECODH      APQPWQQFGVTTDETLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECOBW      APQPWQQFGVTTDETLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECO7I      APQPWQQFGVTTDETLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECO5E      APQPWQQFGVTTDQTLRPSQAGQTIENLFTIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ECO57      APQPWQQFGVTTDQTLRPSQAGQTIENLFTIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_SHIBS      APQPWQQFGVTTDETLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_SHIDS      APQPWQQFGVTTDQTLRPSQAGQTIENLFAIGSVLGGFDPIAQGCGGGVCAVSAL--------------
GLPB_ENT38      APQPWQQFGVITDNTLRPQLSGSPVDNLYAIGSVLGGFDPIALGCGGGVCAITALYAAEQICQRAGGEQ
GLPB_KLEP7      ASQPWQRFGVKTDALLRPLLGGQPFHNLFAIGSLLGGFDAIQLGCGGGVCAVTALHAARQIHALAG---
GLPB_KLEP3      VSQPWQRFGVKTDALLRPVLGGQPFHNLFAIGSLIGGFDAIQLGCGGGVCAVTALHAARQIHALAGDR-
GLPB_PECCP      VPQPYMQFGAIVDEHLHPRIGGETIGNLYAIGAVLEGFDPIAQGCGAGVSLLSALHVAEQI--------
GLPB_ERWCT      APQPYMQFGAIVDEHLHPRIAGETVNNLYAIGAVLEGFDPIVQGCGAGVSLLSALHVAEQI--------
GLPB_YERE8      APQPYLQFGVNTDNRLRALRGGVALDNLHVIGAVLGGYDPLQQGCGAGVSLTSALFVAEQI--------
GLPB_YERPN      APQPYLQFGVNTDNHLRPLRGGVALENLHAIGAVLGGYDPLQQGCGAGVSLTSAVFVAEQI--------
GLPB_YERPE      APQPYLQFGVNTDNHLRPLRGGVALENLHAIGAVLGGYDPLQQGCGAGVSLTSAVFVAEQI--------
GLPB_YERPA      APQPYLQFGVNTDNHLRPLRGGVALENLHAIGAVLGGYDPLQQGCGAGVSLTSAVFVAEQI--------
GLPB_YERPS      APQPYLQFGVNTDNHLRPLRGGVALENLHAIGAVLGGYDPLQQGCGAGVSLTSAVFVAEQI--------
GLPB_ACTPJ      APQPYQSAGVVINSACQVQKNGEVVSNLYAVGNVIGGFQGIEQGCGSGVAVVTALTVAEQI--------
GLPB_ACTP7      APQPYQSAGVVINSACQVQKNGEVVSNLYAVGNVIGGFQGIEQGCGSGVAVVTALTVAEQI--------
GLPB_ACTP2      APQPYQSAGVVINSACQVQKNGEVVSNLYAVGNVIGGFQGIEQGCGSGVAVVTALTVAEQI--------
GLPB_PASMU      APQPYQQTGVVIDEHCRARKSGQFFENLYAIGNIVGGFNGIELGCGSGVAIVTALVAAEQI--------
GLPB_ACTSZ      APQPYQSAGVVINTDCRVQKCGRFFDNLYAAGAVIGGFNGIELGCGSGVAVVTALTVADEIAEKSG---
GLPB_PHOPR      KAHPFLKMGVICNDQLQASANNQTIDNLFCAGALLAHYDPVFEGCGSGV----AISTGFHVAEQ-----
GLPB_VIBCH      AAQPFMTFGVTTDANLHPSRQGKTIDNLWCCGAMLSGYDPVFEGCGGGVAIATAYHAVEQI--------
GLPB_MANSM      DPQPYQSAGVVINAECQVQKDGNNVENLFAIGAVIGGYNGIELGCGSGVAVTTALKVADNI--------
GLPB_VIBC3      AAQPFMTFGVITDANLHPSRQGKTIDNLWCCGAMLSGYDPVFEGCGGGVAIATAYHAVEQI--------
GLPB_VIBCM      AAQPFMTFGVTTDANLHPSRQGKTIDNLWCCGAMLSGYDPVFEGCGGGVAIATAYHAVEQI--------
GLPB_HAES2      SPQPYQSAGVAINSRCQLKKSGQIIKNLYAAGNVIGGYNALELGCGSGVAVVTALTAADNIIE------
GLPB_HAES1      SPQPYQSAGVAINSCCQLKKSGQIIKNLYAAGNVIGGYNALELGCGSGVAVVTALTVADNIIE------
GLPB_HAEPS      SPQPYQSAGVAINEKCQVRKDGQFMANLYATGNVIGGFNSLELGCGSG---------------------
GLPB_VIBVY      SASPFMAFGVETDAMFRPSLNGQVCQNLYCCGSVLSGYDPVFEGSGGGVAVSTALAA------------
GLPB_VIBVU      SASPFMAFGVETDAMFRPSLNGQVCQNLYCCGSVLSGYDPVFEGSGGGVAVSTALAA------------
GLPB_HAEDU      AAQPYQSAGVAINHHCQVYKNGHLIPNLYAIGNVIGGFWGIEQGCASGVSVVTALTVAEWV--------
GLPB_VIBFM      STQPFLSMGIKTTANFQAIKSGHVIDNLYCAGAILSGYNPILEGSGSGVAISSGFHAAESIIEQ-----
GLPB_VIBF1      STQPFLSMGIKTTANFQAIKSGHVIDNLYCAGAILSGYNPILEGSGSGVAISSGFHAAESIIEQ-----
GLPB_HAEIN      HPQPYQSAGVAINAQCQVKKCGQFLTNLYAVGNVIGGFNALELGCGSGVAVVTALAVADEI--------
GLPB_HAEI8      HPQPYQSAGVAINAQCQVQKCGQFLTNLYAVGNVIGGFNALELGCGSGVAVVTALAVADEI--------
GLPB_HAEIG      HPQPYQSAGVAINAQCQVQKCGQFLTNLYAVGNVIGGFNALELGCGSGVAVVTALAVADEI--------
GLPB_HAEIE      HPQPYQSAGVAINAQCQVKKCGQFLTNLYAVGNVIGGFNALELGCGSGVAVVTALAVADEI--------