[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF69636.1

[Show Plain Result]


## Summary of Sequence Search
    1::289
   11::262     2e-60  48%  276 aa  GR_BACSU RecName: Full=Glyoxal reductase;         Short=GR;        
   11::266     3e-57  44%  280 aa  YTBE_BACSU RecName: Full=Uncharacterized oxidoreductase ytbE;      
   11::270     1e-53  46%  284 aa  P100_LEIMA RecName: Full=Probable reductase;         EC=1.1.-.-;
   15::263     4e-51  42%  275 aa  DKGA_ECOLI RecName: Full=2,5-diketo-D-gluconic acid reductase A;   
   16::270     5e-51  45%  283 aa  Y2407_MYCS2 RecName: Full=Uncharacterized oxidoreductase
   15::263     7e-51  41%  275 aa  DKGA_ECO57 RecName: Full=2,5-diketo-D-gluconic acid reductase A;   
   11::266     9e-51  44%  279 aa  Y2161_MYCVP RecName: Full=Uncharacterized oxidoreductase Mvan_2161;
   48::270     2e-48  48%  283 aa  Y1918_MYCSJ RecName: Full=Uncharacterized oxidoreductase Mjls_1918;
   48::270     4e-48  48%  283 aa  Y1984_MYCSK RecName: Full=Uncharacterized oxidoreductase Mkms_1984;
   48::270     4e-48  48%  283 aa  Y1938_MYCSS RecName: Full=Uncharacterized oxidoreductase Mmcs_1938;
    8::264     5e-48  40%  275 aa  YER5_SCHPO RecName: Full=Uncharacterized oxidoreductase C2F3.05c;  
   12::308     7e-48  44%  324 aa  XYL1_CANTR RecName: Full=NAD(P)H-dependent D-xylose reductase I,II;
   12::303     9e-48  44%  326 aa  AK1D1_HUMAN RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase;    
   12::308     1e-47  44%  324 aa  XYL2_CANTR RecName: Full=NADPH-dependent D-xylose reductase II,III;
   11::306     1e-47  44%  323 aa  XYL1_CANSH RecName: Full=NAD(P)H-dependent D-xylose reductase;     
    7::261     2e-47  40%  275 aa  Y2408_MYCS2 RecName: Full=Uncharacterized oxidoreductase
   12::320     4e-47  44%  326 aa  AK1D1_RABIT RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase;    
    8::273     1e-46  39%  276 aa  Y1919_MYCSJ RecName: Full=Uncharacterized oxidoreductase Mjls_1919;
    8::273     3e-46  39%  276 aa  Y1985_MYCSK RecName: Full=Uncharacterized oxidoreductase Mkms_1985;
   10::277     3e-46  42%  296 aa  MORA_PSEPU RecName: Full=Morphine 6-dehydrogenase;       
    7::307     3e-46  41%  327 aa  GRE3_YEAST RecName: Full=NADPH-dependent aldose reductase GRE3;    
   20::293     7e-46  40%  315 aa  6DCS_SOYBN RecName: Full=NAD(P)H-dependent 6'-deoxychalcone
   15::269     3e-45  41%  282 aa  Y2999_MYCTA RecName: Full=Uncharacterized oxidoreductase MRA_2999; 
   15::269     3e-45  41%  282 aa  Y2996_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb2996;   
   15::269     3e-45  41%  282 aa  Y2993_MYCBP RecName: Full=Uncharacterized oxidoreductase BCG_2993; 
   15::269     3e-45  41%  282 aa  Y2971_MYCTU RecName: Full=Uncharacterized oxidoreductase
    7::264     3e-45  39%  278 aa  DKGA_CORSC RecName: Full=2,5-diketo-D-gluconic acid reductase A;   
    5::300     4e-45  41%  317 aa  XYL1_PICGU RecName: Full=NADPH-dependent D-xylose reductase;       
   17::271     7e-45  42%  284 aa  Y3816_MYCA1 RecName: Full=Uncharacterized oxidoreductase MAV_3816; 
   15::263     1e-44  38%  275 aa  DKGA_SALTY RecName: Full=2,5-diketo-D-gluconic acid reductase A;   
    6::295     1e-44  38%  310 aa  S6PD_MALDO RecName: Full=NADP-dependent D-sorbitol-6-phosphate
   19::301     3e-44  36%  321 aa  ALRC_DICDI RecName: Full=Aldose reductase C;         Short=ARC;    
   14::268     4e-44  41%  281 aa  Y3007_MYCPA RecName: Full=Uncharacterized oxidoreductase MAP_3007; 
   15::263     4e-44  39%  277 aa  DKGA_YERPE RecName: Full=2,5-diketo-D-gluconic acid reductase A;   
   12::266     5e-44  39%  279 aa  Y4205_MYCGI RecName: Full=Uncharacterized oxidoreductase Mflv_4205;
    6::301     5e-44  42%  318 aa  XYL1_PICST RecName: Full=NAD(P)H-dependent D-xylose reductase;     
   15::263     5e-44  38%  275 aa  DKGA_SALTI RecName: Full=Putative 2,5-diketo-D-gluconic acid
   12::319     1e-43  41%  325 aa  AK1D1_MOUSE RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase;    
    3::278     1e-43  40%  301 aa  AKCL2_PIG RecName: Full=1,5-anhydro-D-fructose reductase;       
    3::300     4e-43  42%  318 aa  XYL1_PACTA RecName: Full=NAD(P)H-dependent D-xylose reductase;     
    7::293     4e-43  40%  325 aa  AK1A1_BOVIN RecName: Full=Alcohol dehydrogenase [NADP+];       
    3::278     7e-43  39%  301 aa  AKCL2_RAT RecName: Full=1,5-anhydro-D-fructose reductase;       
   15::269     9e-43  40%  282 aa  Y1669_MYCLE RecName: Full=Uncharacterized oxidoreductase ML1669;   
   15::269     9e-43  40%  282 aa  Y1669_MYCLB RecName: Full=Uncharacterized oxidoreductase MLBr01669;
   10::306     9e-43  43%  322 aa  XYL1_CANTE RecName: Full=NAD(P)H-dependent D-xylose reductase;     
   16::300     9e-43  41%  323 aa  DDBX_BOVIN RecName: Full=Dihydrodiol dehydrogenase 3;       
   16::300     9e-43  40%  323 aa  AK1C2_HUMAN RecName: Full=Aldo-keto reductase family 1 member C2;  
   12::306     2e-42  40%  324 aa  XYL1_CANPA RecName: Full=NADH-dependent D-xylose reductase;        
   12::303     2e-42  43%  326 aa  AK1D1_RAT RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase;      
   16::300     4e-42  40%  323 aa  AK1C3_PONAB RecName: Full=Aldo-keto reductase family 1 member C3
   16::300     4e-42  40%  323 aa  AK1C1_MACFU RecName: Full=Aldo-keto reductase family 1 member C1
   16::300     4e-42  40%  323 aa  AK1C1_MACFA RecName: Full=Aldo-keto reductase family 1 member C1
   16::300     4e-42  40%  323 aa  AK1C1_HUMAN RecName: Full=Aldo-keto reductase family 1 member C1;  
   16::300     6e-42  40%  323 aa  AK1C3_HUMAN RecName: Full=Aldo-keto reductase family 1 member C3;  
    7::289     8e-42  41%  316 aa  AK1BA_HUMAN RecName: Full=Aldo-keto reductase family 1 member B10; 
   14::268     1e-41  41%  281 aa  Y1744_MYCMM RecName: Full=Uncharacterized oxidoreductase MMAR_1744;
   15::269     2e-41  40%  282 aa  Y1987_MYCUA RecName: Full=Uncharacterized oxidoreductase MUL_1987; 
   16::300     2e-41  41%  323 aa  PGFS2_BOVIN RecName: Full=Prostaglandin F synthase 2;       
   16::300     2e-41  41%  323 aa  PGFS1_BOVIN RecName: Full=Prostaglandin F synthase 1;       
    7::279     2e-41  38%  297 aa  ALRA_DICDI RecName: Full=Aldose reductase A;         Short=ARA;    
    4::278     2e-41  38%  301 aa  AKCL2_MOUSE RecName: Full=1,5-anhydro-D-fructose reductase;        
   10::300     3e-41  39%  323 aa  AK1C1_PONAB RecName: Full=Aldo-keto reductase family 1 member C1
   16::303     5e-41  39%  323 aa  AK1C4_HUMAN RecName: Full=Aldo-keto reductase family 1 member C4;  
    8::303     6e-41  38%  319 aa  XYL1_ASPNG RecName: Full=NAD(P)H-dependent D-xylose reductase;     
   10::309     8e-41  39%  329 aa  XYL1_KLULA RecName: Full=NAD(P)H-dependent D-xylose reductase;     
   17::293     1e-40  37%  311 aa  ALRB_DICDI RecName: Full=Aldose reductase B;         Short=ARB;    
   14::301     2e-40  40%  321 aa  DTDH_MUCMU RecName: Full=4-dihydromethyl-trisporate dehydrogenase; 
    7::293     3e-40  38%  325 aa  AK1A1_PIG RecName: Full=Alcohol dehydrogenase [NADP+];       
   16::292     5e-40  38%  321 aa  NADO1_ORYSJ RecName: Full=Probable NAD(P)H-dependent oxidoreductase
   19::273     2e-39  39%  286 aa  Y4483_MYCA1 RecName: Full=Uncharacterized oxidoreductase MAV_4483; 
   10::317     2e-39  37%  323 aa  DHB5_MOUSE RecName: Full=Estradiol 17 beta-dehydrogenase 5;        
   16::303     2e-39  39%  323 aa  AK1C4_MACFA RecName: Full=Aldo-keto reductase family 1 member C4;  
   19::273     4e-39  38%  286 aa  Y4149_MYCPA RecName: Full=Uncharacterized oxidoreductase MAP_4149; 
   16::303     4e-39  39%  323 aa  AK1C4_MACFU RecName: Full=Aldo-keto reductase family 1 member C4;  
    8::304     5e-39  40%  324 aa  XYL1_TRIRE RecName: Full=NAD(P)H-dependent D-xylose reductase;     
   19::264     8e-39  40%  277 aa  DKGB_CORSS RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
   10::303     1e-38  37%  323 aa  PE2R_RABIT RecName: Full=Prostaglandin-E(2) 9-reductase;       
    7::293     1e-38  37%  325 aa  AK1A1_MOUSE RecName: Full=Alcohol dehydrogenase [NADP+];       
    7::293     2e-38  37%  325 aa  AK1A1_RAT RecName: Full=Alcohol dehydrogenase [NADP+];       
    7::289     4e-38  37%  316 aa  ALD1_MOUSE RecName: Full=Aldose reductase-related protein 1;       
    9::317     4e-38  35%  323 aa  AK1CL_MOUSE RecName: Full=Aldo-keto reductase family 1 member C21; 
    5::262     5e-38  38%  321 aa  YOF5_CAEEL RecName: Full=Uncharacterized oxidoreductase ZK1290.5;  
   13::268     9e-38  34%  283 aa  YKW2_SCHPO RecName: Full=Uncharacterized oxidoreductase P32A8.02;  
   18::294     1e-37  38%  322 aa  NADO2_ORYSJ RecName: Full=Probable NAD(P)H-dependent oxidoreductase
    3::295     3e-37  39%  324 aa  A1A1B_DANRE RecName: Full=Alcohol dehydrogenase [NADP+] B;       
   14::293     3e-37  37%  325 aa  YBN4_SCHPO RecName: Full=Uncharacterized oxidoreductase C8E4.04;   
    7::293     3e-37  37%  325 aa  AK1A1_HUMAN RecName: Full=Alcohol dehydrogenase [NADP+];       
   14::286     4e-37  37%  312 aa  GCY_YEAST RecName: Full=Protein GCY;         EC=1.1.1.-;
   14::281     4e-37  34%  320 aa  ALDR_HORVU RecName: Full=Aldose reductase;         Short=AR;       
    7::293     1e-36  37%  325 aa  AK1A1_PONAB RecName: Full=Alcohol dehydrogenase [NADP+];       
    7::289     1e-36  37%  316 aa  ALD2_MOUSE RecName: Full=Aldose reductase-related protein 2;       
   14::291     2e-36  36%  312 aa  YPR1_YEAST RecName: Full=Putative reductase 1;         EC=1.1.1.-;
   10::300     2e-36  37%  323 aa  AK1CO_HORSE RecName: Full=Aldo-keto reductase family 1 member
