[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF69712.1

[Show Plain Result]


## Summary of Sequence Search
    1::3824
  562::2348    4e-27  23% 3971 aa  YHU2_SCHPO RecName: Full=Uncharacterized threonine-rich GPI-anchored
  289::1043    3e-23  28% 1283 aa  YBKF_SCHPO RecName: Full=Putative cell agglutination protein
  314::1180    8e-22  29% 1200 aa  HYAL_STRPU RecName: Full=Hyalin;Flags: Fragment;
  622::1139    4e-18  23% 1162 aa  TCNA_TRYCR RecName: Full=Sialidase;         EC=3.2.1.18;AltName:
   68::961     2e-16  28% 2021 aa  OMPA_RICCN RecName: Full=Outer membrane protein A;AltName: Full=rOmp
  622::972     1e-14  32% 1220 aa  YKL1_SCHPO RecName: Full=Putative cell agglutination protein
 3878::4852    3e-14  27% 6254 aa  MUC19_HUMAN RecName: Full=Mucin-19;         Short=MUC-19;Flags:
 1072::2001    4e-14  27% 2660 aa  YEEJ_ECO57 RecName: Full=Uncharacterized protein yeeJ;
10635::7325    6e-11  29% 13100 aa  DIG1_CAEEL RecName: Full=Mesocentin;Flags: Precursor;
  673::1441    1e-10  25% 2358 aa  YEEJ_ECOLI RecName: Full=Uncharacterized protein yeeJ;
   80::684     9e-10  30% 1255 aa  MUC1_HUMAN RecName: Full=Mucin-1;         Short=MUC-1;AltName:
   18::442     2e-08  29%  676 aa  MUC1_MESAU RecName: Full=Mucin-1;         Short=MUC-1;AltName:
  321::798     7e-08  27% 1339 aa  RGAG1_MOUSE RecName: Full=Retrotransposon gag domain-containing
  763::969     9e-08  31% 1090 aa  GUXB_CELFI RecName: Full=Exoglucanase B;         EC=3.2.1.91;AltName:
  263::725     2e-07  23% 1388 aa  RGAG1_HUMAN RecName: Full=Retrotransposon gag domain-containing
 5828::6112    2e-07  28% 9159 aa  HMU_HALWD RecName: Full=Halomucin;Flags: Precursor;
 1119::1562    4e-07  27% 1902 aa  P2P_LACPA RecName: Full=PII-type proteinase;       
 1154::1431    9e-07  28% 1433 aa  SUBF_BACSU RecName: Full=Bacillopeptidase F;       
  259::868     3e-06  26% 1654 aa  OMPB_RICRI RecName: Full=Outer membrane protein B;AltName: Full=rOmp
  989::1475    5e-06  24% 1775 aa  INLI_LISMF RecName: Full=Internalin-I;Flags: Precursor;
  364::664     6e-06  30%  725 aa  Y1033_SULSO RecName: Full=Kelch domain-containing protein
  466::773     1e-05  27%  985 aa  INVA_YERPS RecName: Full=Invasin;
  286::426     1e-05  35%  530 aa  HYAL_LYTVA RecName: Full=Hyalin;Flags: Fragment;
  137::451     2e-05  26%  465 aa  SLAP_LACBR RecName: Full=S-layer protein;AltName: Full=Surface layer
 1106::1555    3e-05  27% 1902 aa  P2P_LACLC RecName: Full=PII-type proteinase;       
 1106::1555    4e-05  27% 1962 aa  P3P_LACLS RecName: Full=PIII-type proteinase;       
  702::1115    5e-05  23% 1733 aa  SDRF_STAEP RecName: Full=Serine-aspartate repeat-containing protein
 1106::1555    5e-05  26% 1902 aa  P1P_LACLC RecName: Full=PI-type proteinase;       
  173::400     1e-04  29%  957 aa  MAGE1_MACFA RecName: Full=Melanoma-associated antigen E1;AltName:
  409::700     2e-04  29%  738 aa  YO13_BPL2 RecName: Full=Uncharacterized 81.3 kDa protein;AltName:
 4479::4660    2e-04  25% 22152 aa  MUC16_HUMAN RecName: Full=Mucin-16;         Short=MUC-16;AltName:
  131::401     2e-04  34% 1036 aa  HPI2_DEIRA RecName: Full=Hexagonally packed intermediate-layer
  237::362     3e-04  37%  670 aa  VG50_ICHV1 RecName: Full=Uncharacterized gene 50 protein;
  481::892     3e-04  25%  948 aa  HPI1_DEIRA RecName: Full=Hexagonally packed intermediate-layer
 1567::1752    3e-04  30% 3343 aa  CADH3_CAEEL RecName: Full=Cadherin-3;Flags: Precursor;
  702::1115    3e-04  23% 1633 aa  SDRF_STAES RecName: Full=Serine-aspartate repeat-containing protein
  522::675     3e-04  34%  939 aa  EAE_ECO27 RecName: Full=Intimin;AltName: Full=Attaching and effacing
  551::776     3e-04  27%  935 aa  EAE_ECO11 RecName: Full=Intimin;AltName: Full=Attaching and
   72::251     4e-04  29%  609 aa  YQ39_SCHPO RecName: Full=Putative cell agglutination protein
  992::1496    4e-04  21% 1778 aa  INLI_LISMO RecName: Full=Internalin-I;Flags: Precursor;
 1291::1715    4e-04  27% 10746 aa  EBH_STAAR RecName: Full=Extracellular matrix-binding protein
  671::817     6e-04  27%  916 aa  VPS27_USTMA RecName: Full=Vacuolar protein sorting-associated protein
  635::749     6e-04  31% 2283 aa  SRAP_STAAU RecName: Full=Serine-rich adhesin for platelets;AltName:
  651::842     6e-04  28%  916 aa  INLJ_LISMF RecName: Full=Internalin-J;Flags: Precursor;
 3462::3689    0.001  24% 4981 aa  FAT4_MOUSE RecName: Full=Protocadherin Fat 4;AltName: Full=FAT tumor
  179::977     2e-12  27% 1283 aa  YBKF_SCHPO RecName: Full=Putative cell agglutination protein(query 891->1715)
  713::1181    7e-12  29% 1200 aa  HYAL_STRPU RecName: Full=Hyalin;Flags: Fragment;(query 592->1074)
  649::1133    5e-08  20% 1162 aa  TCNA_TRYCR RecName: Full=Sialidase;         EC=3.2.1.18;AltName:(query 496->1011)
  190::983     2e-12  30% 2021 aa  OMPA_RICCN RecName: Full=Outer membrane protein A;AltName: Full=rOmp(query 688->1633)
  628::959     1e-04  25% 1220 aa  YKL1_SCHPO RecName: Full=Putative cell agglutination protein(query 1437->1797)
 4068::4405    7e-05  25% 6254 aa  MUC19_HUMAN RecName: Full=Mucin-19;         Short=MUC-19;Flags:(query 1039->1403)
  728::1533    4e-12  28% 2660 aa  YEEJ_ECO57 RecName: Full=Uncharacterized protein yeeJ;(query 1933->2807)
   83::742     3e-09  29% 1255 aa  MUC1_HUMAN RecName: Full=Mucin-1;         Short=MUC-1;AltName:(query 2130->2761)
   23::456     8e-04  23%  676 aa  MUC1_MESAU RecName: Full=Mucin-1;         Short=MUC-1;AltName:(query 520->922)
  294::734     2e-06  25% 1339 aa  RGAG1_MOUSE RecName: Full=Retrotransposon gag domain-containing(query 568->1046)
  767::993     9e-05  28% 1090 aa  GUXB_CELFI RecName: Full=Exoglucanase B;         EC=3.2.1.91;AltName:(query 904->1146)
  764::970     3e-04  30% 1090 aa  GUXB_CELFI RecName: Full=Exoglucanase B;         EC=3.2.1.91;AltName:(query 2332->2553)
  129::312     3e-04  25% 9159 aa  HMU_HALWD RecName: Full=Halomucin;Flags: Precursor;(query 1076->1267)
  129::274     3e-04  36% 9159 aa  HMU_HALWD RecName: Full=Halomucin;Flags: Precursor;(query 321->466)
 1150::1607    2e-05  24% 1902 aa  P2P_LACPA RecName: Full=PII-type proteinase;       (query 767->1260)
 1168::1421    1e-05  28% 1433 aa  SUBF_BACSU RecName: Full=Bacillopeptidase F;       (query 593->847)
 1156::1313    2e-05  28% 1433 aa  SUBF_BACSU RecName: Full=Bacillopeptidase F;       (query 1561->1721)
 1163::1313    3e-05  28% 1433 aa  SUBF_BACSU RecName: Full=Bacillopeptidase F;       (query 296->466)
 1104::1326    3e-04  29% 1433 aa  SUBF_BACSU RecName: Full=Bacillopeptidase F;       (query 1161->1441)
 1156::1315    3e-04  30% 1433 aa  SUBF_BACSU RecName: Full=Bacillopeptidase F;       (query 1945->2138)
  477::698     4e-05  32%  985 aa  INVA_YERPS RecName: Full=Invasin;(query 1917->2154)
  465::686     2e-04  32%  985 aa  INVA_YERPS RecName: Full=Invasin;(query 1511->1716)
  753::1013    3e-04  30% 1733 aa  SDRF_STAEP RecName: Full=Serine-aspartate repeat-containing protein(query 2312->2586)
  818::1071    6e-04  29% 1733 aa  SDRF_STAEP RecName: Full=Serine-aspartate repeat-containing protein(query 1872->2113)
    1::3824

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxSNNQFTNDNTPTLEGTGSAGTVIHIYANGQEIGSTTVDSSGSWRFAITSALADGE
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      -------------------------------GLAGVYVTLKSNNRELQRVTTDQSGHYQFTVEFAIPDNA