    6::295     2e-36  36%  327 aa  AK1A1_CHICK RecName: Full=Alcohol dehydrogenase [NADP+];       
    4::297     3e-36  39%  320 aa  AKCL2_MACFA RecName: Full=1,5-anhydro-D-fructose reductase;        
   19::316     4e-36  37%  322 aa  AK1CN_HORSE RecName: Full=Aldo-keto reductase family 1 member C23; 
    7::287     5e-36  38%  323 aa  ALDX_SPOSA RecName: Full=Aldehyde reductase 1;         Short=ALR 1;
    7::289     5e-36  38%  316 aa  ALD2_CRIGR RecName: Full=Aldose reductase-related protein 2;       
    5::295     5e-36  38%  327 aa  AK1A1_XENTR RecName: Full=Alcohol dehydrogenase [NADP+];       
    5::295     5e-36  38%  327 aa  AK1A1_XENLA RecName: Full=Alcohol dehydrogenase [NADP+];       
    8::262     8e-36  36%  282 aa  YJ66_YEAST RecName: Full=Uncharacterized oxidoreductase YJR096W;   
    6::289     8e-36  38%  316 aa  ALDR_RABIT RecName: Full=Aldose reductase;         Short=AR;       
    4::297     8e-36  38%  320 aa  AKCL2_HUMAN RecName: Full=1,5-anhydro-D-fructose reductase;        
    7::292     2e-35  38%  324 aa  A1A1A_DANRE RecName: Full=Alcohol dehydrogenase [NADP+] A;       
   10::300     7e-35  35%  323 aa  AKC1H_RAT RecName: Full=Aldo-keto reductase family 1 member C18;   
   10::300     2e-34  35%  323 aa  AKC1H_MOUSE RecName: Full=Aldo-keto reductase family 1 member C18; 
   11::301     3e-34  33%  324 aa  CRO_RANCA RecName: Full=Rho crystallin;
    7::289     3e-34  37%  316 aa  ALDR_RAT RecName: Full=Aldose reductase;         Short=AR;       
   16::312     3e-34  36%  318 aa  AK1CL_RAT RecName: Full=Aldo-keto reductase family 1 member C21;   
    6::286     3e-34  37%  316 aa  ALDR_PIG RecName: Full=Aldose reductase;         Short=AR;       
   10::303     3e-34  33%  323 aa  AK1CD_MOUSE RecName: Full=Aldo-keto reductase family 1 member C13; 
    8::298     4e-34  34%  301 aa  ALDR_ENCCU RecName: Full=Aldose reductase;         Short=AR;       
    5::285     4e-34  38%  315 aa  ALDR_BOVIN RecName: Full=Aldose reductase;         Short=AR;       
    6::289     6e-34  37%  316 aa  ALDR_HUMAN RecName: Full=Aldose reductase;         Short=AR;       
   16::312     8e-34  35%  322 aa  DIDH_RAT RecName: Full=3-alpha-hydroxysteroid dehydrogenase;       
   24::332     8e-33  35%  344 aa  ARA1_YEAST RecName: Full=D-arabinose dehydrogenase [NAD(P)+] heavy
    7::289     1e-32  36%  316 aa  ALDR_MOUSE RecName: Full=Aldose reductase;         Short=AR;       
   11::301     2e-32  32%  324 aa  CRO_RANTE RecName: Full=Rho crystallin;
    1::251     5e-32  36%  267 aa  DKGB_SALTY RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
    1::251     5e-32  36%  267 aa  DKGB_SALTI RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
    1::251     2e-31  35%  267 aa  DKGB_ECOLI RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
   18::298     4e-31  34%  321 aa  YDG7_SCHPO RecName: Full=Uncharacterized oxidoreductase C26F1.07;  
    1::251     4e-31  35%  267 aa  DKGB_ECO57 RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
   16::303     3e-29  32%  322 aa  AK1CD_MESAU RecName: Full=Aldo-keto reductase family 1 member C13; 
    9::269     6e-28  35%  284 aa  I3ACR_SCHPO RecName: Full=NAD/NADP-dependent indole-3-acetaldehyde
    1::251     2e-27  33%  267 aa  DKGB_YERPE RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
    6::289     5e-27  32%  312 aa  KAR_YEAST RecName: Full=NADPH-dependent alpha-keto amide reductase;
    1::199     6e-25  38%  228 aa  AK1A1_CRIGR RecName: Full=Alcohol dehydrogenase [NADP+];       
    4::267     4e-22  27%  276 aa  YHH5_SCHPO RecName: Full=Uncharacterized oxidoreductase C28F2.05;  
    9::269     4e-20  35%  284 aa  YEAE_ECOLI RecName: Full=Uncharacterized protein yeaE;
   11::118     3e-17  42%  130 aa  TRAKR_HUMAN RecName: Full=Putative truncated aldo-keto reductase;  
   19::120     6e-17  43%  129 aa  AKCL1_HUMAN RecName: Full=Aldo-keto reductase family 1 member
   25::308     2e-14  29%  310 aa  IOLS_BACSU RecName: Full=Protein iolS;         EC=1.1.1.-;AltName:
   10::309     2e-14  32%  340 aa  YAKC_SCHPO RecName: Full=Aldo-keto reductase yakc [NADP+];       
   12::302     2e-12  30%  310 aa  YCCK_BACSU RecName: Full=Uncharacterized oxidoreductase yccK;      
    1::165     3e-12  34%  331 aa  GS69_BACSU RecName: Full=General stress protein 69;       
   34::311     7e-11  29%  326 aa  YDJG_ECOLI RecName: Full=Uncharacterized oxidoreductase ydjG;      
   20::295     2e-10  28%  298 aa  YDHF_ECOLI RecName: Full=Oxidoreductase ydhF;         EC=1.-.-.-;
    6::297     3e-10  27%  300 aa  YCSN_BACSU RecName: Full=Uncharacterized oxidoreductase ycsN;      
   37::311     4e-09  29%  324 aa  YAJO_ECOLI RecName: Full=Uncharacterized oxidoreductase yajO;      
   93::362     4e-09  29%  377 aa  Y1669_ARATH RecName: Full=Uncharacterized oxidoreductase At1g06690,
    1::216     5e-09  30%  326 aa  YRPG_BACSU RecName: Full=Uncharacterized oxidoreductase yrpG;      
   21::329     1e-08  29%  346 aa  YGHZ_ECOLI RecName: Full=Uncharacterized protein yghZ;
   21::329     2e-08  28%  346 aa  YGHZ_ECO57 RecName: Full=Uncharacterized protein yghZ;
    8::174     4e-08  30%  306 aa  YQKF_BACSU RecName: Full=Uncharacterized oxidoreductase yqkF;      
   36::203     7e-08  28%  331 aa  ARK74_HUMAN RecName: Full=Aflatoxin B1 aldehyde reductase member 4;
   28::287     1e-06  24%  306 aa  YH5B_SCHPO RecName: Full=Uncharacterized oxidoreductase C215.11c;  
  136::283     2e-06  24%  286 aa  YDBC_ECOLI RecName: Full=Putative oxidoreductase ydbC;       
   60::239     2e-06  26%  367 aa  ARK72_MOUSE RecName: Full=Aflatoxin B1 aldehyde reductase member 2;
   28::215     3e-06  29%  306 aa  IN22_MAIZE RecName: Full=IN2-2 protein;
   40::124     3e-05  41%  125 aa  MORA_RABIT RecName: Full=Morphine 6-dehydrogenase;       
   59::231     4e-05  27%  359 aa  ARK72_HUMAN RecName: Full=Aflatoxin B1 aldehyde reductase member 2;
   71::283     6e-05  28%  401 aa  KCAB1_CHICK RecName: Full=Voltage-gated potassium channel subunit
   45::137     6e-05  41%  307 aa  A115_TOBAC RecName: Full=Auxin-induced protein PCNT115;
   36::203     1e-04  29%  331 aa  ARK73_HUMAN RecName: Full=Aflatoxin B1 aldehyde reductase member 3;
   45::249     2e-04  27%  367 aa  KCAB2_XENLA RecName: Full=Voltage-gated potassium channel subunit
   20::199     2e-04  27%  327 aa  ARK73_RAT RecName: Full=Aflatoxin B1 aldehyde reductase member 3;  
   45::249     5e-04  26%  367 aa  KCAB2_BOVIN RecName: Full=Voltage-gated potassium channel subunit
    1::289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEYSILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCTR
GR_BACSU        -----LHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVA----R
YTBE_BACSU      -----LHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNXXXXXXXXXXXXXXXXXXX
P100_LEIMA      -----LSNGVKMPQFGLGVWQSPAGEVTENAVNWALCAGYRHIDTAAIYKNEESVGAGLR---ASGV-PR
DKGA_ECOLI      -----------MPQLGLGVWQASN-EEVITAIQKALEVGYRSIDTAAAYKNEEGVGKALKNASVN----R
Y2407_MYCS2     -----LNDDNTLPVVGIGVGELSDSE-AERSVSAALEAGYRLIDTAAAYGNEAAVG----RAIAASGIPR
DKGA_ECO57      -----------MPQLGLGVWQASN-EEVITAIQKALEVGYRSFDTAAAYKNEEGVGKALKNASVN----R
Y2161_MYCVP     ----ILNDDNTMPVIGLGVGELSDAE-AEQSVLAALEAGYRLIDTAAAYGNEAAVG----RAIAKSGVPR
Y1918_MYCSJ     --------------------------------------GYRLIDTAAVYGNEAAVGRAVN---ASGI-PR
Y1984_MYCSK     --------------------------------------GYRLIDTAAVYGNEAAVGRAVN---ASGI-PR
Y1938_MYCSS     --------------------------------------GYRLIDTAAVYGNEAAVGRAVN---ASGI-PR
YER5_SCHPO      -----LNNGLKCPQFAYGSYMV-NRTKCFDSVYAALQCGYRHIDSAQMYHNEADCGRAILKFMEETGTKR
XYL1_CANTR      -----LNSGYEMPLVGFGCWKVTNATAADQ-IYNAIKTGYRLFDGAEDYGNEKEVGEGINRAIKEGLVKR
AK1D1_HUMAN     -----LSDGNSIPIIGLGTYKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRR
XYL2_CANTR      -----LNSGYEMPLVGFGCWKVNNETAADQ-IYNAIKTGYRLFDGAEDYGNEKEVGEGINRAIKEGLVKR
XYL1_CANSH      -----LNNGLEMPSIGFGCWKL-DKSTAADQVYNAIKAGYRLFDGAEDYGNEQEVGEGVKRAIDEGIVTR
Y2408_MYCS2     -----LNDGNSIPQVGLGVWQ-TPAEDTERAVAAALQAGYRHIDTAAAYRNETETG----RAIANSGVPR
AK1D1_RABIT     -----LGDGNSIPIIGLGTYKTTPKGSCATSVKIAIDTGYRHIDGAYIYQNEHEVGETFREKIAEGKVRR
Y1919_MYCSJ     -----LNDGNSIPQVGLGVWQ-TPPEDTERXXXXXXXXGYRHVDTAAAYGNEEQTG----RAIAQSGLDR
Y1985_MYCSK     -----LNDGNSIPQVGLGVWQ-TPPEDTERXXXXXXXXGYRHVDTAAAYGNEEQTG----RAIAQSGLDR
MORA_PSEPU      -----LNNGVKMPALGLGVFXXXXXXXXXXXXXXXXX-GYRLIDTARSYNNEAQVGEGIRNSGVD----R
GRE3_YEAST      -----LNNGLKMPLVGLGCWKI-DKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAISEGLVSR
6DCS_SOYBN      ----------RMPVVGMGSAPFTCKKDTKEAIIEAVKQGYRHFDTAAAYGSEQALGEALKEAIHLGLVSR
Y2999_MYCTA     -----LNDEHTMPVLGLGVAELSD-DETERAVSAALEIGCRLIDTAYAYGNEAAVG----RAIAASGVAR
Y2996_MYCBO     -----LNDEHTMPVLGLGVAELSD-DETERAVSAALEIGCRLIDTAYAYGNEAAVG----RAIAASGVAR
Y2993_MYCBP     -----LNDEHTMPVLGLGVAELSD-DETERAVSAALEIGCRLIDTAYAYGNEAAVG----RAIAASGVAR
Y2971_MYCTU     -----LNDEHTMPVLGLGVAELSD-DETERAVSAALEIGCRLIDTAYAYGNEAAVG----RAIAASGVAR
DKGA_CORSC      ----VLNDGNSIPQLGYGVFKVPPADT-QRAVEEALEVGYRHIDTAAIYGNEEGVXXXXXXXXXX----R
XYL1_PICGU      -----LNSGYEMPSVGFGCWKV-DKATCADTIYNAIKVGYRLFDGAEDYGNEKEVGEGINRALDEGLVAR
Y3816_MYCA1     -----LNDENTMPVLGLGVAELSD-DETERAVSAALEVGCRLIDTAAAYGNEAAVG----RAIAASGIPR
DKGA_SALTY      -----------MPQLGLGVWKASN-EEVIAAIHKALEVGYRSIDTATAYQNEEGVGKALKAASVA----R
S6PD_MALDO      -----LSSGYEMPVIGLGLWRL-EKDELKEVILNAIKIGYRHFDCAAHYKSEADVGEALAEAFKTGLVKR
ALRC_DICDI      -----LNDGNQIPSIGLGTYYSENPGEVGDAINNALKNGYRHIDGAAFYGNEKVIGNSLKEIFKEGEIKR
Y3007_MYCPA     -----LNDENTMPVLGLGVAELSD-DETERAVSAALEVGCRLIDTAAAYGNEAAVG----RAIAASGIPR
DKGA_YERPE      -----------MPQLGLGVWQASI-QETELAVSKALEVGYRSIDTAAIYKNXXXXXXXXXXXXXX----R
Y4205_MYCGI     -----LNDDNTMPVIGLGVGELSDAET-EQAVTAALEAGYRLIDTAAAYGNEAAVG----RAIAASGVPR