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      -------------------------------GLAGVYVTLKSNNRELQRVTTDQSGHYQFTVEFAIPDNA
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------YEAGVEIATETASSPGDWTLATHTFTAD--
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ---------------TDKSYTNKDSVTVKGNASPGTTVHIYNXXXXXXXXXXXXXXXFHAGI--ILNKGE
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NHFTAIATNVKGESSESARFTLTIDTLSPDAPRVELIADNTGLLTGPLQNNDRTDEAKPLFSGQGEAGNT
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      NNSTNDAIDSDGERDGTRKVVVAKGTIN----NADNMTVDTGFYLTPKYNEDTNKDGIQDDNEKGISGVK
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      NNSTNDAIDSDGERDGTRKVVVAKGTIN----NADNMTVDTGFYLTPKYNEDTNKDGIQDDNEKGISNVK
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------STAETLTFTQITPSSGAKGMAIDNVSIV----ESSDPIDTAAPTVSNQPAGGAT
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      NELTATASTDNGTTDASSPITVTLDQEKP-----ELTLDNP-------KDGGKTNKETLTVKGAVSDDNL
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ITIKEGSTVIGSATVDENGRWTFTPTTPLSDGEHTFTVEQSDKAGNTSRXXXXXXXXXXXXXXXAAIIDN
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      --------------------------------------------------------------------DN
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      VTLKKNGDTIGTTTTDSNGKYEF---TGLENGDYTIEFETPEGYTPTKQNSGSDEGKD----------SN
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      VTLKKNGDTIGTTTTDSNGKYEF---TGLENGDYTIEFETPEGYTPTKQNSGSDEGKD----------SN
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       LTT---SDVALNASANETGNWTYSTLSGLADGSHTATVYIKDDGGN------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      KDVKVNGK---KATVADG---SYSARILLENGRNEIKVIATDLAGN------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           VAKDGTTVSGTAEAGSTVSIYDPAGNYLGSTITGENNHFSITLNPAQTHGERLEARIQDAVGNIGPATEF
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      VVKNLSVVFRTSPADTQLS--------LNARNTNENGIAEVTLKGTVLGVHTAEAILLNGIVNIAPDASN
DIG1_CAEEL      IGPDGQALP-TDESGKTVPIRGPDGTPLPTDASGASIGPDGEPIPTDASGKPLSKDGSPLTDNDGHYVLV
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ---------------------------------------------------------------LAPATEA
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     -----------------------------------------------TDSEAISSLIMSAVASGGTSPQP
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      GTKTTVTVKDADNKTIDSGFYKPTYN-LGDYVWEDTNKDGIQ-DDSEKGISGVKVTLKDKNGNIGTTTTD
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      GTKTTVTVKDADNKTIDSGFYKPIYN-LGDYVWEDTNKDGIQ-DDSEKGISGVKVTLKDKNGNIGTTTTD
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      -----STPADSSAHGTPSTPVDSSAHSTPSTPVDSSAH-STPSTPVDSSAHGAPSTPADSSAHGTPSTPV
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      -----------------------------SVALSQDTSSSSTLNTTPVHSGSSAPATSSAVDSA--TTPG
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           TASDSQYPAQPTILTVTDDAGAVTGLLKNGDATDDNRPTLSGTAEPGSTISINDNGFPVPTFPPIVADAD
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      AQVTLNIPAQQ-VVTNNSDSVQLTATVKD----PSNHPVAGITVDVAANFTLENNGIAI-------TQAN
DIG1_CAEEL      PVDDSTIKAFPT-----DESGNVAYPITRPDGTPLGTDSSSFVTDDGTIIENDDEGKPIPDGQVLPTDAS
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      SGSAATWGQDVTSVPVTRPAGSTTPPAHDVTSAPDNKPAPGSTAPPAHGVTSAPDTRPAPTAPP----AH
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     TSTQNS-GGIPTPLMSDLDSGIMSSLLMSSPGSEVMSTPL---------LSVPDAG-EMSTLPKPAPDAE
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ASGHYQFKGSYTVEFETPSGYTPTKANSGQDITDSNGITTTGIINGADNLTIDSGFYKTPKY----SVGD
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ASGHYQFKGSYTVEFETPSGYTPTKANSGQDITDSNGITTTGIINGADNLTIDSGFYKTPKY----SVGD
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      -------------------------------AVDTTPPTVNCINNVAQTVQLGTGSTQVFFTEPTAFDIS
TCNA_TRYCR      DSSAHGTPSTPA------DSSAHSTPSTPADSSAHSTPSTPADSSAHSTPSVDSSAHGTPSTP-----AD
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      HSGSSAPPTSSAVNSATTPGHSGSSAPPTSSAVNSTTPVHSGSSAPVTSSAVNSATTPVSSAPPTSSAVN
RGAG1_MOUSE     -------PAQPT--NPPESEGIPTVLMSGSDSAVMSSPVSGSGAMPTPLLSIPDAG-EIATLPKPVPDVE
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      --------------------------------TNKDSVTVKGNASPGTTVHIYNXXXXXXXXXXXXXXX-
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           GKWSFTPSLALADGDHVFTATATNDRGTSGQSVSFTIDIDTQPPVLEGLAVSDVGDRLTGTTEAGSTVVI
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      GEAHVTLKGKKA-GTHTVTATLGNNNASDAQPVTFVADKDSAVVVLQTSKAEIIGN---GVDETTLTATV
DIG1_CAEEL      GNYIY-PVIG-PDGQ----ALPTDESGTDASGAAIGPDGEPIPTDASGKPLSQDGSALP--TDNNGNFIL
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      GVTS-APDTRPAPG-----STAPPAHGVTSAPDTRPAPGSTAPPA-------------HGVTSAPDTRPA
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ---AMSPALMTALPSGVMPTQTMPAPGSGAMSPWSTQNVDSEPPV-----------RATASGVMSAPPV-
HMU_HALWD       -------------------------------------------------AGSDVGG-LAGTIDTGNATRV
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      -------------GDYTVALNSENEDGVKAETVYVTVTVDKDPAPIISAKTDITYDKFSKKTEAA---FL
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      YVWEDTNKDGIQD---------DNEKGISGVKVTLK---DEKGNIISTTTTDENGKYQFDNLDSGNYIIF
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      YVWEDTNKDGIQD---------DNEKGISGVKVTLK---DEKGNIISTTTTDENGKYQFDNLDSGNYIIF
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      -------------GDYTVALNSENEDGVKAETVYVTVTVNKDPAPIISAKTEITYDKFSKKTEAA---FL
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      GQTSLVPGDSFPVGTTSVTYIFTDASGNNAQPCTFNVVIDTTPPTV------NCANNIAQTIELGSTVVN
TCNA_TRYCR      SSAHSTPSTPADSSAHGTPSTPVDSSAHSTPSTPVDSSAHGTPSTPVDSSAHSTPSTPVDSSAHGTPSTP
OMPA_RICCN      ---------------------------------------------------------LAGNINGGGIITV
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      SATTHSGSSAPVTSSAVNSATTPVHSGSSAPVTSSAVDSATTP-VHSGSSAPPTSSAVNSATHSGSSAPV
RGAG1_MOUSE     ---AMSPLLMTALTSTVMPSQLISASSSGVMSPDTTQNINSEVMSAPPIRVSSTGLMSTLPVRASDTAAV
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----FHAGIILNKGENELTATASTDNGTTDASSPITVTLDQEKPELTLDNPKDGGKTNKETLTVKGAVSL
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           KDSQGNTLGSGTAGDDGTFSIGISPAKINGETLSISVTDKAANSGPVETLNAPDKTAPAAPDGLIVATDG
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      KDSKSNTNDSGVA--EVTFKLGVHTAEANNDTKIVNIAPDASNA--QVTLNIPQQVVTNNSDSVQLTATV
DIG1_CAEEL      VPSDKSTTKTLPTDESGNFIYPIT--KPDGVLFA---TDSTGNTDEGELIEKDDNGYPLGPDKRVLPTDG
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      PGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPDTRPAPGSTAPPA-HGVTSAPDT
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     -----------RALDSGAMSTPLMGAPASGNMSTLQKTVPASGAMTTSLMTVPSSG--------VMSTEQ
HMU_HALWD       ---------FATGQVEGNSAVGGLVGKNNGGTLSDVYWDK----GATNQTNATGSATPTGADGYGLVNDD
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      DDIDADTNDGSIITSNFATAVNLDKAGDYTVTLN-SINSDGVASTPTAIIVHVEKEKIAT----ISANTA
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      EKPEGMTQTTANSGND-------DEKDADGEDVRVTITD-------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     -------------------STSVVPTPDEGPSTSVQSTAGEGPSTPVP-LTATEGLSTSVPDGLSTATEG
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     --------------------------------------------------SSPVSATSVLTSGLVKTTDM