XYL1_PICST      -----LNSGYDMPAVGFGCWKV-DVDTCSEQIYRAIKTGYRLFDGAEDYANEKLVGAGVKKAIDEGIVKR
DKGA_SALTI      -----------MPQLGLGVWKASN-EEVIAAIHKALEVGYRSIDTATAYQNEEGVGKALKAASVA----R
AK1D1_MOUSE     -----LSDGNNIPLIGLGTYSDPRPVKTYVAVKTAIDEGYRHIDGAYVYHNEHEVGEAIREKIAEGKVKR
AKCL2_PIG       ----------KIPVLGLGTWQAAPGE-VTEAVKVAIDTGYRHFDCAYLYHNENEVGVGIQAKIDEGVVRR
XYL1_PACTA      LQYYTLNNGRKIPAIGMGCWKL---ENAADMVYAAIKEGYRLFDCACDYGNEKEVGEGINRAIKDGLVKR
AK1A1_BOVIN     ----LLHTGQKMPLIGLGTWK-SDPGQVKAAIKYALSVGYRHIDCAAIYGNETEIGEALKENVGPGLVPR
AKCL2_RAT       ----------QIPTVGLGTWKASPGE-VTDAVKVAINLGYRHFDCAYLYHNESEVGMGIKEKIKEGVVKR
Y1669_MYCLE     -----LNDENTMPLLGLGVAELSE-DETERAVLAALEIGCRLIDTAAAYGNEAAVS----RAIAASGIPR
Y1669_MYCLB     -----LNDENTMPLLGLGVAELSE-DETERAVLAALEIGCRLIDTAAAYGNEAAVS----RAIAASGIPR
XYL1_CANTE      -----LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKR
DDBX_BOVIN      -----------IPVLGFGTFREVPKSEALEVTKFAIEAGFRHIDSAHLYQNEEQVGQAIRSKIADGTVKR
AK1C2_HUMAN     -----------MPVLGFGTYAPAEKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKR
XYL1_CANPA      -----LNSGYEIPLVGFGCWKLTNDVASDQ-IYRAIKSGYRLFDGAEDYANEQEVGEGIKRAIKEGIVKR
AK1D1_RAT       -----LNDGNSIPIIGLGTYSDPRPVPGKTAVKTAIDEGYRHIDGAYVYRNEHEVGEAIREKVAEGKVKR
AK1C3_PONAB     -----------MPVLGFGTYAPPERSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKR
AK1C1_MACFU     -----------MPVLGFGTYAPAEKNKAIEATKLAIEAGFRHIDSAHLYNNEEYVGLAIRSKIADGTVKR
AK1C1_MACFA     -----------MPVLGFGTYAPAEKNKALEATKLAIEAGFRHIDSAHLYNNEEYVGLAIRSKIADGTVKR
AK1C1_HUMAN     -----------MPVLGFGTYAPAEKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKR
AK1C3_HUMAN     -----------MPVLGFGTYAPPERSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKR
AK1BA_HUMAN     -----LSTKAKMPIVGLGTWK-SPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKIQEKAVKR
Y1744_MYCMM     -----LNDENTMPVLGMGVAGLSD-DETERAVSAALEIGCRLIDTAAAYGNEAAVG----RAIAASGIPR
Y1987_MYCUA     -----LNDENTMPVLGMGVAGLSD-DETERAVSAALEIGCRLIDTAAAYGNEAAVG----RALAASGIPR
PGFS2_BOVIN     -----------IPVLGFGTYAPEEKSEALEATKFAIEVGFRHVDSAHLYQNEEQVGQAIRSKIADGTVKR
PGFS1_BOVIN     -----------IPVLGFGTYAPEEKSEALEATKFAIEVGFRHVDSAHLYQNEEQVGQAIRSKIADGTVKR
ALRA_DICDI      -----LSSGHKIPLVGFGTWKA-ETTLVGKAVEVALDAGYRHIDCAAVYLNEKEVGEAFTKKFTTATVKR
AKCL2_MOUSE     -----------IPTVGLGTWKASPGE-VTDAVKLAINLGYRHFDCAYLYHNESEVGMGISEKIKEGVVKR
AK1C1_PONAB     -----LNDSHFMPVLGFGTYAPPEKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKR
AK1C4_HUMAN     -----------MPVLGFGTYAPPERNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRSKIADGSVKR
XYL1_ASPNG      -----LNSGYDMPLVGFGLWKVNN-DTCADQIYHAIKEGYRLFDGACDYGNEVEAGQGIARAIKDGLVKR
XYL1_KLULA      -----LNNGEKMPLVGLGCWKMPN-DVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRAIKEGLVKR
ALRB_DICDI      -----------IPMIGLGTYNGAKVGEVGDAVKVALKSGYRHIDGAAIYMNEKEIGHALKEVFAEGEIKR
DTDH_MUCMU      ----------KMPIRGFGCWKI-DTKDCEETVYQAIKTGYRLFDGACDYGNEVEVGRGINKAINEGLVKR
AK1A1_PIG       ----LLHTGQKMPLIGLGTWK-SEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALTETVGPGKAVR
NADO1_ORYSJ     -----------MPRVGMGTFPFTSSEDTTAAMLRAIELGYRHFDTARIYATEGCVGEAVAEAVRRGLASR
Y4483_MYCA1     -----LNDEAKMPVLGLGVAKLSD-EETESSVLAALEAGCRLIDTAASYGNEAAVG----RAIAASGIPR
DHB5_MOUSE      -----LSDGHFIPILGFGTYAPQEKSKATEATKIAIDAGFRHIDSASMYQNEKEVGLAIRSKIADGTVKR
AK1C4_MACFA     -----------MPVLGFGTYAXXXXXXXXXXXXTAIEAGFRHIDSAYLYNNEEQVGLAIRSKIADGSVKR
Y4149_MYCPA     -----LNDEAKKPVLGLGVAKLSD-EETESSVLAALEAGCRLIDTAASYGNEAAVG----RAIAASGIPR
AK1C4_MACFU     -----------MPVLGFGSYAXXXXXXXXXXXXTAIEAGFRHIDSAYLYNNEEQVGLAIRSKIADGSVKR
XYL1_TRIRE      -----LNSGYDMPQVGFGLWKV-DNAVCADTVYNAIKAGYRLFDGACDYGNEKECGEGVARAIKDGLVKR
DKGB_CORSS      ---------------GLGTYNLRG-DEGVAAMVAAIDSGYRLLDTAVNYENESEVGRAVRASSVD----R
PE2R_RABIT      -----LSDGHFIPVLGFGTYAPEEKSKAMEATKIAIDAGFRHIDSAYFYKNEKEVGLAIRSKIADGTVKR
AK1A1_MOUSE     ----LLHTGQKMPLIGLGTWK-SEPGQVKAAIKHALSAGYRHIDCASVYGNETEIGEALKESVGSGKAVR
AK1A1_RAT       ----LLHTGQKMPLIGLGTWK-SEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVR
ALD1_MOUSE      -----LSTKAKMPLVGLGTWK-SSPGQVKEAVKAAIDAGYRHIDCAYVYHNENEVGEAIQEKIKENAVKR
AK1CL_MOUSE     ----ILNDGNFIPVLGFGTALPLEKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSKIADGTVRR
YOF5_CAEEL      ---TVLSNNVEMPLIGLGT--THSGGYYHDAVLHSIKKGYRLIDTAKRYGVEKQLGIAVKNCSVP----R
YKW2_SCHPO      -----LTNGMVIPRIGFGAFMLK-YNECYGLVTQALDSGYRHIDTAAVYGNEDICGKAIVDWCEKNNVKR
NADO2_ORYSJ     -----------MPRIGMGTFPFTSSEETTAALLRAIELGYRHFDTARLYATEGCVSEAVAEAVRRGLASR
A1A1B_DANRE     -DFAVLSTGRKMPLLGLGTWK-SEPGLVKQAVIWALESGYRHIDCAPIYANEPEIGEAFQETMGPDKIRR
YBN4_SCHPO      --YFTLPNGDKIPSIGLGTWR-SGKDETKNAVCAALKAGYRHIDTAHIYGNEKEIGEGIRESGVP----R
AK1A1_HUMAN     ----LLHTGQKMPLIGLGTWK-SEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVR
GCY_YEAST       -----LNTGAQIPQIGLGTWQ-SKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKDSGVP----R
ALDR_HORVU      -DHFVLKSGHAMPAVGLGTWRAGS--DTAHSVRTAIEAGYRHVDTAAEYGVEKEVGKGLKAAMEAGI-DR
AK1A1_PONAB     ----LLHTGQKMPLIGLGTWK-SEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVR
ALD2_MOUSE      -----LSTKAKMPIVGLGTWK-SPPNQVKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIQEKIKEKAVQR
YPR1_YEAST      -----LNTGASIPVLGFGTWRSVDNNG-YHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKDSGVP----R
AK1CO_HORSE     -----LNDGHVIPVLGFGTYAPEEKSRTVEVTKLAIDAGFRHIDSAYSYNNEKEVGQAIRSKIEDGTVKR
AK1A1_CHICK     -DFVALYNGQKIPLIGLGTWK-SEPGQVKEAVKYALSVGYRHVDCAAAYSNEAEIGDAFQECVGPNVIKR
AKCL2_MACFA     -----------IPAVGLSCWKASPGK-VTEAVKVAIDAGYRHFNCAYFYHNEKEVGAGIRYKIKEGAVRR
AK1CN_HORSE     --------------LGFGTYAPNEKSKAVEATKSAIDAGFRHIDCAHLYDNEKEVGLAIRSKIQDGTVKR
ALDX_SPOSA      -----LNTGASLELVGYGTWQAAPGE-VGQGVKVAIETGYRHLDLAKVYSNQPEVGAAIKEAGVK----R
ALD2_CRIGR      -----LSTKAKMPIVGLGTWQ-SPPGQVKEAVKVAIDAGYRHIDCAYAYYNEHEVGEAIQEKIKEKAVRR
AK1A1_XENTR     VEYETLYTGQKIPLIGLGTWK-SAPGQVKDAVKYALGVGYRHIDCAFVYGNETEVGEAIKESVGSGL-SR
AK1A1_XENLA     VEYETLYTGQKMPLIGLGTWK-SAPGQVKDAVKYALGVGYRHIDCAFVYGNETEVGEAIKESVGPGL-KR
YJ66_YEAST      -----LSNGFKIPSIALGTYDIP-RSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNEGNHKR
ALDR_RABIT      ----VLYNGAKMPILGLGTWK-SPPGQVTEAVKTAIDLGYRHIDCAHVYQNENEVGVALQEKLKEQVVKR
AKCL2_HUMAN     -----------IPAVGLSSWKASPGK-VTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRR
A1A1A_DANRE     -----LSTGQRMPTVGLGTWK-SAPGQVKQAVLAALDCGYRHIDCAAAYSNEREVGEALTERLGPGKSLR
AKC1H_RAT       -----LNDGHSIPVLGFGTYATEERKKSMESTKIAIDVGFRHIDCSHLYQNEEEIGQAIVSKIEDGTVKR
AKC1H_MOUSE     -----LNDGHSIPVLGFGTYATEEKKKSMESTKIAIDVGFCHIDCSHLYQNEEEIGQAILSKIEDGTVKR
CRO_RANCA       -----LNDGNMMPILGLGTYAAPDKSLAEEAVKTAIDVGYRHIDCAFITGNEMHIGNGIRSKISDGTVKR
ALDR_RAT        -----LNNGTKMPTLGLGTWK-SPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKR
AK1CL_RAT       -----------IPVLGFGTAMPSEKSKAKEVTKIAIDAGFHHFDSAFVYNTEDHVGEAIREKIANGTTRR
ALDR_PIG        ----VLYTGAKMPILGLGTWK-SPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQGQVVKR
AK1CD_MOUSE     -----LNDGHLIPALGFGTYKPKEKSKSLEAACLALDVGYRHVDTAYAYQVEEEIGQAIQSKIKAGVVKR
ALDR_ENCCU      -----LNNGKEIPTVGLGTWGMEDEAVLEGAIRNALSLGYRHIDTAFIYGNEKMIGNILKKLFDEGVVQR
ALDR_BOVIN      ----VLYTGAKMPILGLGTWK-SPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLALQAKLQEQVVKR
ALDR_HUMAN      ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
DIDH_RAT        -----------IPVLGFGVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVKR
ARA1_YEAST      --YFSLNNGVRIPALGLGTANPHEKAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLEDGSIKR
ALDR_MOUSE      -----LNNGTKMPTLGLGTWK-SPPGQVTEAVKVAIDLGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKR
CRO_RANTE       -----LNDGNMMPILGLGTYASVPKSLAEEAVKIAIDVGYRHIDCAFITGNEMHIGNGIRSKISDGTVKR
DKGB_SALTY      ---------MTIPAFGLGTFRLKD-DVVIASVKTALELGYRAVDTAQIYDNEAAVG----QAIAESGVPR
DKGB_SALTI      ---------MTIPAFGLGTFRLKD-DVVIASVKTALELGYRAVDTAQIYDNEAAVG----QAIAESGVPR
DKGB_ECOLI      ---------MAIPAFGLGTFRLKD-DVVISSVITALELGYRAIDTAQIYDNEAAVG----QAIAESGVPR
YDG7_SCHPO      -----LADGSKIPGLGLGTWR-SEPNQTKNAVKTALQYGYRHIDAAAIYGNEDEVGDGIKESGVP----R
DKGB_ECO57      ---------MAIPAFGLGTFRLKD-DVVISSVKTALELGYRAIDTAQIYDNEAAVG----LAIAESGVPR
AK1CD_MESAU     -----------IPALGFGTYKPIEKSKAMEAANLAIGVGYRHIDTAYAYQIEEEIGQAIQSNIKAGIVKR
I3ACR_SCHPO     ----------KIPVPAYGVGTALFKKEKGESVKNALAAGFIHIDCAEVYGNEEEVGVALKEANVP----R
DKGB_YERPE      ---------MSIPVFGLGTFRLQDQIVID-SVSQALTLGYRAIDTAQIYENEAPVGQAIQES---GI-NR
KAR_YEAST       -QFFTLNNGNKIPIIGTGTRWYKNEETVEQIVYALKLPGIIHIDAAEIYRTYPEVG----KALSLTEKPR
AK1A1_CRIGR     -------------LIGLGTWK-SNPGQVKAAIKYALSVGYRHIDCAAVYGNEIEIGEALKENVGPGKAVR
YHH5_SCHPO      --FSPSQTNFEKEQLCFGVYQLKD---CYQQVIEALSLGIRVIDSAITYRNEKECEQAIQDFCHQNVIKR
YEAE_ECOLI      ------SGDVSLPAVGQGTWYMGEDASQRKTEVAALRAGIELIDTAEMYGAEKVVGEAL-----TGL--R
TRAKR_HUMAN     -----LNDGKFMPILGFGVARKVAMSNVEEAVQVAIDVGYRHIDSAYTHLNEEGIGQAIRKKIANGTVKR
AKCL1_HUMAN     -----------MPVLGFGTYAPTPKSQAAEATKVAIDVGFRHIDSAYLYQNEEEVGQAIWEKIADGTVKR
IOLS_BACSU      ---------------GHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGSEELIGEVLRE------FNR
YAKC_SCHPO      --------NDTVPAIGFGCMGLPSSEEANQAVLTAADLGCTFWDSSDMYGNEECIGRWFKQ---TG--RR
YCCK_BACSU      ---------LKVKRIGFGLFPNLNDETGKDLVRTALDGGVNFIDTAFIYGSEELIGEVVQER-----GVR
GS69_BACSU      MEYSIADTGIEASRIGLGTWAITDEKTSIETIRAALDQGITLIDTAPAYGSEEIVGKAIKE-----YGKR
YDJG_ECOLI      -----------------------DRQICIDTILEAHRCGINLIDTAPGYGNSEVVGQALKKL------PR
YDHF_ECOLI      -----------------GYWRLMDWNMSARQLVSFIEEGVTTVDHADIYGGEAAFGEALKLAPHL----R
YCSN_BACSU      -----LAEDLQFSRVIHGLWRLNEWNYSDAELLSLIEHGITTFDHADIYGGEKLFGNAL--ALSPGL--R
YAJO_ECOLI      ------------------------EESSRPIIKRALEGGINFFDTANSYSDEEIVGRALRD-----FARR
Y1669_ARATH     ---------------------------------TSLDNGIDFFDTAEVYGSKFSLG-AISSETLLGRFIR
YRPG_BACSU      MEYTYLGSRLCLGTMNFGVD--TDEKTAFRIMDEALDNGIQFFDTANIYGNAGLTESIIGKWFAQGGQRR
YGHZ_ECOLI      -------SGLRLPALSLGLFGHVNALESQRAILKAFDLGITHFDLANNYGPEENFGRLLREDFAA---YR
YGHZ_ECO57      -------SGLRLPALSLGLFGHVNALESQRAILKAFDLGITHFDLANNYGPEENFGRLLREDFAA---YR
YQKF_BACSU      ------TSDLDISEVGLGCMSLTEKNKALSILDEAIELGINYLDTADLYDNEEIVGDAIQNR-------R
ARK74_HUMAN     -----------------------------------LERGHTEIDTAFLYGQSETILGGLGLRMGSSDC-R
YH5B_SCHPO      --------------MGFGAMRVTDKEACIATLKRLPELNINFIDTADSYGSENLLREALYPYKGLIIATK
YDBC_ECOLI      ----------------------------------------------------------------------
ARK72_MOUSE     -----------------------DASASAASVRAFLERGHSELDTAFMYGQSENIXXXXXXXXXXXDCT-
IN22_MAIZE      --------------MGMSAFYGPPKPESEMIKLHAVDAGVTFLDTSDVYGNEVLLGKALQGGV------R
MORA_RABIT      ----------------------------------------------------------------------
ARK72_HUMAN     ------------------------------AVRAFLERGHTELDTAFMYGQSETIXXXXXXXXXXXDC-R
KCAB1_CHICK     MKYRNLGKSLRVSCLGLGTWQISD-EVAEQLMTIAYESGVNLFDTAEVYAAEVILGNILKKK----GWRR
A115_TOBAC      -----------------------------QLIHHAINSGITLLDTSDVYGNEILLGKALRVVLATGIVLG
ARK73_HUMAN     -----------------------------------LERGHTEIDTAFVYGQSETIXXXXXXXXXXSDC-R
KCAB2_XENLA     -------SGLRVSCLGLGTWQITD-EMAEQLMTLAYDNGINLFDTAEVYAAEVVLGNIIKKKG----WRR
ARK73_RAT       -----------------------DVTSSSASVRAFLQRGHTEIDTAFVYGQSETIXXXXXXXXXRSGCKV
KCAB2_BOVIN     -------SGLRVSCLGLGTWQITD-EMAEQLMTLAYDNGINLFDTAEVYAAEVVLGNIIKKK----GWRR


                         .         .         *         .         .         .         .:140
query           EELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFSAWRALEDAYEAGKLKAIGVS
GR_BACSU        EELFITSKVWNEDQG-YETTLAAFEKSLERLQLDYLDLYLIHWPGKDYKDTWRALEKLYKDGKIRAIGVS
YTBE_BACSU      XDLFITSKVWNADLG-YEETLAAFETSLSKLGLDYLDLYLIHWPVGKYKEAWRALETLYKEGRIKAIGVS
P100_LEIMA      EDVFITTKLWNTEQG-YESTLAAFEESRQKLGVDYIDLYLIHWPRGKYLDSWRAFEQLYKEKKVRAIGVS
DKGA_ECOLI      EELFITTKLWNDD---HKRPREALLDSLKKLQLDYIDLYLMHPAIDHYVEAWKGMIELQKEGLIKSIGVC
Y2407_MYCS2     DEIYVTTKLATPDQG-FTSSQAAARASLERLGLDYVDLYLIHWPGGDYVDSWGGLMKVKEDGIARSIGVC
DKGA_ECO57      EELFITTKLWNDD---HNRPREALLDSLKKLQLDYIDLYLMHPAIDHYVEAWKGMIELQKEGLIKSIGVC
Y2161_MYCVP     GELFVTTKLATDDLG-FQSSQDALRASLERLGLDYVDLYLIHWSQGTYVDSWGGLMKLKELGLTRSIGVS
Y1918_MYCSJ     EEIYVTTKLAVADQG-FGTSQDAARASLERLGLDYVDLYLIHWPAGDYIDSWGGLMKAKQDGVARSIGVC
Y1984_MYCSK     EEIYVTTKLAVADQG-FGTSQDAARASLERLGLDYVDLYLIHWPAGDYIDSWGGLMKAKQDGVARSIGVC
Y1938_MYCSS     EEIYVTTKLAVADQG-FGTSQDAARASLERLGLDYVDLYLIHWPAGDYIDSWGGLMKAKQDGVARSIGVC
YER5_SCHPO      EDIWFTSKL--NDLSGYKSTLSSIDASVKACGLGYIDLFLLHSPYGDRIESWKALEKGVEEGKLRAIGVS
XYL1_CANTR      EELFITSKLWFHDPKNVETA---LNKTLSDLNLDYVDLFLIHFPIGDNFDTWKALEKLVEAGKIKSIGIS
AK1D1_HUMAN     EDIFYCGKLWATNHVP-EMVRPTLERTLRVLQLDYVDLYIIEVPMGDEIATWEAMEACKDAGLVKSLGVS
XYL2_CANTR      EELFITSKLWFHDPKNVETA---LNKTLSDLNLDYVDLFLIHFPIGDNFDTWKALEKLVEAGKIKSIGIS
XYL1_CANSH      EEIFLTSKLWYHDPKNVETA---LNKTLKDLKVDYVDLFLIHFPIGDNFETWKALEKLVKAGKIRSIGVS
Y2408_MYCS2     EDIFLVTKLWNSDQG-YDATLAAFDASVQRLGVDYLDLYLIHWPVPEFVDTFKAFAHLRDQGRIRSIGVS
AK1D1_RABIT     EDIFYCGKLWA---TNHDMVRPTLERTLKVLKLDYIDLYIIEIPMGDVVATWEALEACKDAGLVKSLGVS
Y1919_MYCSJ     SQVYLVTKLWNSEQG-YDATLAAFEASVDRLGVDYLDLYLIHWPVPEFVDTFRAFARLREDGRIRSIGVS
Y1985_MYCSK     SQVYLVTKLWNSEQG-YDATLAAFEASVDRLGVDYLDLYLIHWPVPEFVDTFKAFARLREDGRIRSIGVS
MORA_PSEPU      AEMFVTTKLFNCDYG-YERALRAFDESLGRLGLDYVDLYLLHWPTKDWIQSWKAAEKILGDGRARAIGVC
GRE3_YEAST      KDIFVVSKLW-NNFHHPDHVKLALKKTLSDMGLDYLDLYYIHEAHVPIIDTYRALEECVDEGLIKSIGVS
6DCS_SOYBN      QDLFVTSKLWVTENHPH-LVLPALRKSLKTLQLEYLDLYLIHWPLSDVKGVWESMEECQKLGLTKAIGVS
Y2999_MYCTA     EELFVTTKLATPDQG-FTRSQEACRASLDRLGLDYVDLYLIHPPVGKYVDAWGGMIQSRGEGHARSIGVS
Y2996_MYCBO     EELFVTTKLATPDQG-FTRSQEACRASLDRLGLDYVDLYLIHPPVGKYVDAWGGMIQSRGEGHARSIGVS
Y2993_MYCBP     EELFVTTKLATPDQG-FTRSQEACRASLDRLGLDYVDLYLIHPPVGKYVDAWGGMIQSRGEGHARSIGVS
Y2971_MYCTU     EELFVTTKLATPDQG-FTRSQEACRASLDRLGLDYVDLYLIHPPVGKYVDAWGGMIQSRGEGHARSIGVS
DKGA_CORSC      DDLFITTKLW-NDRHDGDEPXXXXXXXXXXXXXDQVDLYLVHPAADNYVHAWEKMIELRAAGLTRSIGVS
XYL1_PICGU      DELFVVSKLWFHDPKNVEKA---LDRTLSDLKVDYLDLFLIHFPIGDKFDTWRALEKMVEKGKIRSIGIS
Y3816_MYCA1     AELFVTTKLATSDQG-FKGAMDACEASLERLGLDYVDLYLIHPALGTYVNSFGGMIQSRGNGHARSIGVS
DKGA_SALTY      EELFITTKLWNDDQKR---PREALQESXXXXXXXXXXXXXMHPAIDHYVDAWKGMIALQKEGLVKSIGVC
S6PD_MALDO      EELFITTKIWNSDHGH---VVEACKNSLEKLQIDYLDLYLVHYPMPTKHNAWEGMEKTVSLGLVRSIGLS
ALRC_DICDI      EDIFYTSKLW-NSCHNSNLVVKHCVKTIEDLGIGYLDLYLIHWPIASIRETWQEMEKLVELGLVKSIGVS
Y3007_MYCPA     AELFVTTKLATSDQG-FKGAMDACEASLERLGLDYVDLYLIHPALGTYVNSFGGMIQSRGNGHARSIGVS
DKGA_YERPE      DELFITTKLWNDDQHN---PQQALETSLQKLQLDYVDLYLIHPKQDHYVSAWRELVTLKEQGLIRSIGVC
Y4205_MYCGI     DELFVTTKLATED-AGFQSSQDALRASLERLGLDYVDLYLIHSQQGKHVDSWGGLMKSKEVGLTRSIGVA
XYL1_PICST      EDLFLTSKLW-NNYHHPDNVEKALNRTLSDLQVDYVDLFLIHFPVGDNFETWKALEKLVKAGKIRSIGVS
DKGA_SALTI      EELFITTKLWNDDQKR---PREALQESXXXXXXXXXXXXXMHPAIDHYVDAWKGMIALQKEGLVKSIGVC
AK1D1_MOUSE     EEIFYCGKLWNTEHVP-SMVLPALERTLKALKLDYIDLYIIELPMANLCATWEALEACKDAGLVKSLGVS
AKCL2_PIG       EDLFIVSKLWCT-CHKKSLVKSACTRSLKALKLQYLDLYLIHWPMGDFLDTWEAMEDLVIEGLVRAIGVS
XYL1_PACTA      KDLFITSKLWNNFHAKENVKKA-LMKSLSDFNLDYFDLYLMHFPIGDKFETWRAMENLVDEGLVKSIGVS
AK1A1_BOVIN     EELFVTSKLWNTKHHPEDVEPA-LRKTLADLQLEYLDLYLMHWPYGDYKETWRALEALVAKGLVRALGLS
AKCL2_RAT       DELFIVSKLWCT-YHKQSLVKTACINTLEALNLDYLDLYLIHWPMGSFLDTWEAMEDLVIEGLVKNIGVS
Y1669_MYCLE     AQLFVTTKLATPDQG-FTKSQDACNASLDRLGMDYVDLYLIHPPVGQYVDAWGGMIQSRGEGHARSIGVC
Y1669_MYCLB     AQLFVTTKLATPDQG-FTKSQDACNASLDRLGMDYVDLYLIHPPVGQYVDAWGGMIQSRGEGHARSIGVC
XYL1_CANTE      EEIFLTSKLWYHDPKNVETALNKTLADLK---VDYVDLFLIHFPIAFKFETWKALEKLVAAGKIKSIGVS
DDBX_BOVIN      EDIFYTSKLWSTSLRP-ELVRPALEKSLNNLQLDYVDLYIIHFPVADLCRTWEALEKCKDAGLTKSIGVS
AK1C2_HUMAN     EDIFYTSKLW-SNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSDLCATWEAMEKCKDAGLAKSIGVS
XYL1_CANPA      EELFITSKLWFHDKKNVEVA---LMKTLSDLNLDYVDLFYIHFPIGDKWSTWRALEKLVDQGLAKSIGIS
AK1D1_RAT       EEIFYCGKLWSTDH-DPEMVRPALERTLQTLKLDYIDLYIIEMPMGEEFATWEALEACKDAGLVKSLGVS
AK1C3_PONAB     EDIFYTSKLW-STFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSDLCTTWEAMEECKDAGLAKSIGVS
AK1C1_MACFU     EDIFYTSKLWCNSHRP-EFVRPALERSLKNLQLDYVDLYLIHFPVSDLCATWEAMEKCKDAGLAKSIGVS
AK1C1_MACFA     EDIFYTSKLWCNSHRP-EFVRPALERSLKNLQLDYVDLYLIHFPVSDLCATWEAMEKCKDAGLAKSIGVS
AK1C1_HUMAN     EDIFYTSKLWC-NSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSDLCATWEAVEKCKDAGLAKSIGVS
AK1C3_HUMAN     EDIFYTSKLW-STFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSDLCTTWEAMEKCKDAGLAKSIGVS
AK1BA_HUMAN     EDLFIVSKLW-PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGTFLDAWEAMEELVDEGLVKALGVS
Y1744_MYCMM     AELFVTTKVATADHG-FTASREACKASLDRLGLDYVDLYLIHPAAGKYVDAFGGLIQARGEGFTRSIGVS
Y1987_MYCUA     AELFVTTKVATADHG-FTASREACKASLDRLGLDYVDLYLIHPAVGKYVDAFGGLIQARGEGFTRSIGVS
PGFS2_BOVIN     EDIFYTSKLWCNSLQP-ELVRPALEKSLQNLQLDYVDLYIIHSPVSDLCHTWEALEKCKDAGLTKSIGVS
PGFS1_BOVIN     EDIFYTSKLWCNSLQP-ELVRPALEKSLQNLQLDYVDLYIIHSPVSDLCHTWEALEKCKDAGLTKSIGVS
ALRA_DICDI      EDVFITSKLW-NTFHKKEHVRPALERTLSDLGLQYLDLYLVHWPVAFEYTSWEEMEKLVDAGLVKSIGLS
AKCL2_MOUSE     EDLFVVSKLWCT-CHKKSLVKTACTNTLEALNLDYLDLYLIHWPMGSFLDTWEAMEDLVFEGLVKNLGVS
AK1C1_PONAB     EDIFYTSKLWC-NSHRPELVRPALERSLKNLQLDYVDLYLVHFPVSDLCATWEAMEKCKDAGLAKSIGVS
AK1C4_HUMAN     EDIFYTSKLWCT-FFQPQMVQPALESSLKKLQLDYVDLYLLHFPMADLSATWEVMEKCKDAGLAKSIGVS
XYL1_ASPNG      EELFIVSKLW-NSFHDGDRVEPICRKQLADWGIDYFDLYIVHFPISRYPPGWKSEKDELEFGNARSIGIS
XYL1_KLULA      EDLVVVSKLW-NSFHHPDNVPRALERTLSDLQLDYVDIFYIHEAKGHILDTWRALEKLVDQGKIKSLGIS
ALRB_DICDI      EDIFYVSKLW-NSCHHASLVRKHCEKTXXXXXXXXXXXXXIHQPLRDIRETWQEMEKLVEYGLVKSIGVS
DTDH_MUCMU      EDLFIVTKLW-NTFHSKKHVRALFDRQLKDTGLEYFDLYLIHFPVGDAKSCWAELEKIVDAGLARNIGVA
AK1A1_PIG       EELFVTSKLWNTKHHPEDVEPA-LRKTLADLQLEYLDLYLMHWPYGDYKDTWKALEALVAKGLVRALGLS
NADO1_ORYSJ     ADVFVTSKIWCSDLHAGRVVPAARE-TLRNLGMDYVDLLLVHWPVSDMEGVWRGMEECHRLGLARAIGVS
Y4483_MYCA1     EELFVTTKLGTSRQG-FHSAQESCKESXXXXXXXXXXXXXIHPKLGKYVESFEGMIEARERGHVRSIGVS
DHB5_MOUSE      EDIFYTSKVWC-TFHRPELVRVCLEQSLKQLQLDYVDLYLIHFPMADICDTWEAMEKCKDAGLAKSIGVS
AK1C4_MACFA     EDIFYTSKLWC-TFFRPQLVQPALESSLKKLQLDYVDLYLIHFPMADLCAIWEAMEKCKDAGLAKSIGVS
Y4149_MYCPA     EELFVTTKLGTSRQG-FHSAQESCKESXXXXXXXXXXXXXIHPTLGKYVESFEGMIEARERGHVRSIGVS
AK1C4_MACFU     EDIFYTSKLWC-TFFRPQLVQPALESSLKKLQLDYVDLYLIHFPMADLCAIWEAMEKCKDAGLAKSIGVS
XYL1_TRIRE      EDLFIVSKLW-QTFHDEDKVEPITRRQLADWQIDYFDLFLVHPAALEYVQTWGAMERLVDKGLARSIGVS
DKGB_CORSS      DELIVASKIPGRQHGRAE-AVDSIRGSLDRLGLDVIDLQLIHPSVGRWLDTWRGMIDAREAGLVRSIGVS
PE2R_RABIT      EDIFYTSKLWCT-FHRPELVRPSLEDSLKNLQLDYVDLYIIHFPTADICATWEAMEKCKDAGLAKSIGVS
AK1A1_MOUSE     EELFVTSKLWNTKHHPEDVEPA-LRKTLADLQLEYLDLYLMHWPYGDYKETWKALEVLVAKGLVKALGLS
AK1A1_RAT       EELFVTSKLWNTKHHPEDVEPA-VRKTLADLQLEYLDLYLMHWPYGDYKETWKALEALVAKGLVKALGLS
ALD1_MOUSE      EDLFIVSKLWA-TFFEKSLVKKAFQNTXXXXXXXXXXXXXVHWPQGTFLDAWEAMEELVDQGLVKALGIS
AK1CL_MOUSE     EDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMADLCATWEAMEKCKDAGLTKSIGVS
YOF5_CAEEL      EEMFLSTKLWPVDCG--DEVYNAFQTSCEKLQTDYLDMYMIHMPLPDWIKTWRQMELLYEDEHVRSIGVS
YKW2_SCHPO      TDIFLTSKL--ANCSDYYSTRAAIRSSLHHLG-TYIDLFLIQSPAGSRIASWKAMEEFVDSGDIRSVGVS
NADO2_ORYSJ     ADVFVTSKLWCSDLHAGRVVPAARE-TLRNLGMDYVDLLLVHWAPGSYDGVWRGMEECHRLGLARAIGVS
A1A1B_DANRE     EDVFVTSKLWVEPSXXYAFQRGDTPFPRKEDGLLYDDI--------DYKLTWAAMEKLVGKGLVRAIGLS
YBN4_SCHPO      TDIWVTSKLWC-NAHRAGLVPLALEKTLQDLNLEYIDAYLIHNEKGELIETWQAMEELLETGKVRYIGIS
AK1A1_HUMAN     EELFVTSKLWNTKHHPEDVEPA-LRKTLADLQLEYLDLYLMHWPYGDYKETWKALEALVAKGLVQALGLS
GCY_YEAST       EEIFVTTKLWCTQHHEPEVA---LDQSLKRLGLDYVDLYLMHWPARNFIKTWELMQELPKTGKTKAVGVS
ALDR_HORVU      KDLFVTSKIWCTNLAP-ERVRPALENTLKDLQLDYIDLYHIHWPFRDMEGVWKEMENLVKDGLVKDIGVC
AK1A1_PONAB     EELFVTSKLWNTKHHPEDVEPA-LQKTLADLQLEYLDLYLMHWPYGDYKETWKALEALVAKGLVRALGLS