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      EKPEGMTQTTANSGND-------DEKDADGEDVRVTITD-------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------NGQVVDVGVTDFTADSAKADGTEAITYTATVKKNGVTQANVP
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      DDIDADTNDGSIVTSNFATAVNLDKAGDYTVTLNSINSDGVAGT-PTAIIVHVEKEK--------IATIS
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      --------------------------------------------------------------GQITVTSG
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      YAEPSATDISGTAFLVSRSSSPGDSFPIGSTTVTYIFSDQSGNEAPTVTIGTVDTMMPSCPNNIVQSVE-
TCNA_TRYCR      VDSSAHSTPS-TPADSSAHSTPSTPADSSAHGTPSTPVDSSAHSTPSTPADSSAHSTPSTPVDSSAHSTP
OMPA_RICCN      KTDAAINGTIGNTNALATVNVGAGIATLEGAIIKATTT-KLTNAASVLTLTNVNAVLTGAIDNT-TGVDN
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      TSSAVN---SATTPVHSGSSAPVTSSAVNSATTPVSGSSAPPTSSVVNSATTPGSSAPPTSSAVNLATT-
RGAG1_MOUSE     PASGNMSTSQKTVPVSGSMSTPLMAVTSPGAIFTEQMPSTA--SGTMSTHLTMPQTPGTMPIGFMKSTSN
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ------------------------------------------------------------------AVDG
SUBF_BACSU      KDVKVN--GKKATVADGSYSARILLENGRNE-IKVIATDLAGNKTTKKTVIDVNFDKPVI-SGLIPGEDK
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LSVSGQAEAGATVTIRDSSNTVLGSAVANGNGQFIVPLNTAQTNGQALIATATDVAKNESAAATVIAPDS
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      KDPSNHPVAGITVNFTMPQDVAAGIAITQANGEAHVTLKGKKAGTHTVTATLSNNNTSDSQPVTFVADKT
DIG1_CAEEL      SGNYIYPAVGSDEKILPTDN--LGKVVYPITRPDGSPLATDST-GVFVTGDGTIVERNEEGKP--IGPDG
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      RPAPGSTAPPAHVTSAPDTRPAPGSTAPPAHGVTSAP-DTRPAPG----STAPPAHGVTSAPDTRPAPGS
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     MSATASRVMSAQLTMAKTSGAMPTGSMATASGKMSTPLRRAPTSGAMSTQPVTATASETMSMPQLTVPAS
HMU_HALWD       TPAERMQGEAATAFMSALNYTTTWNTTRG------YPVLQAQATGETIDATDASSAQTEQVAISITVTAA
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      QQYEKYAEINETQFLKDSINASPTTAVLESDFETVVKLDVPGTYTVTITATNEDGGVSAPKEVSVIVKKL
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     LSVPPTPDEGPSTSMPEGRSTTMLPAASDGQSISLVPTKGSSTSGPP---TATEGLSTSVQPTAGEGPST
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     LNTSMEPVTNSPQNLNNPSNEILATLAATTDIETIHPINKAVTNGTAVLHSTLPVSSEPSTATSPMVPAS
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       VSVSGTATLGANSATTDANGKATVTLKSSTPGQVVVSAKTAEMT-SALNASAVIFVEQTKASITEIKADK
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      TNTAQQYEKYAKINVHASINASPTTAVLESDFETVVKLDVPGTYTVTITATNEDGGVSAPKEVSVIVRKI
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      LDRESLPVYNLTVLAVDS-----GTPSATGSASLVVTLEDINDNGPVLTVSEGEVLENKRPGTLVMTLQS
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      LGVPGTVISWTTPTANDAAG--IASIVSNLQGSFF-------TVGES--ATVTYVATDNSGTVTVFAVDT
TCNA_TRYCR      STPADSSAHGTPSTPVDSSAHGTPSTPADSSAHS-TPSTPADSSAHSTPSTPADSSAHSTPSTPV---DS
OMPA_RICCN      VGVLNLNGALSQVT-GNIGNTNALATISVGAGK-------ATLGGAVIKATTTKLTDNASAVTF------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      -PVHSGSSTPATNSTTDSATTPVPPGSSMQTTEAISSANTPIHNGSLVPTTSSALVPTTSAAHSGASAMT
RGAG1_MOUSE     GAVSAQQ-------IRCSVSGMMSTVIATASEIMSVSQSTVPTSGSV---------STQKTRAPVSGPMS
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       TYTDAQGKKHDLNTTYDAATNSFTASMAVTNADYAAQVDLYADKAHTQLLKHFDTKVRLTAPTFTDLKFN
SUBF_BACSU      IAFSSAEDLDATFTIR----MPLTNARASVQNATELPLREISPGRYEGYWTATSSIKAKGAKVEVIVRDD
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           TAPEMPKNVVISEDGTSISGTAEPGSAITIATPDGKPLGSGKADGEGHFTLPLVPAQTNGEQVTVTATDS
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      SALQISKNEITGNDSATLTATVKDNLPVTFSTSSGLTLTPGESNNESGIAQATLAGVAFGEQ-TVTASLA
DIG1_CAEEL      QVLTTDNSPVIGPDGEPLGTDASGKTVYPVRGPDGTPLAT---DAFGAVIGP------DGEPIPTDASGK
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      TAP--PAHGVTSAPDTAPGSTAPPAHGVTSA-PDTRPAGSTAPPAHGVTSAPDTPAPGS------TAPPA
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     GSMSMLQMRAPVSEAMSMPQMRTMASGLTSAA-------QMKAMTSGAMSTPLMTAQTSGSTSTLLMRDT
HMU_HALWD       DSESTDGFVITVRESDGLSGLED---ATAVTDQDGTATFSFSESNANSYKPTFGVAGDTAVSTTANITVK
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      PAPEIPKHATINEKNVTITSNFSADVNLNKAGDYTVTLNATNEDGVKATPVEVIVHVQQGERPVITADDK
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     SVPPTPCG------GLSTSVPPTPGEGLSTSVPEGLSTSVPPTPGEGPSTSVLTPGEGRSTSVPPTASDG
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     SMGDALASISIGSETTDIEG--EPTSSLTAGRKENSTLQEMNSTTESNIILSSVGAITEATKMEVPSFDA
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       TTAVANGNDAVTYT-VKVMKEGQPVHGHSVAFTTNFGMFNGKSQSDGRATITL--TSSSAGKATVSATVS
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      PAPEIPKHATISDKNVAITSNFSTDVNLNKAGDYTVTLNATNEDGVKATPVEVIVHVQQGERPVITADDK
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      TDPDLPPN-------------QGPFNYYLLSTGPATNYFSLSTAGVLSTTREIDREQIADFYLSVVTRDS
YBKF_SCHPO      --------------------------------------------------LSILPHSTISTLSTVSINDT
HYAL_STRPU      TPP----SVVCTNN---VFQTVELGTQVFYTEPTASDI-SGQANLVSRTNVPGDSFPVGTSTVTYVFADN
TCNA_TRYCR      SAHSTPSTPADSSAHSTPSTPADSSAHSTPSTP---------ADSSAHST-PSTPVDSSAHSTPSTPADS
OMPA_RICCN      TNP-----VVVTG---AIDNTGNANNGIVTFTGDSTVTGNGNTNALATISVGAGKATLGGAIIKATTTKL
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      NSSESDLATTPIDSGTSISTTKAPGSATTLIHNDTSTMATTTPVGNGHPVTPTPPAVSSNSTIAL-STYY
RGAG1_MOUSE     T--------------TQIRTTA---SALT-STPQMRATASGT------MSIPLMTAKTSGSASTLLMRDT
GUXB_CELFI      ---------------------------------------------------------------TVRAFDA
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       NGSDQTSEATIKVTGTVSSDTKTVNVGDTVAA----------LDAQHHFSVD-VPVNYGDNTIKVTATDE
SUBF_BACSU      YGNETRK---------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           ANNVSPPTTAQAPDITAPDKPIITQVLDDVESFTGPLVNGQTTNDNRPTLSGTAEAGARVEVFDNGVSLG
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      NNGASDNKTVHFIGDTAAAKIILTPVPDSIIAGTPQNSSGSVITATVVDNNGFPVKGVTVNFTSNAATAE
DIG1_CAEEL      PLDQSGPTDNNGNYILVPSDEALGKILPTDEN--GNVVYSVTNPDGTPTGSFIASNGLIVEKDDEGKPIG
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      HGVTSAPDTRPAPGSTAPPAHGVTSAPDPAPGSTAPPAHGVTSPDTRPAPGSTAPPAHGVTSAPDTRPAP
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ASGVMSCPQMRSLASGALSKPLMTPKASGTEKMTTTASEAMPTLLMRDTVSGALSMPQMTDTASGGLSAS
HMU_HALWD       EGAVRTYTREDGTNLTTPDDPYLANSLTDLQVIN----KNATTRDEHYQLTDDINASATIESWNGG----
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      FANITEAKFLEDIHATSSDGQSSTVITSNFETAT----NFKTAMSYTVTLNAVNEDGISAEPVAVTVTIN
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     SDTSVPPTPGEGPSTTASDRP-------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     TFIPTPAQSTKFPDI-------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       GGN-----DVKAPEVTFFDGLKIDNKVDILKNVTGDLPN-------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      FANITEAKFLEDIHATSSDGQSSTVITSNFQTAT----NFKTAMSYTVTLNAVNEDGISAEPVAVTVTIN
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      APQMSSTGTVHITVLDQNDNPSQSRTVEIFVNYYGNLFPGGTLGSVKPQDPDVLDS------FHCSLTSG
YBKF_SCHPO      SASLSKTTSPTAGTIT--------------ETIVSGSVGYTSTFPASGTTSGTVEAGTITETIVSG-SVG
HYAL_STRPU      SGNTADACTVTAQDTTPPTVNCITNIVRTVELGTSSV----QVFYNEPTAS----------------DLG
TCNA_TRYCR      SAHGTPSTPADSSAHSTPSTPV------DSSAHSTPSTPADSSAHGTPSTPADSSAHSTPSTPADSSAHG