ALD2_MOUSE      EDLFIVSKLWPTCFEK-KLLKEAFQXXXXXXXXXXXXXXXIHWPQGTFLEAWEGMEELVDQGLVKALGVS
YPR1_YEAST      EEIFITTKLWGTEQRD---PEAALNKSLKRLGLDYVDLYLMHWPVPNFIKTWELMQELPKTGKTKAVGVS
AK1CO_HORSE     EDIFYTSKLWL-TFLRPELVRPALEKSLTNLQLDYVDLYIIHFPIADLCATWEAMEKCKDAGLAKSIGVS
AK1A1_CHICK     EDLFVTSKLW-----NTKHHPEDVEPALRKTXXXXXXXXXXXXXMHDYKDTWKAMEKLVEKGLAKAIGLS
AKCL2_MACFA     EDLFIASKLWCT-CHKKSLVKTACRRSLKALKLNYLDLYLIHWPMGDFLDTWEAMEDLVITGLVKNIGVS
AK1CN_HORSE     EDIFCTSKLWATSL-RLQLVRPALEKSLKNLQLDYVDLYIIHFPVADLCATWEAMEKCKDAGLTKSIGVS
ALDX_SPOSA      EDLFITSKLW-NNSHRPEQVEPALDDTLKELGLEYLDLYLIHWPVGDIVDTWKAMVKLLDTGKVKAIGVS
ALD2_CRIGR      EDLFIVSKLWPTCFER-KLLKEAFQXXXXXXXXXXXXXXXIHWPQGTFLDAWEVMEELVDEGLVKALGVS
AK1A1_XENTR     EEVFVTSKLW-----NNKHHPDDVECALRKTXXXXXXXXXXXXXMHDYKDTWKAMEKLVKQGLTKAIGLS
AK1A1_XENLA     EEVFVTSKLW-----NNKHHPDDVECALRKTXXXXXXXXXXXXXMHDYKDTWKAMEKLVEKGLAKAIGLS
YJ66_YEAST      EEIFYTTKLW-NSQNGYKRAKAAIRQCLNESGLQYIDLLLIHSPLEGSLETWRAMQEAVDEGLVKSIGVS
ALDR_RABIT      EELFIVSKLWCTSH-DKSLVKGACQKTXXKHGSEYFPLDAAGNVIPDFLDTWEAMEGLVDEGLVKSIGVS
AKCL2_HUMAN     EDLFIATKLWCT-CHKKSLVETACRKSLKALKLNYLDLYLIHWPMGDFLDTWEAMEDLVITGLVKNIGVS
A1A1A_DANRE     DDIFVTSKLWNTKHHPDDVEEA-CXXXXXXXXXXXXXXXXIHWPMGDYRDTWAAMEKLVDQGLAKAIGLS
AKC1H_RAT       EDIFYTSKLW-STSHRPELVRPSLENSLRKLNLDYVDLYLIHFPVSDLCDTWEAMEKCKDAGLAKSIGVS
AKC1H_MOUSE     EDIFYTSKLW-STSHRPELVRPSLENSLRKLNLDYVDLYLIHFPVSDLCDTWEAMEKCKDAGLAKSIGVS
CRO_RANCA       EDIFYTGKLWCTYFSP-DMVRKGLERSLRDVGMDYLDLFLMHWPVSDLCATWEALEARKDAGLVRSLGVS
ALDR_RAT        QDLFIVSKLWC-TFHDQSMVKGACQKTXXKPGPDYFPLDASGNVITDFVDTWTAMEQLVDEGLVKAIGVS
AK1CL_RAT       EDIFYTSKLWCTSL-HPELVRSSLECSLKKLQLDYVDLYLIHFPMADLCATWEAMEKCKDAGLAKSIGVS
ALDR_PIG        EDLFIVSKLWCTDHEK-NLVKGACQTTXXXXXXXXXXXXXIHWPTGDFVETWEAMEELVDEGLVKAIGVS
AK1CD_MOUSE     EDLFITTKLWC-TCFRPELVKPALEKSLKKLQLDYVDLYIMHYPVPDFCDTWERLEECKDAGLVKSIGVS
ALDR_ENCCU      KDLFITSKLW---NTFHGCPEDGLRRSLNDLQMDYVDLYLIHESCGDAVGVWKKMEALVDLGLAKSIGIS
ALDR_BOVIN      EDLFIVSKLWCT-YHDKDLVKGACQKTXXKPGKDFFPLDEVIPSEKDFVDTWTAMEELVDEGLVKAIGVS
ALDR_HUMAN      EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
DIDH_RAT        EDIFYTSKLW-STFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMGDIFDTWEAMEKCKDAGLAKSIGVS
ARA1_YEAST      EDLFITTKVW---PVLWDEVDRSLNESLKALGLEYVDLLLQHAADGDYLETYKQLEKIYNDHRVRAIGVS
ALDR_MOUSE      QDLFIVSKLWC-TFHDKSMVKGAFQKTXXKPGPDYFPLDASGNVITDFVDTWTAMEQLVDEGLVKTIGVS
CRO_RANTE       EDIFYTGKLWCTYFSP-EMVRKGLERSLRDVGMDYLDLFLMHWPVSDLCATWEALEARKDAGLVRSLGVS
DKGB_SALTY      NELYITTKIWIENLSKDKLIPS-LKESLKKLRTDYVDLTLIHPSPGDAVSVMQALLEAKKQGLTREIGIS
DKGB_SALTI      NELYITTKIWIENLSKDKLIPS-LKESLKKLRTDYVDLTLIHPSPGDAVSVMQALLEAKKQGLTREIGIS
DKGB_ECOLI      HELYITTKIWIENLSKDKLIPS-LKESLQKLRTDYVDLTLIHPSPNDEVSVMQALLEAKKQGLTREIGIS
YDG7_SCHPO      KDIWVTSKLWCNAHAPEAVPKAXXXXXXXKTGEDKFDGNLIYEK-NPIEETWKAMEKLLETGKVRHIGLS
DKGB_ECO57      HELYITTKIWIENLSKDKLIPS-LKESLQKLRTDYVDLTLIHPSPNDEVSVMQALLEAKKEGLTREIGIS
AK1CD_MESAU     EDMFITTKLWC-TCFQPELVRPSLEXXXXXLQLEHVDLFIMHYPVPDFCATWEALEKXXDAGLVKSIGVS
I3ACR_SCHPO     SKLFITSKV----MHNVDNIPEALNESLRKLGTDYLDLYLLHSPIPFYSEGWKAMETALGTGLVHSVGVS
DKGB_YERPE      DELFITTKIWIANLSKDKLIPS-LRESIQKLKTDYVDLTLIHPSPNDEVSVAEFMSELLKAGLTRQIGIS
KAR_YEAST       NAIFLTDKYSPQIKMS-DSPADGLDLALKKMGTDYVDLYLLHSPFVSLEEAWKDMEQLYKSGKAKNIGVS
AK1A1_CRIGR     EELFVTSKLWNTKHHPEDV-EAALRKTLADLQLEYLDLYLMHWPYGDYKETWKALEALVAKGLVKALGLS
YHH5_SCHPO      EDITLITKI-PDSLQGFERTWKAVEQSLRRTGRPKLDVVLIHSPKWPVIESWRALLQHQKEGRINKIGVS
YEAE_ECOLI      EKVFLVSKVYPWNAGGQKAINA-CEASLRRLNTDYLDLYLLHWSGSFAFETVAAMEKLIAQGKIRRWGVS
TRAKR_HUMAN     KDIFYTTKVW-GTFSRPELVQRGLEMSLKKLQLSYMDLYLFH----------------------------
AKCL1_HUMAN     EEIFYTIKLWA-TFFRAELVHPALERSLKKLGPDYVDLFIIH----------------------------
IOLS_BACSU      EDVVIATKAAHRKQGNPDFLKKSVDESLKRLNTDYIDLFYIHDEHTPKDEAVNALNEMKKAGKIRSIGVS
YAKC_SCHPO      KEIFLATKFGYEKNPETDYIEKALDLSLKRLGIDCIDLYYVHRFSGEIEKIMGALKKCVEAGKIRYIGLS
YCCK_BACSU      NELIIATKGAHKEVDSREFLRSEVEKSLKRLKTDYIDLYYVHFPDGKTPLAEVALKELKDEGKIKAIGAS
GS69_BACSU      DQVILATKTWKNNQANRARIVEEVENSLKRLQTDYIDLYQVHDPLVPIEETAEVMKELYDAGKIRAIGVS
YDJG_ECOLI      EQVVVETKVWVGDRQLYESIREEVAASLQRLGIDYIDIYMTHQSVPPFFTTVAVLNELKSEGKIRAIGAA
YDHF_ECOLI      ERMEIVSKCGIATTADRDHIIKSAEQSLINLATDHLDLLLIHRPLMDADEVADAFKHLHQSGKVRHFGVS
YCSN_BACSU      ENIELVTKCGIHRSHHYNTSKSHILASVEQSLMDYIDMLLIHRP--DPLMDPEGVAEAFQAGKVRYFGVS
YAJO_ECOLI      EDVVVATKVFVGDLPE-GLSRASIDDSLRRLGMDYVDILQIHR--WDYNTTLEALNDVVKAGKARYIGAS
Y1669_ARATH     EEVSVATKFAALPWRGRESVVTALKDSLSRLELSSVDLYQLHPGLWGNEGYLDGLGDAVEQGLVKAVGVS
YRPG_BACSU      EKVVLATKVYENDMRGLSLYKIRLEGSLKRLQTDHIELYQMHHIRTPWDEIWEAFETQVRSGKVDYIGSS
YGHZ_ECOLI      DELIISTKMWPGPYGSGGSRKASLDQSLKRMGLEYVDIFYSHRVDENMEETASALAHAVQSGKALYVGIS
YGHZ_ECO57      DELIISTKMWPGPYGSGGSRKASLDQSLKRMGLEYVDIFYSHRVDENMEETASALAHAVQSGKALYVGIS
YQKF_BACSU      HDIILATKAWDDGSEGWDPSKAYIKEAVKKSKTDYIDLYQLHGGTDNIDETIEAFEELKQEGVIRYYGIS
ARK74_HUMAN     VKIATKANPWIGNSLKPDSVRSQLETSLKRLQCPUVDLFYLHAPSAPVEETLRACHQLHQEGKFVELGLS
YH5B_SCHPO      GGLVRTGPNEWHPCGAPKFLRQEVLMSMRRLGVKQIDLWQLHRPRKDQFSEIAAMK---KEGLIRHVGLS
YDBC_ECOLI      -------------------------------------------AEGSIEASLTVLAEMQQQGLVKHIGLS
ARK72_MOUSE     VKIATKANPWEGKSLKPDSVRSQLETSLKRLQCPRVDLFYLHAP--DHSTTLRACHQLHQEGKFVELGLS
IN22_MAIZE      EKVELATKFGVEIHGDPAYVRTACEGSFKRLGVDCIDLYYQHRTIGE-------LKKLVEEGKIKYIGLS
MORA_RABIT      ----------------------------------------------------------------KSIGVS
ARK72_HUMAN     VKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAP--DHGTTLHACQRLHQEGKFVELGLS
KCAB1_CHICK     SSLVITTKLYWGGKAETERGLSGLRASLQRLQLEYVDVVFANRPDNNMEEIVRAMTHVINQGMAMYWGTS
A115_TOBAC      DEKKAEGKRAVHGDPAY--VRAACEASLKRLDIDCIDLYYQHR---------------------------
ARK73_HUMAN     VKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLH--MPDHSTTLRACHQLHQEGKFVELGLS
KCAB2_XENLA     SSLVITTKIFWGGKAETERGLSGLKASLERLQLDYVDVVFANRPDPNMEETVRAMTHVINQGMAMYWGTS
ARK73_RAT       KIATKAAPMFGKTLKPADV-RFQLETSLKRLQCPRVDLFYLH--FPDHGTTLQACHQLHQEGKFVELGLS
KCAB2_BOVIN     SSLVITTKIFWGGKAETERGLSGLKASLERLQLEYVDVVFANRPDPNMEETVRAMTHVINQGMAMYWGTS


                         +         .         .         .         .         *         .:210
query           NFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPYENVMLQRIADA
GR_BACSU        NFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPLMQG--QLLDNEVLTQIAEK
YTBE_BACSU      NFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQG--QLLDHPVLADIAQT
P100_LEIMA      NFHIHHLEDVLAMCTVTPMVNQVELHPLNNQADLRAFCDAKQIKVEAWSPLGQG--KLLSNPILSAIGAK
DKGA_ECOLI      NFQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHAWNATHKIQTESWSPLAQGGKGVFDQKVIRDLADK
Y2407_MYCS2     NFGAEDLETIVSLTYFTPAVNQIELHPLLNQAALREVNAGYNIVTEAYGPLGVGR--LLDHPAVTAIAEA
DKGA_ECO57      NFQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHAWNATHKIQTESWSPLAQGGKGVFDQKVIRDLADK
Y2161_MYCVP     NFHAQHLDDIIGLSFFTPAVNQIELHPLLNQAELRAVNAEHGIVTEAYSPLGVG--SLLSNPAVTAIADA
Y1918_MYCSJ     NFNAEHLSNIIDLSFFTPAINQIELHPLLNQAELREVNAGYGIVTEAYGPLGVGRL--LDHAAVTGVAQA
Y1984_MYCSK     NFNAEHLSNIIDLSFFTPAINQIELHPLLNQAELREVNAGYGIVTEAYGPLGVGRL--LDHAAVTGVAQA
Y1938_MYCSS     NFNAEHLSNIIDLSFFTPAINQIELHPLLNQAELREVNAGYGIVTEAYGPLGVGRL--LDHAAVTGVAQA
YER5_SCHPO      NFGPHHIQELLDSPKIIPCVNQIELHPFCSQQKVVDYCESKGIQLAAYAPLVHG--EKFGNKQLLAIASK
XYL1_CANTR      NFTGALIYDLIRGATIKPAVLQIEHHPYLQQPKLIEYVQKAGIAPQSFLELESKRNTPFEHETIKLIADK
AK1D1_HUMAN     NFNRRQLELILNKLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVLLNSLGKR
XYL2_CANTR      NFTGALIYDLIRGATIKPAVLQIEHHPYLQQPKLIEYVQKAGIAPQSFLELESKRNTPFEHETIKSIADK
XYL1_CANSH      NFPGALLLDLFRGATIKPAVLQVEHHPYLQQPKLIEYAQKVGITPQSFVEMNQGRNTPFEHDVIKAIAAK
Y2408_MYCS2     NFEPEHLTTLIEETGIVPAVNQIELHPLLPQQELRDVHAKLGIATEAWSPLGQG--SLLADPVITGIAEQ
AK1D1_RABIT     NFNRQQLELLLNKLKHKPVCNQVECHPYFTQPKLLKFCQQHDIIIVAYSPLGTCRNPMWVNTLLNSLGKK
Y1919_MYCSJ     NFEPEHLRVLIDSTGIVPAVNQIELHPLLPQRELRELHAQLGIATEAWSPLGQGSLLAHPTVT--GVAES
Y1985_MYCSK     NFEPEHLRVLIDSTGIVPAVNQIELHPLLPQRELRELHAQLGIATEAWSPLGQGSLLAHPTVT--GVAES
MORA_PSEPU      NFLEDQLDELIAASDVVPAVNQIELHPYFAQKPLLAKNRALGIVTEAWSPXXXXRKHPLTDPVITTIAEA
GRE3_YEAST      NFQGSLIQDLLRGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPAKTTPFENDVIKKVSQN
6DCS_SOYBN      NFSVKKLQNLLSVATIRPVVDQVEMNLAWQQKKLREFCKENGIIVTAFSPLSRGPNEVMENDVLKEIAEA
Y2999_MYCTA     NFTAENIENLIDLTFVTPAVNQIELHPLLNQDELRKANAQHTVVTQSYCPLALGR--LLDNPTVTSIASE
Y2996_MYCBO     NFTAEHIENLIDLTFVTPAVNQIELHPLLNQDELRKANAQHTVVTQSYCPLALGR--LLDNPTVTSIASE
Y2993_MYCBP     NFTAEHIENLIDLTFVTPAVNQIELHPLLNQDELRKANAQHTVVTQSYCPLALGR--LLDNPTVTSIASE
Y2971_MYCTU     NFTAENIENLIDLTFVTPAVNQIELHPLLNQDELRKANAQHTVVTQSYCPLALGR--LLDNPTVTSIASE
DKGA_CORSC      NHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTXXXXX
XYL1_PICGU      NFPGALIQDLLRGAKIKPAVLQIEHHPYLQQPRLIEYVQSQGIAPQSFVELNHPRVKDFEHDVIKSVAEK
Y3816_MYCA1     NFTEEYLTTVIDLTFVTPAVNQIELHPLLNQEALRKTNAEHNVVTQSYTPLALGKLNDHPTV--NSVAAE
DKGA_SALTY      NFQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHAWNATHKIQTESWSPLAQGGEGVFDQKVIRELADK
S6PD_MALDO      NYELFLTRDCLAYSKIKPAVSQFETHPYFQRDSLVKFCMKHGVLPTAHTPLGGGSVSPLDDPVLNDVAKK
ALRC_DICDI      NFNVQNLVDLLTYAKIKPVVNQVEIHPYLTQFKLQEYCDKYEIKLVAYSPLGQGKCDFFSNKILKSIAGK
Y3007_MYCPA     NFTEEYLTTVIDLTFVTPAVNQIELHPLLNQEALRKTNAEHNVVTQSYTPLALGKLNDHPTV--NSVAAE
DKGA_YERPE      NFHIPHLQRLIDETGIAPTVNQIELHPLLQQRQLHAWNATHHIATESWSPLAQGGKGVFDQEIIRKLAQQ
Y4205_MYCGI     NFHGHHLDDIISLSFFTPAVNQIELHPLLNQAELRAVNAEHGIATEAYGPLGVGNLLSHSAV--NAIAEA
XYL1_PICST      NFPGALLLDLLRGATIKPSVLQVEHHPYLQQPRLIEFAQSRGIAPQSFVELNQGRSPLFENETIKAIAAK
DKGA_SALTI      NFQIHHLQRLIDETGVPPVINQIELHPLMQQRQLHAWNATHKIQTESWSPLAQGGEGVFDQKVIRELADK
AK1D1_MOUSE     NFNRRQLELILNKLKYKPVTNQVECHPYFTQTKLLKFCQQHDIVIVAHSPLGTCRNPSWVNVLLTSLGKK
AKCL2_PIG       NFNHEQLERLLNNLRVKPVTNQIECHPYLTQKKLISFCQSRNVSVTAYRPLGGSSEGVLEDPVIQTIAQK
XYL1_PACTA      NVSGGLLEDLIKAARIKPASLQIEHHPYYAQLKGIVVTGYSNFGPLSFLELGNETAKKYENKTITTIAAK
AK1A1_BOVIN     NFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARNLEVTAYSPLGSSDRAPEEPVLLKELAEK
AKCL2_RAT       NFNHEQLDRLLNKLRIKPITNQIECHPYLNQKSLIDFCHGRNVSVTAYRPLGGSRDGVHDDIVIRKIAKK
Y1669_MYCLE     NFTEEHLSAIIDLTFVTPAVNQIELHPLLNQDEMRKSNAQHNVITQSYTPLVLGRLM--DNSTLTAIAAE
Y1669_MYCLB     NFTEEHLSAIIDLTFVTPAVNQIELHPLLNQDEMRKSNAQHNVITQSYTPLVLGRLM--DNSTLTAIAAE
XYL1_CANTE      NFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTPQSFVEMNQGRNTPFAHDTIKAIAAK
DDBX_BOVIN      NFNHKQLEKILNKLKYKPVCNQVECHPYFNQSKLLDFCKSHDIVLVAYGALGSQRLKEWEDPVLSAIAKK
AK1C2_HUMAN     NFNHRLLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWEDPVLCALAKK
XYL1_CANPA      NFSAQLIYDLIRGCTIKPVALQIEHHPYLTQPKLVEYVQLHDIQITGYSSFGPQSFLELEEPTVKSIADK
AK1D1_RAT       NFNRRQLEVILNKLKYKPVTNQVECHPYFTQTKLLESMTSFIV---AYSPLGTCRNPLWVNVLLTSLGKK
AK1C3_PONAB     NFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWEDPVLCALAKK
AK1C1_MACFU     NFNRRQLEMILNKLKYKPVCNQVECHPYLNQRKLLDFCKSKDIVLVAYSALGSHREKPWEDPVLCALAKK
AK1C1_MACFA     NFNRRQLEMILNKLKYKPVCNQVECHPYLNQRKLLDFCKSKDIVLVAFSALGSHREKPWEDPVLCALAKK
AK1C1_HUMAN     NFNRRQLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWEDPVLCALAKK
AK1C3_HUMAN     NFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWEDPVLCALAKK
AK1BA_HUMAN     NFSHFQIEKLLNKLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRKPLEDPKIKEIAAK
Y1744_MYCMM     NFTEEHVSNVIDLTFVTPAVNQVELHPLLNQDELRKANAQHNVVTQSYTPLALGQLA--DNPTVTSIAGE
Y1987_MYCUA     NFTEEHVSNVIDLTFVTPAVNQVELHPLLNQDELRKANAQHNVVTQSYTPLALGQLA--DNPTVTSIAGE
PGFS2_BOVIN     NFNHKQLEKILNKLKYKPVCNQVECHPYLNQSKLLEFCKSHDIVLVAYAALGANSNNPVEDPVLCAIAKK
PGFS1_BOVIN     NFNHKQLEKILNKLKYKPVCNQVECHPYLNQSKLLEFCKSHDIVLVAYAALGANSNNPVEDPVLCAIAKK
ALRA_DICDI      NFNVQGLMEVLSYARIKPAANQVELHPFLSQPELKKFCDKHNIHLTAYSPLGNGAF--VDNEEVGAIAKK
AKCL2_MOUSE     NFNHEQLERLLDKLRVRPITNQIECHPYLNQKKLIDFCHKRNVSVTAYRPLGGGGFHLMDDTVIRKIAKK
AK1C1_PONAB     NFNRRQLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEKWEDPVLCALAKK
AK1C4_HUMAN     NFNCRQLEMILNKLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWEDPVLCALAKK
XYL1_ASPNG      NFSAQLVMDLLRYARIRPATLQIEHHPYLTQTRLVEYAQKEGLTVTAYSSFGNAVDSPFEHQLVKSIAEK
XYL1_KLULA      NFSGALIQDLLRGARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGKALNTPFEHDTIKSIASK
ALRB_DICDI      NFNVQNLVDLLTYAKIKPAINQVEVHPYLSQPNLKYFCDRYGIVLTAYSPLGQGKCDLLSNETLKSIADK
DTDH_MUCMU      NFNCQAILDLLTYARIKPAVLQIELHPYLPQERLVKWVKEQGIQITAYSSFGPTSYKTYEHASVKSVADK
AK1A1_PIG       NFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAPNEPVLLQALAEK
NADO1_ORYSJ     NFSAKKLEQLLSLAAVRPAVNQVEVNPMWQQRTLREVCRREGVQLCGYSPLGAGSAAVMDSGVLQEIAGA
Y4483_MYCA1     NFTEDLLATVIEETDEVPAVNQVELHPRLNQAELRQVHAQHDVTTQSYSPLGVGR--LIEEPTVTTIAAE
DHB5_MOUSE      NFNRRQLEKILKKLKYKPVCNQVECHPYLNQGKLLDFCRSKDIVLVAYSALGSHREKQWDNPVLGSMAKK
AK1C4_MACFA     NFNRRQLEMILNNLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWEDPVLCALAKK
Y4149_MYCPA     NFTEDLLATVIEETNEVPAVNQVELHPRLNQAELRQVHAQHDVTTQSYSPLGVGR--LIEEPTVTTIAAE
AK1C4_MACFU     NFNRRQLEMILNNLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWEDPVLCALAKK
XYL1_TRIRE      NYQAQSVYDALIYARIKPATLQIEHHPYLQQPDLVSLAQTEGIVVTAYSSFGPPRAKSVAPLMIKALADK
DKGB_CORSS      NFTEPMLKTLIDETGVTPAVNQVELHPYFPQAALRAFHDEHGIRTESWSPL-ARRSXXXXXXXXXXXAVV
PE2R_RABIT      NFNRRQLEMILNKLKYKPVCNQVECHPYLNQGKLLEFCKSKGIVLVAYSALGSHREPEWEDPLIGALAKK
AK1A1_MOUSE     NFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCHARGLEVTAYSPLGSSRHPDXXXXXXXXXXXX
AK1A1_RAT       NFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSRHXXXXXXXXXXXXXK
ALD1_MOUSE      NFNHFQIERLLNKLKHKPVTNQIESHPYLTQEKLIQYCQSKGIAVTAYSPLGSPDRKPEDPVVMEEIAAK
AK1CL_MOUSE     NFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWDEPVLGSMAKK
YOF5_CAEEL      NYSIEDLDELLEFASILPHANQVELHPWFHQADLKNYCDELGILTMGYCPLAKGKY--LEDETLCKIASK
YKW2_SCHPO      NYVKHLQELYASNPKFYPCVNQIELHPFLSQDDIVKYCQSHDIAIEAYSPLTHGIRLNDEK--LVPIAKK
NADO2_ORYSJ     NFSAKKLEQLLSFAVVRPAANQVEMNPMWQQRTLREVCRREGVQLCGYSPLGAGSAAVMDSGVLHDIAQT
A1A1B_DANRE     NFNSRQIDDILSVASIKPTVLQVESHPYLAQVELLSHCRDRGLVMTAYSPLGSPDRAPDEPVLLEELAKK
YBN4_SCHPO      NFNNEYLDRVLKIAKVKPTIHQMELHPYLPQTEYLEKHKKLQIHVSAYSPLANQNSKLIEHKTLVDIANA
AK1A1_HUMAN     NFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAXXXXXXXXXXXXK
GCY_YEAST       NFSINNLKDLLASQKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKK
ALDR_HORVU      NYTVTKLNRLLRSAKIPPAVCQMEMHPGWKNDKIFEACKKHGIHVTAYSPLGSSEKNLAHDPVVEKVANK
AK1A1_PONAB     NFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLAVTAYSPLGSSXXXXXXXXXXXXXXXK
ALD2_MOUSE      NFNHFQIERLLNKLKHKPVTNQVECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDRKPLEDPKIKEIAAK
YPR1_YEAST      NFSINNIKELLESPKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK
AK1CO_HORSE     NFNRRQLEMILNKLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAYGALGTQRLKRWEDPVLCAMAKK
AK1A1_CHICK     NFNSRQIDDVLSVATVKPAVLQVECHPYLAQNELIAHCQKRGLVVTAYSPLGSPDRMPDEPVLLEKLAEK
AKCL2_MACFA     NFNHEQLERLLNKLRFKPVTNQIECHPYLTQKNLISFCQSRGVSVTAYRPLGGSCEGVIDDPVIQRIAKE
AK1CN_HORSE     NFNRRQLEMILNKLKHKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAYSALGSQREHLLEDPVLCAMAKK
ALDX_SPOSA      NFDAKMVDAIIEATGVTPSVNQIERHPLLLQPELIAHHKAKNIHITAYSPLGNGAPLLVQHPEIKRIAEK
ALD2_CRIGR      NFNHFQIERILNKLKHKPVTNQVECHPYLTQEKLIEYCHSKGITVTAYSPLGSPNRKPLEDPKIKEIAAK
AK1A1_XENTR     NFNKRQIDDIISIATVKPAVLQVECHPYLAQNELIAYCHAHGLVFTGYSPLGSSWRKPEDPVLLEEMAKK
AK1A1_XENLA     NFNKRQMDDILSIATVKPAVLQVECHPYLAQNELIACCRSHGLVLTGYSPLGSSWRKPEDPVLLEEMAKK
YJ66_YEAST      NYHIDELLNWPE-LKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPLCHGYKMT--NPDLLKVCKE
ALDR_RABIT      NFNHLQIERILNKLKYKPAVNQIECHPYLTQEKLIQYCHSKGIVVTAYSPLGSPDRKPLEDPRIKAIADK
AKCL2_HUMAN     NFNHEQLERLLNKLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVIDNPVIKRIAKE
A1A1A_DANRE     NFNAKQIDDILSIAKHKPVVNQVECHPYLVQAELVSHCWSRNLTVTAYSPLGSPDRPPGEALLLDDIAKS
AKC1H_RAT       NFNRRQLEKILNKLKHRPVCNQVECHLYLNQSKLLAYCKMNDIVLVAYGALGTQRYKYLDDPILCTMAKK
AKC1H_MOUSE     NFNRRQLEMILNKLKYKPVCNQVECHLYLNQSKLLAYCKMNDIVLVAYGALGTQRYKYLDDPVLCAMAKK
CRO_RANCA       NFNRRQLERILNKLKYKPVCNQVECHVYLNQNKLHSYCKSKDIVLVTYSVLGSHRDRNWXXXXXNKIAAK
ALDR_RAT        NFNPLQIERILNKLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRKPLEDPRIKEIAAK
AK1CL_RAT       NFNRRQLEKILNKLKYKPVCNQVECHLYLNQMKLLDFCKTNGIILVAYGVLGTQRYNGWNEPVLSSMAKK
ALDR_PIG        NFNHLQVEKILNKLKYKPAVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
AK1CD_MOUSE     NFNHRQLERILNKLKYKPVCNQVECHLYLNQRKLLDYCESKDIVLVAYGALGTQRYKEWNDPVLCDVAKK
ALDR_ENCCU      NFGKANTEKILGTCRICPAAIQIELHPYLNQKELVEFMKSKGIQXXXXXXXXXXXXKVRDDKTIKAIAKK
ALDR_BOVIN      NFNHLQVEKILNKLKYKPAVNQIECHPYLTQEKLIQYCNSKGIVVTAYSPLGSPDRKPLEDPRIKAIADK
ALDR_HUMAN      NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
DIDH_RAT        NFNCRQLERILNKLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSSRDKTWDDPVLCAIAKK
ARA1_YEAST      NFSIEYLERLIKECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLVKKLAEK
ALDR_MOUSE      NFNPLQIERILNKLKYKPAVNQIECHPYLTQEKLIEYCHSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
CRO_RANTE       NFNRRQLERILNKLKYKPVCNQVECHVYLNQNKLHSYCKSKDIVLVTYSVLGSHRDRNWXXXXXNKVAAK
DKGB_SALTY      NFTIPLMEKAIAAVGADNIANQIELSPYLQNRKVVDWAKAHGIHITSYMTLAYG--KALKDEVIARIAAK
DKGB_SALTI      NFTIPLMEKAIAAVGADHIANQIELSPYLQNRKVVDWAKAHGIHITSYMTLAYG--KALKDEVIARIAVK
DKGB_ECOLI      NFTIPLMEKAIAAVGAENIANQIELSPYLQNRKVVAWAKQHGIHITSYMTLAYG--KALKDEVIARIAAK
YDG7_SCHPO      NFNDTNLERILKVAKVKPAVHQMELHPFLPQTEFVEKHKKLGIHVTAYSPFGNQNPKLIEHETIQKIAKS
DKGB_ECO57      NFTIPLMEKAIAAVGAENIANQIELSPYLQNRKVVAWAKQHGIHITSYMTLAYG--KALKDEVIARIAAK
AK1CD_MESAU     NFNMRQLERILNKLKYKPVCNQVECHVYNNQSKLLDYCKSKDIVLVAFGALGTQRYKEWNDPVLCGGAKX
I3ACR_SCHPO     NFRIPDLEELLKTSTITPRVNQIEFHPYKAAKPLVEFCQSKGIIVEGYGPLSPLVRDAQGPVFTKSLESK
DKGB_YERPE      NFTIDLMKQAIAAVGAEEIANQIELSPLLQNRNVVDFAKQNGIAVTSYMTLAYG--KALAEPVIKTIAEQ
KAR_YEAST       NFAVEDLQRILKVAEVKPQVNQIEFSPFLQNPGIYKFCQEHDILVEAYSPLGPLQKKTAQDEYVKELSEK
AK1A1_CRIGR     NFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLG------------------
YHH5_SCHPO      NYNIHHLEEIISLGLPLPAINQVEFSAFNNRPTFLSYCFNHGILVQAFSPLTRG--YXXXXXXXXXXXXK
YEAE_ECOLI      NLYADMQGNQCAT-------NQVLYHSRGIEYDLLPWCQQQQMPVMAYSPLGRLRNGLLKNAVVNEIAHA
TRAKR_HUMAN     ----------------------------------------------------------------------
AKCL1_HUMAN     ----------------------------------------------------------------------
IOLS_BACSU      NFSLEQLKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPLVSGGERFKENIKLAPIAEK
YAKC_SCHPO      ECSANTIRRAAAVYPVSAV--QVEYSPFSPEIGVMKACRENNITIVCYAPLGRGRKAPYKNLELEKIATA
YCCK_BACSU      NLDYQQLQDFNADGYLEVFQAEYSLIQRDAEKELLPYCEKQGISFIPYFPLASGKDKPIHNLKLKAVAEE
GS69_BACSU      NFSIEQMDTF------------------------------------------------------------
YDJG_ECOLI      NVDADHIREYLQYGELDIIQAKYSILDRAMENELLPLCRDNGIVVQVYSPLGGARANKVENMLWQPLCAR
YDHF_ECOLI      NFTPAQFALLQSRLPFTLATNQVEIHXXXXXXXXXXXXXXXRVRPMAWSCLGGGRFQPLRDELAVVAEEL
YCSN_BACSU      NFKDHQYRMLESYLPEKLVTNQIELSAYELEDGTLNLCQEKRIPPMAWSPLAGGKVFTENTDKDRRVRTA
YAJO_ECOLI      SMHASQFAQALELQKQHGWAQFVSMQDHYEEREMLPLCYQEGVAVIPWSPLARGRTRPWGETTARLVSDE
Y1669_ARATH     NYSEKRLRDAYERLKIPLASNQVNYSLIYRAPGVKAACDELGVTLIAYSPISGPRGRIYTREFLKQIGEN
YRPG_BACSU      NFAGHLVKAQAEAEKRRFMGLVTEQHKYTAEMEVLPAARDLGLGVVAWSP--------------------
YGHZ_ECOLI      SYSPERTQKMVELLRIPLLIHQPSLNRWVDKSGLLDTLQNNGVGCIAFTPLAQGMHREGNKVLLNEMAQQ
YGHZ_ECO57      SYSPERTQKMVELLKIPLLIHQPSLNRWVDKSGLLDTLQNNGVGCIAFTPLAQGMHREGNKVLLNEMAQQ
YQKF_BACSU      SIRPNVIKEYVKKSNIVSIMMQFSL---------------------------------------------
ARK74_HUMAN     NYAAWEVAEICTLCKILPTVYQ---GMYSATTRQVETLRHFGLRFYAYNPLAGG----------------
YH5B_SCHPO      EV---TVDDIKEAEQYFPVVSVQNLFNLVKNEKVLEYCEQKGIAFIPWYPLASGAAKP--GTILDAVSKD