OMPA_RICCN      TDNASA--------VTFTNPVVVTGAIDN----TGNANNGIVTFTGDSTVTGNI-----------GNTNA
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      STALSPAFSSHA----------------------------------------------------------
RGAG1_MOUSE     ASGVISVPQMRAPGSGTVSKPLMTSKASGMQQMTTAAFGATPTSLMRDTASG----GLSMPQMTDPASGG
GUXB_CELFI      AGNVSAPTKATPSDTTAPSVPAITSSSSTANSVT---IGWSASTDNA---GGSGLAG-----YD--VYRG
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       DGN----TTTEQKTITSSYDP---DVLKNAVTFDQGVKFG--ANEFNATSAKFYDPKTGIATITGKVKHP
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           LATLQPNGGWTFTPSQNLGEGAHRLTVIATDAKGNASPAASFDLVVDTQSPQQPVITFITDDAPGILGSV
YHU2_SCHPO      -------------------------TPITSSSVLNSSTPITSSTVVNTSTPRYSVLNSSTPTSSTVLNSI
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      MT----NGGQAVTNEQG------KATVTYTNTRSSIESGARPDTVASLENGSSTLSTSINVNAD---AST
DIG1_CAEEL      -----PDG-----------------QVLPTDASGNIYPVIGPDQALPTDESGKPIYPVFTEDGTQLPSTG
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      GSTAPPAHGVTSAPDTRPAPGAHGVT-SAPDTRSTAPPAHGVTSAPDTRAPPAHGVTSAPDPAPGSTAPP
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     LMRDTASGAMSTSQMTATVSGGMSMPLMRAQDPG-VMPASLMRAKVSGKMLSQPMST-------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      AATLKADAEVSYAKNEAVTESDFFKDVHGAEAPSTAKATSNFDSVVDRSK--------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      AAALKADAEVSYAKNEAVTESDFFKDVHGTEAPSTAKATSNFDSVVDRSKTGDYTVTINATNEDGAVSTP
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      VTSLIPAGSCDLSSQPRSTDGTFDLTVVSSD---------------------------------------
YBKF_SCHPO      YTSTFPANGTTSGTVEVVEPTAGTITTIVSGSVGYTSTFPANGTTSGTVEVVEPTAGTITETI--VSGSV
HYAL_STRPU      QASLVSR---TAQPGDNFPVGVNPVTYVFGDNSGNQADPCTFTITVNTQDTTPPTVTCISDITRVVELGT
TCNA_TRYCR      TPSTPADSSAHSTPSTPAGSSANGTVLILPD---------------------------------------
OMPA_RICCN      LATISVGAG-----KATLGGAIIKATT--TKLTDNAS-AVTFT---------NPVV---------VTGAI
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------LSAEATGTTGPS
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     MSTLLTRATASGTKSTSQMTATTSGGIFMPQTRLSGPGATSTPLMRATASEKMPSQAMNIQDSGGV----
GUXB_CELFI      ATRVAQXXXXXXXXXXXXXSTAYEYTVRARDVAGNVSPSTAXXXXXXXXXXXXXXXXXXXXGLAAMTVTE
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       TTTLQVDGDLTFSFTLDLGTGQKPFGVVVGDTTQNKTFQEALTFILDAVAPTLSLDS--STDAPVY----
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           AHLGLTNDSTPTINGTGEPGSTVHLYQNGARIADIIVGNSGVWSYAYTTASPLADDTYTFTVTASDSNGN
YHU2_SCHPO      TSSSVLNSSTPTALNTSTPITSSSVLNSSTPITSSSVLNSSTSSTALNTSTPITSSSVSTPITSSTALNT
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      AHLTLLQALFDTVSA----GDTTNLYGNGVPQQEVTLSSEGVTNAIYTTASFTATKAGVYQVTATLENGD
DIG1_CAEEL      FAIGPDGELVPTDSANGVP-----LSKDGSPLPTDASGNYILPDSGVTTANPTDENGYAITLLATDSTGS
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      AH-GVTSDTRPAPGSTAPPA-------------------HGVTSAPDTRPAPGSTAPPAHGVTSAPDTGS
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      -----TGDYTVTINATNEDGAVVHI---GAESAPVITANAEV---KYNKHEQTDERRFLYDSDAKIDEAN
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      IEVHIEAESAPVITANAEVKYNKHLYDSEAKIDE---ANVEIKTDFAEKVDINKVGTYTVTLTATNEDG-
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      GY-------TSTFPANGTTSGTVEVVEPTATVTETIVSGSVGYTSTFPASGTTSGTVEVVEPTAGTITET
HYAL_STRPU      TSVGITEPTATDISGTATLDSRSH----------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      DNTGNANNGIVTFTGTGNIGNTNAL-------ATISVGAG---------KATLGGAIIKATTTKLTDNAS
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     A--GVTGTTGLSAGVTGTAGLSARVTESTGLSAGV-TGTTGLSAGVTGTTGPSAGITGTNGLSA-EVTGT
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      TSVALTWNASTDTGGSGLKGYDV--YRGATRVGSTTTAS-------YTDTGLTAATAYQYTVRATDNAGN
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       -------------------------YEAGVEIADLNISSPGDWTLAHTFTADSTAETLTFTITPSSGAKG
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       -----TNDPNFQITGTATDNAQLSLAINGSHVADININSGKPGHMAIDQPVKLLEGKNVLTVAVTDSENN
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           TTPFSTDFTITIDTQAPAAPGVIGVADGDGNTIDTNQITQESQPRLSGSGTAGDTIILYDNGNAIGQALV
YHU2_SCHPO      STPITSSSVLNSSTAITSSTAL-----NTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPIT
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      SMQQTVTYNAEISLAASKDPVIXXXXXXEGNAIANSEVTFTLPEDVRANFTLGDG----------GKVVT
DIG1_CAEEL      YITQGGQLIEKDNTGKPIGPGQVLPTDGDGQALPTDDTGNVVYPVINADGSLGKIVAKDDEGKPIGQVL-
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      TAPPAHGVTSAPDTR-PAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDT---------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      -VEIKTDFAEKVD---------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      IVSGSKAFTSTFPANGTTS-GTVEVVEPTAGTI-TKTIVSGSKTFTSANGTTSGTVVVEPTAGTITETIV
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      AVTFTNPVVVTIDNTGNANNGIVGDSTVTGNIGNTNALATISVG--AGKATLGGAIILTDNASAV-----
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     TGPLA-GVTGTIGLSA-GVTGIAGLSAG---------VTESTGLSAGVTGTIRSSAVV-TGINGLSAGVT
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      VXXXXXXXXVT--TKTPQTGGSCSVA--------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       MAIDNVSIVESSDPIDTAAPTVSVNQPAGGATLTTSDVALNASANETGNWT-------YSVDGGPNQTAT
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       TT--TKKITVYYEPKKTAAPTVTPSTTEPAKTVTLTANAAATGETVQYSADGGKT---YQDVPAAG-VTV
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------QSKPDPYSPGLAMD-----ETGQNSGRNWQ
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           GTDGRWQFTPPAALGDGDHLLTARANDPAGNESPESISFTLRIDTQAPDAPQIVSAAITGGEGEVLLANG
YHU2_SCHPO      SSSILNSSTPITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSST-VLNSSTPITSSSVLNSST
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      DTEGKAKVTLKGTKA-GAHTVTA---SMAGGKSEQLVTLTAQVNLNVTEDNFILQATVTDGNGNP-LANE
DIG1_CAEEL      PTDASGNYIYPALGPDGSILPTDSVRGPDGTPLPDEFGFAI-----GPDGKPIP----TDTSGKPLSADG
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      SGSVGYTSTFPA---NGTTSGTVEVVEPTAGTITETIVSGSKTFTSTFPA-----SGTTSGTVEVVEPTG
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ------TFTNP--------VVVTGAIDNTGNANNGIVTFTGNIGNTNALATVNVGAGIATLEGAVIKATT
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     GTTG------PSAEETGATGPSAEXXXXXXXXXXXXXXXXISAEVTGTTGP---SAEVTGLPGVSAGVTG
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       DANGTKTLNVTSGLADGSHTATVYIKDDGGNIGIDTVSFTI------SSAPTVTTS--SGGTNYTASTGG
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       TANGTFKF---------------KSTDLYGNESPAVDYVVTNIKADDPAQLQTAKQALTNASAKTLSASG
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      YIDGKWQ---PGDKADGNYMIRALVDYEAA-------------------VPEITSPT-----------DK
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           SITNQRMPTLSGTGEPGTIITLYNNGVELATVQVNPQGSWTYPLTRNLSEGLNILTATATDAAGNSSPTS
YHU2_SCHPO      PITSS---TVVNTSTPITSSTVVNSSTPITSSSVLNSST---PITS--STALNTSTPITSSSVLNSS-TP
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      AVTFTLPADVSASGQGGSAITDINGKAE---VTLSGTKSGTYPVTVSVNSDTKQVTLIADAGTAKLASLT
DIG1_CAEEL      S----PLP----TDNNGNYILVLSEGVEHAPTDEN--GNVIYPVTN--PDG----TPLGTDSSGAFITQD
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      TITETIV-----SGSKAFTSTFPANGTTSGTVEVVEPTAGT--ITETIVSGSVGYTSTF--------PAS
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      TKLTNAASVLTLTNVNAVLTGAIDNTTGVDNVGVLNLNGALSQVTGNIGN----TNALATISVGAGKATL
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     TIGSPAAVT--GTTRPSAVVT----GISGLSAEVTGTTGLSAGVTETIGSGTNGLSAEATETTGPSAGVT
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       FVVDENL---------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      SYTNKDSVTVKGNASPGTTVHIYNXXXXXXXXXXXXXXXFHAGII--LNKGENELTATASTDNGTTDASS
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           GVFSVTLDTQPPAQPDAPLISDNVAPVIGNIGNNGATNDTTPTFSGTGEIGSTIILYNNGSEIGRTTVGD
YHU2_SCHPO      ITSSTVVNTSTPVNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTGLNTSTPIVLNSSTPITSSTVLN
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      SVYSFVVSTTEGATMTASVTDANGNPVEG-----------------------------------------
DIG1_CAEEL      GTVVKKDEDGKPIGPDGQVLTDNIYPVIGPDGQVLPTDASGKTHSVYGPDGTQLPTDASGSAIG------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      GTTSGTVEV---VEPTAGTVTETI--VSGSVGY-------TSTFPASGTTSGTVVVEPTAGTVTETIVGS
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      GGAVIKATTTKLTDNASAVTFTNPVVVTGAIDNTGNANNGIATFTGTGNIGNTLATVNVGAGLLRVQGGV
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     GTTGLSAGVTGTTGPSAGIAGTNSAGVTGTTGLSARVTESTGLSAGTGTIGSSAVV----TETTRLSSGV
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      PI-TVTLDQEKPEL------------TLDNPKDGGKTNKETLTVKGAVSDDNLKDVKVNGK---KATVAD
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           NGSWSFTPAALXXXXXXXXXXXXDIAGNISPPSASVTFTLDTTAPANPVITFAEDNVGEVQDTIVSGATT
YHU2_SCHPO      ----SSTPITSSTALNTSTPITSSSVLNSSTPITSSS-VLNTSTP------ITSSSVLNSSTAITSSTAL
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      VGYTSTFPAS--GTTSGTVEVVEPTAGTITETIVSGSKAFTSTFPANGTVEVVEPTAGTITETIVSGSKT
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      VKSNTI---------------------NLTDNASAVTFT-------NPVVTGAIDNTGNANNGIVT--FT
YKL1_SCHPO      ------------------------------------TTTLATASTVSGTVEVIEPAAGTVTTTVYSG-TQ
MUC19_HUMAN     TGT-------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      -GSYS-ARILLENGRNEIKVIATDLAGNKTTKKTVIDVNFD-----------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           DDNTPVIHGTGDIGSVITLYNXXXXXXXXXXXXXXXWTLPVTSALPDGVYTLTAIAADAAGNSSDVSNSF
YHU2_SCHPO      NTSTPITSSSVNSSTPITSSTVVNTSTPITSSTVVNSSTPITSST--ALNTSTPITSSSVLNSSTPITSS
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ---------------------------------------PVTVNYVDDTGKTLAPSETLNGNVGDTYNAT
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      FTSTFPANGTGSVGYTSTFPASGTTSGTVEVVEPTAGTVTVISGSVSFMSTITAVVEPTAGTVTEVSGSI
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      GDSTV----TGNIGNTNAL---------------------ATISVGAGKATLGAIIKATTTKLTDNASAV
YKL1_SCHPO      EYTTTLATASGTVSGTVEVIEPAAGT--------------VTSTVYSGTQEYTTTLATASGTVSG-----
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------VTDDLTANFYSLSALAVDHQGNRS---NSF
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           TFTVDTVPLQPPVVNEILDDVAPVTGPLTDGAFTNDRTLTINGSGENGSTVTIYDNGVAIGTALVTDGTW
YHU2_SCHPO      TVLNSSTPITS---SSVLNSSTPITSPITSSTALNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVV
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------DDETATLSPNGTNVETGASIHSGIIIVGSTPTDGS-
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------TADRFTEVGKIVILGAGLEGSVFRIQDNDYNF-TISPFDGTI
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      AKQIDGYTLSAEPTN--------ATGQFTSSAQTVNYIYTKNPAPEKGVVEIHYENNKQLSSATKISGTV
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      PFT-STIPAQ-GTTSGTVEVVEPTAGTVTETII----------SGSVGYTSTFPAQGTTSGTVEVVEP--
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      TFT------NPVVVTGAIDN----TGNANNGTFTGDSTVT----GNIGNTNALATVNVGAGVTLQAGGSL
YKL1_SCHPO      --TVEVIPAAGTVTTTVYSGTQEYTTTLATASGTVSGTVEVIEPAAGTVTTTVYSGSEVYTTTLASPGTV
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      --------------------VPEITSP-TDKSYTNKDSVTVKGNASPGTTVHIYNXXXXXXXXXXXXXXX
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      TLSVTVQQPQLTLTAAVIGDGAPANGKT---AITVEFTVTNNGALPNKITEKTDANGVAIALTNTTDGV-
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           TFNTPELSEVSHALTFSATDDAGNTTAQTQPITITVDITAPPAPTIQTVDDDGTRVAGLADPYATVEIHH
YHU2_SCHPO      NSSTPITSST---VVNTSTPITSSTVVNTSPITSSTVVNSSTPITSSTVLNTST-------PITSSSVLN
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------DQSLTVNVTDDTGNAAVRTIQVSVTVDTKAPEITSVSRAGGDSVDVSGLSEPGKVASVNT
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      -----------------------------------------PAPTTAVLTID---LAGVSS--APITIKD
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     FTNSPLDFENIKTYRFNIT--AGKSTSQ---VIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIEG
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      GDNYTTEPKNIDGYTLTTTPDNANTSSQTVTYVYTKNIVAAEPVTVNYVDANGKTLATIGDTY-NATAKQ
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      TAGTVTETIISGSVGYTSTFPAQGTTSGTVEITVTETIVSGSIPFTSTIPAQGT-------TSGTVEVVE
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      DANNIDFGARS-TLEFNGPLDGG-----------------------------------------------
YKL1_SCHPO      EVVDPEAGSVTTTIYSGSVEYTTVLADASGSVTGTVEVVEPAAGTVTTTVYSGSEVSASESVPGTVEVVD
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      FHAGIILNKGENELTATASTDNGTTDA-SSPITVTLDQEKPELTLDNPKDGGKTNKETLTVKGAVSDDNL
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      TVVTAEVEGQRQSVDVKGTIAADKSTLAAVPTSIIADGLMASTITLELKDTYGDPQAGANVAFDTVITDH
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           ADGTLVGSAIANGTGEFVVTLSPAQTDGGTLTAIAIDRAGNNGPATNFPASDSGLPAVPAITAIEDDVGS
YHU2_SCHPO      SSTPITSSSILNSSTP--ITSSSVLNSSTPITSSTV--VNSSTPITSSTALNTSIPVLNSSTPIXXXXXX
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       SDGSNQTQTVRIGLTDAIRGKTPTVTINSSSDGI-LDKAGNGQGEDSTSSNESSDGTESDQGDPEDDIGG
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ANGNVV-QGYDNVTVNDNATITVAR---GVYTVTAGNVSGFNGPTTNFRVDLSGLNYTQAGTTTPTPVGS
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     QNGLVTYSILSGNTSLFAVN----STTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGD
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      IDGYTLSAEPTNATGQF-----------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      PTAGTVTETIISGSVGYTSTFPAQGTTSGTVEIVA-----------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      PEAGSVTTTIYSGSVEYTTVLADA---SGSVTGTVEVVEPAAGTVTGTLTSGSQF----FTTTIAQASGS
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      KDVKVNGATVADGSYSARILLENGRNE---IKVIATDLAGN-----------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      NDGTYSAPLTSTTLGVATVTV---KVDGAAFSVPSV----------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           VQGNIXXXXXXXXXXXXXXXXXXIGSTVEVFIDGDSAGFATVDASGNWIFEIATPLSESTHYFTVQATNA
YHU2_SCHPO      XXXXXXXXXXXXXXXXXXXXXTVVNTSTP--ITSSSVLNSSTPITSSTVVNSSTPITSSTVVNTSTPITS
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      -----------------------IGDIIERDDEGKPIGVLTTDASGNYIYPVVGPLILPTDATGKPIYPV
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       INTGI-----------------------------------------------------------VDANGH
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      INILTPAXXXXXXXXXXXXXXFDKANEVQCMVGGAAAVTAQVDSTSGYC-DVVVPNSTGNVVITVMGKGV