YDBC_ECOLI      NVTPTQVAEARKIAEIVCVQNEYNI-AHRADDAMIDALAHDGIAYVPFFPLGG--FTPLQSSTLSDVAAS
ARK72_MOUSE     NYASWEVAEICTLCKILPTVYQGMYNATTRQVEALPCLRHFGLRFYAYNPLAGG----------------
IN22_MAIZE      EASASTIRRAHAVHPITAVQLEWSLWSRDAEEDIIPTCRELGIGIVAYSPLGRG----------------
MORA_RABIT      NF------------NHKRVXNQVEXHPYLNQSKDIVLV--------AYSALGSSR-------------DP
ARK72_HUMAN     NYASWEVAEICTLCKILPTVYQ---GMYNATTRQVETLRHFGLRFYAYNPLAGG----------------
KCAB1_CHICK     RWSAMEIMEAYSVARIPPVCEQAEYHLFQREKVEVQLPELYHVGAMTWSPLACG----------------
A115_TOBAC      ----------------------------------------------------------------------
ARK73_HUMAN     NYAAWEVAEICTLCKILPTVYQ---GMYNAITRQVETLRHFGLRFYAFNPLAGG----------------
KCAB2_XENLA     RWSSMEIMEAYSVARIPPICEQAEYHMFQREKVEVELFHKIGVGAMTWSPLACG----------------
ARK73_RAT       NYVSWEVAEICTLCKIMPTVYQ---GMYNAITRQVETLRHFGLRFYAFNPLAGG----------------
KCAB2_BOVIN     RWSSMEIMEAYSVARIPPICEQAEYHMFQREKVEVELFHKIGVGAMTWSPLACG----------------


                         .         .         .         +         .         .         .:280
query           HQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGYVGEAVKHFNPEFxx
GR_BACSU        HNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDMDKIDALN-----------------
YTBE_BACSU      YNKSVAQIILRWDLQHGIITIPKSTKEHRIKENASVFDFELTQDDMNRIDALN-----------------
P100_LEIMA      YNKTAAQVILRWNIQKNLITIPKSVHRERIEENADIFDFELGAEDVMSIDALN-----------------
DKGA_ECOLI      YGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAENFDVWDFRLDKDELGEIAKLDQG---------------
Y2407_MYCS2     HGRTAAQVLLRWSIQLGNVVISRSANPERIASNLDVFGFELTADEMETLNGLDDG---------------
DKGA_ECO57      YGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAENFDVWDFRLDKDELGEIAKLDQG---------------
Y2161_MYCVP     QDRTPAQVLIRWSLQLGNVVISRSSSPERIKSNLDVFDFELTADQMAALDGLDEG---------------
Y1918_MYCSJ     HDKTPAQVLLRWSIQLGNVVIARSANPDRITSNLEVFDFELTDDEMATLNGLDEG---------------
Y1984_MYCSK     HGKTPAQVLLRWSIQLGNVVIARSANPDRITSNLEVFDFELTDDEMATLNGLDEG---------------
Y1938_MYCSS     HGKTPAQVLLRWSIQLGNVVIARSANPDRITSNLEVFDFELTDDEMATLNGLDEG---------------
YER5_SCHPO      YNKSEAQIMIRYCLQRGFIVLPKSSTPRRIKENGDVFDFEISKEDMEKLYNLDEDY--------------
XYL1_CANTR      HGKSPAQVLLRWATQRNIAVIPKSNNPERLAQNLSVVDFDLTKDDLDNIAKLDIG---------------
AK1D1_HUMAN     YNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALN-----------------
XYL2_CANTR      HGKSPAQVLLRWATQRNIAVIPKSNNPERLAQNLSVVDFDLTKDDLDNIAKLDIG---------------
XYL1_CANSH      HNKVPAEVLLRWSAQRGIAVIPKSNLPERLVQNRSFNDFELTKEDFEEISKLDI----------------
Y2408_MYCS2     HGKTPAQVLIRWHIQLGNIVIPKSVNPERIASNFDVFDFELSGQDITSIASLETG---------------
AK1D1_RABIT     YKKTAAQIVLRFNVQRGVVVIPKSFNPERIKENFQIFDFSLTEEEMKDIEALNVRYVELLMWRDHPEY--
Y1919_MYCSJ     HGKTAAQALIRWHMQLGNIVIPKSVNPQRIESNFDVFDFELSEQDMASISSLDASRLGPDPKTFN-----
Y1985_MYCSK     HGKTAAQALIRWHMQLGNIVIPKSVNPQRIESNFDVFDFELSEQDMASISSLEDGRLGPDPKTFN-----
MORA_PSEPU      HGRSAAQVILRWHFQNDVVAIPKSVNPERIAKNIDVFDFALSDAEMAQLDELDTG---------------
GRE3_YEAST      HPSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIKKFTLTEQELKDISALN-----------------
6DCS_SOYBN      HGKSIAQVSLRWLYEQGVTFVPKSYDKERMNQNLHIFDWALTEQDHHKISQI------------------
Y2999_MYCTA     YVKTPAQVLLRWNLQLGNAVVVRSARPERIASNFDVFDFELAAEHMDALGGLNDG---------------
Y2996_MYCBO     YVKTPAQVLLRWNLQLGNAVVVRSARPERIASNFDVFDFELAAEHMDALGGLNDG---------------
Y2993_MYCBP     YVKTPAQVLLRWNLQLGNAVVVRSARPERIASNFDVFDFELAAEHMDALGGLNDG---------------
Y2971_MYCTU     YVKTPAQVLLRWNLQLGNAVVVRSARPERIASNFDVFDFELAAEHMDALGGLNDG---------------
DKGA_CORSC      HGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDPG---------------
XYL1_PICGU      ANKTPAQVLLRWATQRGLAVIPKSNNPDRLLSNLKVNDFDLSQEDFKEISKLDI----------------
Y3816_MYCA1     YGKTASQVLLRWNLQLGNAVIFRSANAEHIASDFDVFDFELAAEHMDAINALNDG---------------
DKGA_SALTY      YGKTPAQIVIRWHLDCGLVVIPKSVTPSRIAENFAVWDFRLDKDELGEIAKLDQG---------------
S6PD_MALDO      YGKSVAQICLRWGIQRKTAVIPKSSKIQRLKENLEVLEFQLSDEDMQLIYSIDRKY--------------
ALRC_DICDI      YKKSVANVIFKWLNQRGIAAIPKSGNHSRIIENFNIFDFQLSNDDIEKINSLN-----------------
Y3007_MYCPA     YGKTASQVLLRWNLQLSNAVIFRSANAEHIASDFDVFDFELAAEHMDAINALNDG---------------
DKGA_YERPE      YNKTPAQIVIRWHLDSGLIVIPKSVTPARIRENFEVFDFKLQKEELLAITKLDCG---------------
Y4205_MYCGI     HGRTPAQVLIRWSLQLGNXXXXXXXXXXXXXXXXDVFGFELSEEQMSTLNGLDDG---------------
XYL1_PICST      HGKSPAQVLLRWSSQRGIAIIPKSNTVPRLLENKDVNSFDLDEQDFADIAKLDI----------------
DKGA_SALTI      YGKTPAQIVIRWHLDCGLVVIPKSVTPSRIAENFAVWDFRLDKDELGEIAKLDQG---------------
AK1D1_MOUSE     YNKTQAQIVLRFNIQRGIVVIPKSFTPERIKENFQIFDFSLTEEEMKDIDALNVRYVELLMWSDHPEY--
AKCL2_PIG       HGKSAAQILIRFQIQRNVIVIPKSVNPKRILENFQVFDFELSEQDMTDLLGLD-----------------
XYL1_PACTA      HGKTPFQVLLRWVNQRGIAIIPKSTFPNTLAVNLHVDEFDLTKEDFEEIAKLD-----------------
AK1A1_BOVIN     HGRSPAQILLRWQVQRKVSCIPKSVTPSRILENIQVFDFTFSPEEMKQLDALN-----------------
AKCL2_RAT       HGKSPAQILIRFQIQRNLIVIPKSVNPSRIRENIQVFDFELTEKDMEELLSLD-----------------
Y1669_MYCLE     YGKTPAQVLLRWNLQLGNAVVFRSAKAEHIASNFDVFDFELAVNHMDAMNELHDG---------------
Y1669_MYCLB     YGKTPAQVLLRWNLQLGNAVVFRSAKAEHIASNFDVFDFELAVNHMDAMNELHDG---------------
XYL1_CANTE      YNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIG---------------
DDBX_BOVIN      HRQTPALVALRYQIQRGVVVLAKSYNKKRIKENIQVFDFELTPEDMKAIDGLN-----------------
AK1C2_HUMAN     HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN-----------------
XYL1_CANPA      HGKSPAQVLLRYQTQRGIAVIPRSNSPDRMAQNLSVIDFELTQDDLQAIAELD-----------------
AK1D1_RAT       YNKTQAQIVLRFDIQRGLVVIPKSTTPERIKENFQIFDFSLTKEEMKDIEALN-----------------
AK1C3_PONAB     HKRTPALIALRYQLQRGVVVLAKSYNEQRIRENVQVFEFQLTAEDMRAIDGLN-----------------
AK1C1_MACFU     HKRTPALIALRYQLQRGVVVLAKSYNEQRIRENMKVFEFQLTSEDMKAIDGLD-----------------
AK1C1_MACFA     HKRTPALIALRYQLQRGVVVLAKSYNEQRIRENMKVFEFQLTSEDMKAIDGLD-----------------
AK1C1_HUMAN     HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN-----------------
AK1C3_HUMAN     HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD-----------------
AK1BA_HUMAN     HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATI---------------------
Y1744_MYCMM     YGKTPTQVLLRWNLQLGNAVIFGSSNAEHIATNLDVFEFELASQHMDAINGLNDG---------------
Y1987_MYCUA     YGKTPTQVLLRWNLQLGNAVIFGSSNAEHIVTNLDVFEFELASQHMDAINGLNDG---------------
PGFS2_BOVIN     HKQTPALVALRYQVQRGVVVLAKSFNKKRIKENMQVFDFELTPEDMKAIDGLN-----------------
PGFS1_BOVIN     HKQTPALVALRYQVQRGVVVLAKSFNKKRIKENMQVFDFELTPEDMKAIDGLN-----------------
ALRA_DICDI      YNKTIPNVLCKWAIQKNFSVIPKSSTPSRVAENFDLFNFEIEEADMLFLDKMD-----------------
AKCL2_MOUSE     HGKSPAQILIRFQIQRNLIVIPKSVTPSRIRENIQVFDFELTEKDMEELLSLD-----------------
AK1C1_PONAB     HKQTPALIALRYQLQRGVVVLAKSYNEQRIRQNMQVFDFQLTSEDMKTIDGLN-----------------
AK1C4_HUMAN     HKRTPALIALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLNRNY--------------
XYL1_ASPNG      HGRTPAQVLLRWATQRGIAVIPKSNNPQRLKQNLDVTGWNLEEEEIKAISGLDRG---------------
XYL1_KLULA      HKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDLTLTDDELKQISGLN-----------------
ALRB_DICDI      HNKTVANVIFKWLNQRGIVTIPKSSNPARIIENFNIFDFQLSNEDMDKINSLN-----------------
DTDH_MUCMU      HNVSTGQVLLRWALDREFAVIPKSVNAGRMKANLEILDIKLDAEDNKTLDSL------------------
AK1A1_PIG       YNRSPAQILLRWQVQRKVICIPKSVTPSRIPQNIQVFDFTFSPEEMKQLDALN-----------------
NADO1_ORYSJ     KGKTLAQICLRWLYEQGDVLLVKTYNEKRMKENLDIFNWELTDEERERISQL------------------
Y4483_MYCA1     YGRTPAQVLVRWNLQLDNVVVSRSSKPERVAENLDVFDFTLEPEHMEAIEGLHDG---------------
DHB5_MOUSE      YNRTPALIALRYQLQRGVVVLAKSFSEKRIKENMQVFEFQLTSEDMKVLDDLNIRYISGSSFKDHPDF--
AK1C4_MACFA     HKRSPALIALRYQLQRGVVVLAKSYNEQRIRENVQVFEFQLTSEDMKVLDDLNRNF--------------
Y4149_MYCPA     YGRTPAQVLVRWNLQLDNVVVSRSSKPERVAENLDVFDFTLEPEHMEAIEGLHDG---------------
AK1C4_MACFU     HKRSPALIALRYQLQRGVVVLAKSYNEQRIRENVQVFEFQLTSEDMKVLDDLNRNF--------------
XYL1_TRIRE      HRRTPAQVLLRWATQRGIAVIPKTSRPEVMAQNLDNTSFDLDSEDLAKIADMDL----------------
DKGB_CORSS      YGVTPTQVVLRWHVQLGSTPIPKSADPDRQRENADVFGFALTADQVDAISGLERG---------------
PE2R_RABIT      HQQTPALIALRYQLQRGIVVLAKSFTEKRIKENIQVFEFQLPSEDMKVIDSLNRNF--------------
AK1A1_MOUSE     HGRSPAQILLRWQVQRKVICIPKSINPSRILQNIQVFDFTFSPEEMKQLDALN-----------------
AK1A1_RAT       HGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALN-----------------
ALD1_MOUSE      HKKTVAQVLIRFHVQRNVVVIPKSVTPSRIQENLQVFDFQLSEEDMAAI---------------------
AK1CL_MOUSE     YNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNMRYIPAAIFKGHPNW--
YOF5_CAEEL      YQKSPAQICLRWSIQQNVPTVPKSTDCRRLKENTNVFDFELSAEDMNTLNS-------------------
YKW2_SCHPO      LNISVAQLLIRWSLQKGYIPIIKSTKKEHMLSDLDVFNFTIPDDVVQELSSFD-----------------
NADO2_ORYSJ     KGKTLAQICLRWMYEQGDVLLVKTYNENRMKENLDIFDWELTEEERDKISKL------------------
A1A1B_DANRE     YNKTPAQIIIRWQTQRGVVTIPKSITQSRIKENIQVFDFTLESEEMSQVTALHRGW--------------
YBN4_SCHPO      RGETPANIAISWAVKRGTSVLPKSVNESRIVSNFLY--IPLTDKEMEAIN--------------------
AK1A1_HUMAN     YGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALN-----------------
GCY_YEAST       NNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFE-------------------------
ALDR_HORVU      LNKTPGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEED-------------------------
AK1A1_PONAB     YGGSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALN-----------------
ALD2_MOUSE      HEKTSAQVLIRFHIQRNVVVIPKSVTPSRIQENIQVFDFQLSDEEMATI---------------------
YPR1_YEAST      HGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKTISNL------------------
AK1CO_HORSE     YKRTPALIALRYLLQRGVVVLAKSYNEKRIKENMQVFEFQLTSEDMKDLDGLN-----------------
AK1A1_CHICK     YKKSPAQILLRWQAQRKVVTIPKSVTPARILQNLQVFDFSLTEEEMSHVGSLN-----------------
AKCL2_MACFA     HSKSPAQILIRFQTQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLD-----------------