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     INDN------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      VSGNVEVIEPS-------------GSTVTSTIYSGSESFTTTLAVGS-----------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1890
query           NGPGGLSAPVGITVDLSVPAQPVITSATDDVPGMTGTLDNGALTNDSRPTLNGTGEAGATIRILDNGVEI
YHU2_SCHPO      STVVNTSTP--ITSSTVVNSSTPITSST--VLNSSTPITSSSVLNSSTPITSST--------VVNTSTPI
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      RGPDGTPLPTDASGAVIGPGEPIPTDASTDVNGNYIMLPSDEVTSQSLP----TDESGNVIYPIPDGTPL
YEEJ_ECOLI      ---------------------------------------------------------------LNNAVSI
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       NEAGGFAGDIGSNARVEVSATGGVKNGGSEIGGLFGNASSGSEIVEAAGNVSGTTNVGGLL-----GRQD
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      NGQ-TVTATRNISVTQAAVSYGVVTPAGD----QELTLTSEGIVRDADSGWRRLGQGVSTPSDPNLNLDI
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ---------------------------------------------------NEKGISGVKVTLKNNGDTI


                         *         .         .         .         .         +         .:1960
query           GSATVDQSGNWRFTPNAPLENIAHIFTAVATDPAGNSGQPSDGFTLNIDAQAPDVPVITSVIDDNNQPTV
YHU2_SCHPO      TSSTVVNSS----TPITS-STVVNTSTPITSSSVLNSSTPITSSTV----VNTSTPITSSTVVNSSTPTS
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      GT---DSSGSFITEDGQIIEKIGPDGQILSTDASGNYIYPDDVQTLPTDGDMISVPTVEATVEFTSDKTP
YEEJ_ECOLI      DNVKPGVTTDWKETADGVYKATYTAYTKGSGLTAKNEDLHTAGFIIDANPQSAKIATLSALANENAANTV
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ------------------------------------------------------------VTDPNSVALS
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------AYAYTVRAFDAAGNVSAPSAALTVTTDTTAPSVPAITSSSSTANSVTI
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       GSAVTVDRAYWDEQSTGQTSSAGDTETALPT------------VKMQGTAATEFMPGLNFTTTWNTTRDY
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       -------------------------------------GDISDSIVIDNDGYSPDTVGIYSVTNSNGQTSS
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      YI-----KGTVNFSVNAPAGQKVELFLARTT----GSDVPT-----NDDIQAGDV---------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ------------------------------------------GFIIDANPQSAKIATLSALANENAANTV
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ------------------------------------------------------VPEITSPTDKSY----
INVA_YERPS      --------------------------SALAVDHQGNR---SNSFTLSVTVQQPQLTLTAAVIGDG----A
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      GTTTTDSNGKYEFT---GLENGDYTYTPTKQNSGSDEGKDSNGTKTTVTVKDADNKTIDSVWEDTNKDGI


                         .         .         .         *         .         .         .:2030
query           PVLPGQSTDDRQPILNGTGEPGATITIFDNGTPLGTAQVGENGSWTFPVPRNLSEGSHNLTVSATDPAGN
YHU2_SCHPO      STVVNTSTPITSSTVVNTSTPITSSTVVNSSTPITSSTVLNTST-----PITSSSVLNSSTPITSSSVLN
YBKF_SCHPO      -----------------SGSVGYTSTFPANGTTSGTVEVVEPTAGT--ITETIVSGSVGYT--STFPANG
HYAL_STRPU      ------------------GTPGVNVTATDNGIANLVSRTNQPGDF-FPV------GQTDVTYTFQDPSGN
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ------------------------------GVANGTPARGPQNNWAFTYG-----GDYTITADVADHI--
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ------------PLAGVTGTTGISAGVTGT-TGLSAGVTGTIGSSAVVTGINLSAGVTGTTTGATGPSAE
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      EVIHSITKPDGTPLTDSTGEDGQIIEKDDEGKPIGVLPTDASGNYIYPV---------------------
YEEJ_ECOLI      SV--NVADEGSNPINDHTAVLSGSATSFNNQN---TAKTDVNGLATFDLKSSKQEDN---TVEVTLENGV
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      QDTSSSSTLNTTPVHSGSSAPATSSAVDSATTP------GHSGSSAPPTSSAVN--------SATTPGHS
RGAG1_MOUSE     ---------------------------------------------SLPMPVSGSGAMPTPLLSIPD-AGE
GUXB_CELFI      GW--SASTDNA----GGSGLAGYDVY-------RGATRVAQXXXXXXXXXXXXXSTAYEYTVRARDVAGN
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       PVLQVQTT--------GTEQPPRTVDTID-ATNASLVQ-SEQVSVSITVTASEADSRNGFLISVQDAAGL
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ---PGSTSFDL--IVNGGGIPSSTTTGYEANTQGG-------GTYTF-------SGTYPAAVDGTDAQGK
P3P_LACLS       ---PGSTSFDL--IVNGGGIPSSTTTGYEANTQGG-------GTYTF-------SGTYPAAVDGTDAQGK
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ---PGSTSFDL--IVNGGGIPSSTTTGYEANTQSGTYPAAVDGTYT-----NAQGKKHDLNTTY-DAATN
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       IIAPVHVVDIVNPVINGVSDTVHSLTVSDNYYTGLSISIKEN---TYTVNKN-KLGTYKITVQAVDPSGN
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      SV--NVADEGSNPINDHTAVLSGSATSFNNQN---TAKTDVNGLATFDLKSSKQEDN---TVEVTLENGV
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      -------TNKDSVTVKGNASPGTTVHIYNXXXXXXXXXXXXXXX--FHAGIILNKGENELTATASTDNGT
INVA_YERPS      PANGKTAITVEFTVADFEGKPGQEVVITTNNGALPTEKTDANG-----VARALTNTTDGVTVVTAEVEGQ
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      -------QDDSE-----KGISGVKVTLKDNGNAIGTTTTDASGHYQF---KGLENGSY--TVEFETPSGY


                         .         +         .         .         .         .         *:2100
query           TSAVSAPWTIVVDITPPAIPVLTSVVDDQPGITGNLVSGQLTNDATPTLNGRGEAGATINVYLDGNPASI
YHU2_SCHPO      SSTPITSSTVVNTSTPITS---SSVVNSSTPIT----SSTALNTSTPI---------TSSSVLNSSTPIT
YBKF_SCHPO      TTSGT-----VEVVEPTAGTVTETIVSGSVGYTSTFPASGTTSGTVEVVEPT--AGTITETIVSGSKAF-
HYAL_STRPU      PSSGTVTINVVVDTTSPVITVPSNTITREVEL-GTPGVNVFYTEPTATDNS-GIANLVSRTNQPGDFFNV
TCNA_TRYCR      --------------------------------------------STPSTPADSSAHGTPSTPVDSS--AH
OMPA_RICCN      ITAIN-----VADTTPIGLNIAQNTVVGSIVTGGNLLPVTITAGKSLTLNGNNQSAAPAKITLAGNINGG
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     VTGTTGPSAEETGATGPSAEVXXXXXXXXXXXXXXXLSAEVTGTTGPSAEVTGLPGVSAGVTTIGSPAAV
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      VSFVGDSSTAQVDLQKSKNEVVADG-NDSVTMTATVAKGNLLNDVMVTFN------------VNSAEAKL
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      GSSAPPTSSAVNSATTPSAPVTSSAVNSHSGSSAPPTSSAVNSATTPVHSGSSAPVTSSAVNSATTPVHS
RGAG1_MOUSE     IATLPKPVPDVEAMSPLLMTALTSTVMPSQLISASS-SGVMSPDTTQNINSEVMSAPPIRV---------
GUXB_CELFI      VSAPSTAXXXXXXXXXXXXXXXXXXXXGLAAMTVTETSVALTWNASTDTGGSG---------LKGYDVYR
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       TSLENA----------------TAVTNETGTAAFNLTESD-AGTFTPTFGVAGDASATTNATLTVKQGAV
P2P_LACPA       ----------------------------------------------------------------GIPDKI
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       KHDLNTTYDAATNSFTASMPVTNADYAAQVDLYADKAHTQLLKHTAPTFNGSDQTSATIKVTADTKTVNV
P3P_LACLS       KHDLNTTYDAATNSFTASMPVTNADYAAQVDLYADKAHTQLLKHTAPTFNGSDQTSATIKVTADTKTVNV
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       SFTASMPVTNAVDLADKAHTQLLKHFDTKVRLTAPTFTDLKFNNGSDQTS-EATIKVTGTVSADTKTVNV
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       IGTLTR--TIVVN--DGIGPVFNGINTITASINENITVEQI------------KAGLAAIDAIDGNVTT-
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ------------------------------------------------------------VYADPNQALS
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      VSFVGDSSTAQVDLQKSKNEVVADG-NDSATMTATVAKGNLLNDVKVTFNVNSAA------------AKL
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      TDA-SSPITVTLDQEKPELTL------------DNPKDGGKTNKETLTVKGAVSDDNLKDVKVNGKKATV
INVA_YERPS      RQSVDTHFTIAADSTLAAVP--TSIIAD------GLMASTITLELKDTY-GDPQAGA--NVAFDTTLGNM
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      TTKANSGQDITVDSNG---ITTTGIINGADNLTGDYVWEDTNKDGIQDDNEKGISGVKVTL-KDEKGNII


                         .         .         .         .         +         .         .:2170
query           GTTTVNSDGTWSFTPQTPLANGSHTFTLSATDPAGNSSAVSSGFVLTIDATPPAAPVIASVADNTAPVTG
YHU2_SCHPO      SSTALNTS--------TPITSSS---VLNSSTPITSSTVLNS-----------STPITSSTALNTSPITS
YBKF_SCHPO      -TSTFPANGTTSGTVEVTIVSGSKTFT--STFPANGTT---SGTVEVVE--PTAGTITETIVSGSVGYTS
HYAL_STRPU      GQTVV---------------------TYTFQDPSGNASGTVTINVVEVDTTPPQVFVTTGEVVRTAPFGS
TCNA_TRYCR      GTPSTPADSSAHGTPSTPVDSSAHSTPSTPVDSSAHSTPST-----PVDSSAHGAP--STPADSSAHGTP
OMPA_RICCN      GIITVKTDGTIGNTNALATVNGAGIATLGAIIKATTTKLTNAASVLTL---TNVNAVLTGAIDNTTGVVG
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     TGTIRPSAVVTGITGLSAEVTGTTGLSAWVTGIAGLSAGVTE------------------TIGSSAGVTG
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      SQTEVNSHDGIATATLTSLKNGDYRVTASVSSGSQANQQVNSTAALTL-SVPSGDITVTNTAPQYMTATL
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      GSSAVTSSAVDSAT--TPVHSGSSSAVNSATTPSGSSAPVTSSAVNS--ATTPSAPVTSSAVNSSAPPTS
RGAG1_MOUSE     -----SSTGLMSTLPVRASDTAATPIQLMRVPASGNMSTSQKTVPVSGSMSTPLMAVTSPGAIFTEQMPS
GUXB_CELFI      GATRVGSTTTASYTDTGLTAATAYQYTVRATDNAGN----------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       RTYT-REDGTGNGTPESPYEIDS-LADLQAID--NSSTARNNSYRLTADIDASATEPIANATDDDEAFTG
P2P_LACPA       SSTTTGYEGTYTFSGTYPAADGTYTHDLNTTYDAATNSFTASMAVTNADY----AAQVDLYADKTAPTTD
SUBF_BACSU      ----------------------------------------------------------AAVPEITSPT--
OMPB_RICRI      ---------------------GGTTINFTGTDGTGRLVLLSKHAAATFNITGSLGGNLKGVIENTVAVDG
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     --SSINVGNVTSYTV-TGLKDGTYYFEVLAYNSIGYSSP--SSIIALTPASVPNPPQLVSVKYGNDNVT-
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ------------------------------TTTKADMPARTTGFYLTDTSTLWTAPKYTQYKASKVSLYG
P2P_LACLC       GDTVAALDAQHHFSVDVPVNYGDNTIKVTATDEDGNTTTEQKTITSSYDVTFGANEFNATSAKFYDPKTG
P3P_LACLS       GDTVAALDAQHHFSVDVPVNYGDNTIKVTATDEDGNTTTEQKTITSSYDVTFGANEFNATSAKFYDPKTG
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       GDTVAALDAQHHFSVDVPVNYGDNTIKVTATDEDGNTTTEQKTITSSYDVTFGANEFNATSAKFYDPKTG
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       -SIVVDSDNL------TGKANGVYEVVFRAVDAAGNQTFHT--VTVSIVASPPGFYILNSNSVRLLPILN
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     PTSTVANTAQYAAYDYSTIDHASHTQANSVAHTTAPAYAQTNGAASMSSAEPLASQPPDTLSVRTQGIMG
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      SQTEVNSHDGIATATLTSLKNGDYTVTASVSSGSANQQVIFIGDQSTAALTL-SVPSGDITVTNTAPLTL
MUC1_HUMAN      -----------------------------ATEPASGSAATWGQDVTSVSTTPPAHDVTSAPDNKPAPGST
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ------ADG--SYSARILLENGRNEIKVIATDLAGNKT--------------------------------
INVA_YERPS      GVITDHNDGTYS-APLTSTTLGVATVTVKVDGAAFSVPSVTVNF--TADPIPDA----------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      STTTTDENGKYQF---------------------------------------------------------


                         .         .         *         .         .         .         .:2240
query           IVPNGGSTNETRPTLSGTGEAGTTISIYNGSALVGTAQVQANGSWSFTPSTSLGAGVWNLTATATDAAGN
YHU2_SCHPO      STVVNSSTPITSSTVVNTSTPITSSTVVNSSTPI-TSSTALNTSTPITSSSVLNSSTPITSSTVVNTSTP
YBKF_SCHPO      TFPANGTTSGTVEVVEPT--AGTTETIVSGSKTF-TSTFPASGTTSGTVEVPTAGTITETIVSGSKAFTS
HYAL_STRPU      SGVNVFFTEPVAIDNSGTADLGSTVVTYSGNEATGTFTVTVEEMVDTTPPTVTVSGVIYTEPTATDNSGE
TCNA_TRYCR      STPVDSSAHGT-PSTPADSSAHSTPSTPADSSAHSTPSTPADSSAHSTPSTPVDSSAHGTPSTPADSSAH
OMPA_RICCN      VLNLNGALSQVTGNIGNT-NALATISVGAGKATLGGAVIKANGIVTFTGDSTVTGNIGNTNALATISVGA
YKL1_SCHPO      ---------------SGTQEYTTTLATASGT-VSGTVEVIEPAAGTVT--TTVYSGTQEYTTTLATASGT
MUC19_HUMAN     T--NGLSAEATGTTGPSAGVTGTTGL---SAGVTGTAGLSAR----VTESTGLSAGVTGTTGLSAGVTGT
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      QDKNGNPLKDKEITFSVPNDVASKFSISNG----GKGMTDSNGV-AIASLTGTLAGTHMIMANVSDAQPM
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      SVVNSATTSSAPPTSSAVNLA--TTPVHSGSSTPATNSTTDSATTPVPPGSSMQ------TTEAISGSAN
RGAG1_MOUSE     TASGTMSTHLTMPQTPGTMPIGFMKSTSNGAVSAQQIRCSVSGMMSTQP----------VIATASE----
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       SLDGDGHTRSGADTVGLFGELDTAGVLEN--VTLQNASVTGGNDVGLVAGTSIGTTELNSVLTESSAAVN
P2P_LACPA       LKFNNGSDQTSEATIKVTG----TVSSDTKTVNVGDTVAALDAQHHFSVDVPVNYGDNTIKVTATDEDGN
SUBF_BACSU      ---DKSYTNKDSVTVKGNASPGTTVHIYN--XXXXXXXXXXXXXXXFHAGIILNKGENELTATASTDNGT
OMPB_RICRI      LTANAGAANAVIGTNNGAGRAGFVVSVDNGKVATIDGQVNATGQVNFRHIVDVGAAASKVTITQDSNFGN
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     -------LNWLPPTFSGGYLLGYYVIVKNENSMVSS---------HFVNSTSLT--ISNLTPNVT-----
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      VAKDTKFTVDQAATKTREGSLYYHVTATNGSGISG---------WIYA-----GKG-FSTTATGTQVLGG
P2P_LACLC       IATITGKVKHPTTTLQVDGK-----------------QIPIKDDLTFSFTLDLGTLGQKPFGVVVGDTTQ
P3P_LACLS       IATITGKVKHPTTTLQVDGK-----------------QIPIKDDLTFSFTLDLGTLGQKPFGVVVGDTTQ
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       IATITGKVKHPTTTLQVDGK-----------------QIPIKDDLTFSFTLDLGTLGQKPFGVVVGDTTQ
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ILNASDAENSTNYTVSVPGTYNLSFTLYGESHQVSITVLGQNDSIIPTP---------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ------------------------------------SRVIGSGATSTVTPKAQDNVTYRVYAISRDQLGN
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       -----------RPTDGGLSWSDDHKSIYRYDATLGT-QITTNDILTLLKATTTVPGLRNNIAGNEKAQAE
VPS27_USTMA     GAPSNVSTPADKSQVINDGKGNESIST---SHLPEDASISSRNGWSAVPTPALTEGALERTATGTD----
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      QDKNGNPLKDKEITFSVPNDVASRFSISNS----GKGMTDSNGT-AIASLTGTLAGTHMITANVSDTQPM
MUC1_HUMAN      APPAHGVTSDTRPAPGSTAPAHGVTSAPDTRPAPGSTAPPAHGVTS-APDTRPAPG-----STAPPAHGV
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:2310
query           TSAASEIRSFTIDTTAPAAPVIDTVYDGTGPITGNLSSGQITDEARPVISGTRETNTTIRLYDNGTLLAE
YHU2_SCHPO      ITSSTVVNSSTPITSS-------TVVNSSTPITSSITSSSVLNSSTPITSSTA-LNTSTPITSSSVLNSS
YBKF_SCHPO      TFPANGTTSGTVEVVEPTAGTIETIVSGSVGYTSTFPASGTTSGTVEVVEPTAGTVTETIVSGSVGYTST
HYAL_STRPU      ANLVSRTAQFPVGTTT-----VEYVYQDPA---GNEGRGQFTVTVIAVDTTPPSVNCPNNVFQEGTSSAP
TCNA_TRYCR      SSSAHGTPSTPVDSSAHSTPSTPVDSSAHGTPSTPVDSSAHSTPSTPVDSSAHGTPST-PVDSSAHSTPS
OMPA_RICCN      TLGGAIIKATTTKLTDNASAVTFTVVTGAIDNTGNANNGIVTFTGDSTVTGNIGNTNALATISVGAGKAT
YKL1_SCHPO      VSG-------TVEVIEPAATVTSTVYSGTQEYTTTLATASGT------VSGTVEVIEPAA----GTVTTT
MUC19_HUMAN     TGPSAGISAEVTGTTGPLAGVTGTIGLSAG-VTGIAGLSAGVTESTGLSAG---VTGTIRSSAVVTGING
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      TFVADKDRAVVVLQTSKAEIIGNGVDETTLTATVKDPSNHPVAGITVNFTMPQDVAANFTLENNGIAITQ
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      TPIHNG--SLVPTTSSALVPTTSAAHSGASAMTNSSESDLATT---PIDSGTSISTTKAP--------AT
RGAG1_MOUSE     ---------------------IMSVSQSTVPTSGSVS----TQKTRAPVSGPMST-TQIR----------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       TSGSQRVGGLTVTATGQYAGGLIGESQGTIPVTNTAASGNVTGTA-DVGGLIGRTNTTVR----------
P2P_LACPA       TTTEQKTSSYDPDVLKNAVTFDQGVKFGANEF--NATSAKFYDPKTGIITGKVKHPTTTLQVDG----KQ
SUBF_BACSU      TDASSPI-TVTLDQEKPEL-TLDNPKDGTLTVKGAVSDDNLKDVK---VNGKKAT---------------
OMPB_RICRI      T----DFGNLAAQIKVPNAITLTGNFTGDASNPGN-TAGVITFDANGTLSASADANVAVTVQLSGTHAAE
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----YNVFIYAVNKLGNSSPLVLTVV----PITKASVFAFITKLGNGILTTSFPANITLELYNNGNLISQ
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      LSTDKSVTA----TNDNSVKIVYRTTDGTQVGSNTWVTSTDGTKAGSKVSDKAADQTALEAYIN------