AK1CN_HORSE     YKRTPALIALRYQLQRGVVVLAKSYNEKRIKENVQAFGFQLTSEDMKVLDGLNLRYVTLEMFAGHPEY--
ALDX_SPOSA      NGCTPAQVLIAWAIVGGHSVIPKSVTPSRIGENFK--QVSLSQEDVDAVSKLGEG---------------
ALD2_CRIGR      HKKTSAQVLIRFHIQRNVVVIPKSVTPARIHENFQVFDFQLSDQEMATI---------------------
AK1A1_XENTR     YGKSEAQILLRWQVQRKVVSIPKSVTPTRILQNFQVFDFSLSEEEMQLIGALN-----------------
AK1A1_XENLA     YNISEAQILLRWQVQRRVVTIPKSVTPARILQNLQVFDFSLSEEEMQLIGALN-----------------
YJ66_YEAST      VDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSDEQM------------------------
ALDR_RABIT      HKKTTAQVLIRFPMQRNLVVIPKSVTPARIAENFQVFDFELSSEDMTTL---------------------
AKCL2_HUMAN     HGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLN-----------------
A1A1A_DANRE     YNKTPAQVIIRWHIQRGVVCIPKSVTPSRIKQNIEVFDFKLSDEDMRLIESFN-----------------
AKC1H_RAT       YKRTPALIALRYQLERGIVTLVKSFNEERIRENLQVFDFQLASDDMEILDNLD-----------------
AKC1H_MOUSE     YKRTPALIALRYQLDRGIVALAKSFNEERIRENMQVFDFQLASDDMKILDGLD-----------------
CRO_RANCA       YNRTSAEVAMRFILQKGIVVLAKSFTPARIKQNLGVFEFELKPEDMKTLESLD-----------------
ALDR_RAT        YNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATL---------------------
AK1CL_RAT       YNQTPALIALRHQLQRGIVVLNTSLKEERIKEN-----MKLSPEDMKVLDDLNLRYIAGGIFEGHPNF--
ALDR_PIG        YNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDM------------------------
AK1CD_MOUSE     NKRSPALIALRYLIQRGIVPLAQSFKENEMRENLQVFGFQLSPEDMKTLDGLNKNF--------------
ALDR_ENCCU      YGCAPSQIILSYITAQGICVIPKSRSKEHLRENIDLKELSRED--ISAIDALNTGHRYVDPPGFGPE---
ALDR_BOVIN      YNKTTAQVLIRFPIQRNLIVIPKSVTPERIAENFQVFDFELDKEDM------------------------
ALDR_HUMAN      HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
DIDH_RAT        YKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYFD-----
ARA1_YEAST      YNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEF--ASLTKDELQELN--DFGFIDEPFAAILPEF--
ALDR_MOUSE      YNKTTAQVLIRFPIQRNLVVIPKSVTPVRIAENLKVFDFEVSSEDMATL---------------------
CRO_RANTE       YNRTSAEIAMRFILQKGIVVLAKSFTPARIKQNLGVFEFELKPEDMKSLESLD-----------------
DKGB_SALTY      HNATPAQVILAWAMGEGYSVIPSSTRRENLASSLLAQDLHLDAEDKNAIAALD-----------------
DKGB_SALTI      HNATPVQVILAWAMGEGYSVIPSSTRRENLASNLLAQDLHLDAEDKNAIAALD-----------------
DKGB_ECOLI      HNATPAQVILAWAMGEGYSVIPSSTKRKNLESNLKAQNLQLDAEDKKAIAALD-----------------
YDG7_SCHPO      KGETGATIAVSWAITRGTSVIPKSVNEQRIKSNFKY--IPLTKEDMDEINSIGI----------------
DKGB_ECO57      HNATPAQVILAWAMGEGYSVIPSSTKRENLESNLKAQNLQLDAEDKKAIAALD-----------------
AK1CD_MESAU     XXRSPALIALRYLVQRGVVPLAQSFYESEMKENLQVFEFQLSPEDMKILDGLNKNF--------------
I3ACR_SCHPO     YHVSDTQILLKWAYSKGVIPITTTSKIERMKECLNFDSFTLDKADIDELGTL------------------
DKGB_YERPE      HGATPAQVILSWAMQLGYGVIPSSTKAANLASNLLAQKLCLNAADMALIATLD-----------------
KAR_YEAST       YIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEVDKITELGL----------------
AK1A1_CRIGR     ----------------------------------------------------------------------
YHH5_SCHPO      YNKTPANILLRYCLQKGVSPIFKASSFVHIHENVKAEQFMLDPSDMDVMDTWDEEFVSK-----------
YEAE_ECOLI      HNISAAQVLLAWVIHQGVMAIPKAATIAHVQQNAAVLEVELSSAELAMLD--------------------
TRAKR_HUMAN     ----------------------------------------------------------------------
AKCL1_HUMAN     ----------------------------------------------------------------------
IOLS_BACSU      HNVDIPHIVLAWYLARPEILIPGAKRADQLIDNIKTADVTLSQEDISFIDKL------------------
YAKC_SCHPO      NNITPGQLSLAWLLAQGILPIPGTKRVKYLEENFGALKVKLSDATVKEI---------------------
YCCK_BACSU      KQADTAHVALAWLLTRPAAIIPGAKRPEQLQDNLKTLNIELTEDEV------------------------
GS69_BACSU      ----------------------------------------------------------------------
YDJG_ECOLI      YQCTIPTLALAWILKQSISILSGATAPEQVRENVAALNINLSD---------------------------
YDHF_ECOLI      NAGSIEQVVYAWVLRLPSQPLPGSGKIERVRAAVEAETLKMTRQQWFRIRKAALGY--------------
YCSN_BACSU      LESSLDEVMYAWTHPAGIMPIVGSGKRERISAAINALSYKLDQDQWFRIFTAVQGY--------------
YAJO_ECOLI      VGKTRAQVALAWLLSKPGIAAPGTSREEQLDELLNAVDITLKPEQIAEL---------------------
Y1669_ARATH     YSKTPTQIALNWLVAQGVIPIPGAKNAEQAKEFAGAIGWSLTDNEVSELRSL------------------
YRPG_BACSU      ----------------------------------------------------------------------
YGHZ_ECOLI      RGQSMAQMALSWLLKRVTSVLIGASRAEQLEENVALNNLTFSTKELAQID--------------------
YGHZ_ECO57      RGQSMAQMALSWLLERVTSVLVGASRAEQLEENVALNNLTFSTEELAQID--------------------
YQKF_BACSU      ----------------------------------------------------------------------
ARK74_HUMAN     ----------------------------------------------------------------------
YH5B_SCHPO      LDRSTSQIALSWVLQRSPVMIPGTSKVDHLEENVKAAGIQLSSEVFAKLD--------------------
YDBC_ECOLI      LGATPMQVALAWLLQRNILLIPGTSSVAHLRENMAAEKLHLSEEVLSTLDGI------------------
ARK72_MOUSE     ----------------------------------------------------------------------
IN22_MAIZE      ----------------------------------------------------------------------
MORA_RABIT      WKQSPALIALRYQLQRGVVVLAKSF----IEREIKVFGFQLSSEDM------------------------
ARK72_HUMAN     ----------------------------------------------------------------------
KCAB1_CHICK     ----------------------------------------------------------------------
A115_TOBAC      ----------------------------------------------------------------------
ARK73_HUMAN     ----------------------------------------------------------------------
KCAB2_XENLA     ----------------------------------------------------------------------
ARK73_RAT       ----------------------------------------------------------------------
KCAB2_BOVIN     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxx
GR_BACSU        ---------
YTBE_BACSU      ---------
P100_LEIMA      ---------
DKGA_ECOLI      ---------
Y2407_MYCS2     ---------
DKGA_ECO57      ---------
Y2161_MYCVP     ---------
Y1918_MYCSJ     ---------
Y1984_MYCSK     ---------
Y1938_MYCSS     ---------
YER5_SCHPO      ---------
XYL1_CANTR      ---------
AK1D1_HUMAN     ---------
XYL2_CANTR      ---------
XYL1_CANSH      ---------
Y2408_MYCS2     ---------
AK1D1_RABIT     ---------
Y1919_MYCSJ     ---------
Y1985_MYCSK     ---------
MORA_PSEPU      ---------
GRE3_YEAST      ---------
6DCS_SOYBN      ---------
Y2999_MYCTA     ---------
Y2996_MYCBO     ---------
Y2993_MYCBP     ---------
Y2971_MYCTU     ---------
DKGA_CORSC      ---------
XYL1_PICGU      ---------
Y3816_MYCA1     ---------
DKGA_SALTY      ---------
S6PD_MALDO      ---------
ALRC_DICDI      ---------
Y3007_MYCPA     ---------
DKGA_YERPE      ---------
Y4205_MYCGI     ---------
XYL1_PICST      ---------
DKGA_SALTI      ---------
AK1D1_MOUSE     ---------
AKCL2_PIG       ---------
XYL1_PACTA      ---------
AK1A1_BOVIN     ---------
AKCL2_RAT       ---------
Y1669_MYCLE     ---------
Y1669_MYCLB     ---------
XYL1_CANTE      ---------
DDBX_BOVIN      ---------
AK1C2_HUMAN     ---------
XYL1_CANPA      ---------
AK1D1_RAT       ---------
AK1C3_PONAB     ---------
AK1C1_MACFU     ---------
AK1C1_MACFA     ---------
AK1C1_HUMAN     ---------
AK1C3_HUMAN     ---------
AK1BA_HUMAN     ---------
Y1744_MYCMM     ---------
Y1987_MYCUA     ---------
PGFS2_BOVIN     ---------
PGFS1_BOVIN     ---------
ALRA_DICDI      ---------
AKCL2_MOUSE     ---------
AK1C1_PONAB     ---------
AK1C4_HUMAN     ---------
XYL1_ASPNG      ---------
XYL1_KLULA      ---------
ALRB_DICDI      ---------
DTDH_MUCMU      ---------
AK1A1_PIG       ---------
NADO1_ORYSJ     ---------
Y4483_MYCA1     ---------
DHB5_MOUSE      ---------
AK1C4_MACFA     ---------
Y4149_MYCPA     ---------
AK1C4_MACFU     ---------
XYL1_TRIRE      ---------
DKGB_CORSS      ---------
PE2R_RABIT      ---------
AK1A1_MOUSE     ---------
AK1A1_RAT       ---------
ALD1_MOUSE      ---------
AK1CL_MOUSE     ---------
YOF5_CAEEL      ---------
YKW2_SCHPO      ---------
NADO2_ORYSJ     ---------
A1A1B_DANRE     ---------
YBN4_SCHPO      ---------
AK1A1_HUMAN     ---------
GCY_YEAST       ---------
ALDR_HORVU      ---------
AK1A1_PONAB     ---------
ALD2_MOUSE      ---------
YPR1_YEAST      ---------
AK1CO_HORSE     ---------
AK1A1_CHICK     ---------
AKCL2_MACFA     ---------
AK1CN_HORSE     ---------
ALDX_SPOSA      ---------
ALD2_CRIGR      ---------
AK1A1_XENTR     ---------
AK1A1_XENLA     ---------
YJ66_YEAST      ---------
ALDR_RABIT      ---------
AKCL2_HUMAN     ---------
A1A1A_DANRE     ---------
AKC1H_RAT       ---------
AKC1H_MOUSE     ---------
CRO_RANCA       ---------
ALDR_RAT        ---------
AK1CL_RAT       ---------
ALDR_PIG        ---------
AK1CD_MOUSE     ---------
ALDR_ENCCU      ---------
ALDR_BOVIN      ---------
ALDR_HUMAN      ---------
DIDH_RAT        ---------
ARA1_YEAST      ---------
ALDR_MOUSE      ---------
CRO_RANTE       ---------
DKGB_SALTY      ---------
DKGB_SALTI      ---------
DKGB_ECOLI      ---------
YDG7_SCHPO      ---------
DKGB_ECO57      ---------
AK1CD_MESAU     ---------
I3ACR_SCHPO     ---------
DKGB_YERPE      ---------
KAR_YEAST       ---------
AK1A1_CRIGR     ---------
YHH5_SCHPO      ---------
YEAE_ECOLI      ---------
TRAKR_HUMAN     ---------
AKCL1_HUMAN     ---------
IOLS_BACSU      ---------
YAKC_SCHPO      ---------
YCCK_BACSU      ---------
GS69_BACSU      ---------
YDJG_ECOLI      ---------
YDHF_ECOLI      ---------
YCSN_BACSU      ---------
YAJO_ECOLI      ---------
Y1669_ARATH     ---------
YRPG_BACSU      ---------
YGHZ_ECOLI      ---------
YGHZ_ECO57      ---------
YQKF_BACSU      ---------
ARK74_HUMAN     ---------
YH5B_SCHPO      ---------
YDBC_ECOLI      ---------
ARK72_MOUSE     ---------
IN22_MAIZE      ---------
MORA_RABIT      ---------
ARK72_HUMAN     ---------
KCAB1_CHICK     ---------
A115_TOBAC      ---------
ARK73_HUMAN     ---------
KCAB2_XENLA     ---------
ARK73_RAT       ---------
KCAB2_BOVIN     ---------