P2P_LACLC       NKTFQEALTFILDAVAPTLS-LDSSTD--APVYTNNPNFQIT--------GTATDNAQLSLSINGSSVAN
P3P_LACLS       NKTFQEALTFILDAVAPTLS-LDSSTD--APVYTNDPNFQIT--------GTATDNAQLSLSINGSSVAN
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       NKTFQEALTFILDAVAPTLSLESST---DAPVYTNDPNFQIT--------GTATDNAQLSLSINGSSVAN
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ETASATYELVRFDNVGPT--ITGSVIRDTSPFASQEPERCLSDIATITLGGITDNAGGVGLNPGQGLTFT
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       AGGRPNYKTTGYSQSNPTS-------DGQRQFTLNGQVIQIMDIINPSFGGQPVTNSNVRAHSNSTVVSV
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      TFVADKDRAVVVLQTSKAEIIVDTVKDPFDNVVKNLSVVFRTSPADTQLSNARNTN------ENG--IAE
MUC1_HUMAN      TS-APDTRPAPGSTAPPAAPDTRPAPGSTAPPAHGVTS---APDTRPAPGSTAPPAHGVTSAPDTRPAPG
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:2380
query           IPADNSSSWRYTPDASLATGNHVITVIAVDAAGNASPVSDSVNFVVDTTPPLTPVITSVSDDQAPGLGTI
YHU2_SCHPO      TPITSSTALNTTPITSSSVLNSSTPITSSTVVNTSTPITSST--VVNSSTPITSSITSSSVLNSSTPITS
YBKF_SCHPO      FPASGTTSG--TVEVVEPTAGTVTETIVSGSVGYTSPASGTTSGTVEVVEPTAGTITEVSGSKAPANGTT
HYAL_STRPU      VFFTEPTAFDISGQANLVTGTTSVSYIFSDNSGNAEPCTFTVTIAVDTTPPTVNCINNVA--QTVQLGTG
TCNA_TRYCR      TPADSSA--HSTPSTPADSSAHGTPSTPVDSSAHSTPSTPADSSAHST--PSTPVDSSAHSTPSTPADSS
OMPA_RICCN      LGGAKATTTKLTDNASAVTTNPVVVTGAIDNTGNASTVTGNIGIIKATTTKLTDNASAVTTNPVVVTGAI
YKL1_SCHPO      V---YSGTQEYTTTLATASGTVSGTVEVIEAAGTVTTTVYSGSEVYTTT-------LASASESVPGTVEV
MUC19_HUMAN     LSAGVTGTTGPSAEETGATGXXXXXXISAEVTGTTGPSAESPAAVTGTTRP-SAVVTGISGLSAEVTGTT
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ANGEAHVTLK-----GKKAGTHTVTATL---GNNNTSDSQPVTFVADKAS--AQVVLQISKDEITGNGTV
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      TPVHNGS---LVPTTSSVLGS-ATTLIHNDTSTMATPVGNGTQSSVPSRHPVTPTPPAVSSNSTIALST-
RGAG1_MOUSE     ---TTASALTSTPQRATASGTMSIPLMTAKTSGSASTL-----LMRDTASG----VISVPQMRAPGSGTV
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ISIKNDLTFSFTLDLG-TLGQKPFGVVVGDTTQNKT-FQEALTFILDA---VAPTLSLDSSTDAP-----
SUBF_BACSU      -VADGS----YSARILLENGRNEIKVIATDLAGNKTTKKTVIDVNFD-KPVISGLIPGEDKNLKAGESVK
OMPB_RICRI      LRLGNAGSIFKLADGTVINGK-------VNQXXXXXXXXXXXXXXXDGSATITGDIGNAGGAAALQRITL
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     IAAGNSSYLFRVPQ-----GNYTLVIIASNSAG----VSKYVYQVVYYLPPASPQVSLI------GFG--
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ------------PGDVFPVGQTVVTYTFQDPSGNPASATVTINVVVDTTPPVISV-PSTFITRTVELGT-
SLAP_LACBR      --ANKPSGYTVTPNAADATYGNTVYATVSQAA------TSKVALKVSGTPVTTALTTADANDKVAANDTT
P2P_LACLC       INSGKPGHMAIDQPVKLLEGKNVLTVAVTDSEDNTTTKNITVYYEPKKTPTVTPSTTEPAKTVTLTANSA
P3P_LACLS       INSGKPGHMAIDQPVKLLEGKNVLTVAVTDSEDNTTTKNITVYYEPKKTPTVTPSTTEPAKTVTLTANSA
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       INSGKPGHMAIDQPVKLLEGKNVLTVAVTDSEDNTTTKNITVYYEPKKTPTVTPSTTEPAKTVTLTANSA
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      LGGRQIQAGQFDTN-QLADGEYTIGFNSLDALGNSAPTNAKV--YIDNTDP------TVNFNRAVMQGTF
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       NESAANGAGAFTIDHVVKNNS---THNAADAVYKASPYGEHLNQNTDNTNEAINIYFVPSDLVNP---TI
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      -------------------GQSTVTVVSTDQANNKSXXXXXXXXXXXXAPTVTPIGDQSSEVYSPSPIKI
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      VTLKGTVLGVHTAEAILLNGNRDTKIV------NIAP--DASNAQVTLNIPAQQVVTNNSDSVQL---TA
MUC1_HUMAN      STAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS------TAPPAHGVTSAPDTRPAPGTAPP
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ---------------------YAYTVRAFDAAGNVSAPSAALTVTTKATP---------SDTTAPSVPAI
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      -PANNS-----TNDAIDSDGERDGTRKVVVAKGT---INNADNMTVDTGFYLTPKYN---------VGDY
SDRF_STAEP      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:2450
query           ANGQNTNDPTPTFSGTAEAGATITLYENGTVIGTTTAQPDGAWSVSTSTLASGTHVITAVATDAAGNSSP
YHU2_SCHPO      STALNTSTPI-TSSSVLNSSTPIT---SSTVLNSSTPITSST-ALNTSTPITSSSVLNS-STPITSSSVL
YBKF_SCHPO      SGTVEVVEPTATITETIVSGSTSTFPANGTTSGTVEVVEPTAGTI-TETIVSGTSTFPASGTTSGTVEVV
HYAL_STRPU      STQVFFTEPTADISGQ-------------TSLVTRTSAPGDSFPVGTTS-------VTYIFTDASGNNAQ
TCNA_TRYCR      AHGTPSTPVDSSAHGTPSTPADSSAHST-----PSTPADSSAHSTPSTPADSSAHSTPSTPVDSSAHSTP
OMPA_RICCN      DNTGNANNGIVTFTG----DSTVT-----GNIGNTNAL--ATISVGAGKATLGGAIIKATTTKLTDNAST
YKL1_SCHPO      VDPEAGSVTTTIYSGSVEY-TTVLADASGSVTGTVEVVEPAAGTVTT-TVYSGSEVYTTTLASASESVDP
MUC19_HUMAN     GLSAGVTETIGSSAGVTSAEATETTGPSAGVTGTTGLSAGVTGTTGPSAGIAGTNGLSAGVTGTTGLSAT
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      KDDNEVNNLPVTFS-SASSGLTLTP-------GVSNTNESGIAQATLAGVAFGEKTVTA---SLANNGAS
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     SKPLMTSKASGMFMTTAAFGATPTSLMRDTASGMTDPASGGMSTLLTRATASGTKSTSQMTATTSGGSGP
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       -------------------------YEAGVEIATETASSPGDWTLATHTFTADSTAETLTFTQITPSSGA
P2P_LACPA       ---VYTNDPNFQITGTATDNAQLSLAINGSHVASNSGKPGHMAIDQPVKLLEGKNVLTVAVTDSENNTTP
SUBF_BACSU      IAFSSAEDLDATFTIRMPLTNARASVQNATELPLREISPEGYWTATSSIKAKGAKV-EVIVRDDYGNETR
OMPB_RICRI      ANDAKKTLTLXXXXXXXXXXXTIDLQANGGTIKLTSTQNNIVVDFDL-----------AIATDQTGDASS
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ------NNLYISWNNEANV-ITYLVYVNNSLVY------EGPSNSIVTNISNGTYLVKVIGVNPAGSSSP
INVA_YERPS      ----------------------------------------------TDDLTANFYSLSALAVDHQGN---
HYAL_LYTVA      -PGVNVFYPEPTASDNS----------GTAILVTRTNQPGDFFSV-------GQTVVTYTFQDPTGN--P
SLAP_LACBR      ANGSSVAGSTVYAAGTKLAQLTTDLTEKGQVVTLTAIDTDLEDATFTGTLGKAYHYTYTYNKDSAASSNA
P2P_LACLC       ATGQYSADGGKTYQDVPAAGVTVT--ANGT----------------------------------------
P3P_LACLS       ATGQYSADGGKTYQDVPAAGVTVT--ANGT----------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ATGQYSADGGKTYQDVPAAGVTVT--ANGT----------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ------------------AGANDTA--NGTAVTTTPAMPAGANDTANIT----------TATPTGANDTA
HPI1_DEIRA      ASGERVSVESDASDGGCGVYETRLFWDNGVVDDATT----------TPAIGHPVQFARQRVTDGAKADSL
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ---------------------------------------------------SNVYKVTARAYDRNGNSS-
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      --------------GTTNHSTIYTTINSGTVASTYTV-----------TLADGDVVVKDIEPXXXXXXXX
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       SVGNYTNHQVETFTNTITANQSVTVPTTSQLTGTVDNNHQHVSATAPNVTSTTNKTINLVATDTSGNTA-
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ATQDNSGNAVTNKSTGLPSGLTFDS-TNNTISGTPT-------NIGTST-------ITIVSTDASGNKTT
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      TVKDPSNHPTVNFTMPQDVAANFTLENNGIAI----TQANGEAHVTLKGKKAGTHTVTATL---GNNNAS
MUC1_HUMAN      AHGTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPHGVTSAPDTRPAPGSHGVTSATRPAPGSTAP
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      TSSSSTNSVTIGWSASTDNAGGSGLAGYDVYRGATVAQXXXXXXXXXXXXXSTAYEYTVRARDVAGNVSA
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      VWEDTNKDGIQDDNEKGISGVKVTLKKNGDTIGTTTTDSNGKYEF--TGLENGDYTITKQNSGSDEGKDS
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:2520
query           NSTAFTLTVDTTAPQTPILTSVVDDVAGGVTGNLANGQITNDNRPTLNGTAEAGSVVSIYDGDTLLGVTS
YHU2_SCHPO      NSSTPITSSTVVNSSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSSVLNTSTPI-TSS
YBKF_SCHPO      EPTAGTVTETVISGSVSFMSTVVEPTAGTVTETIVSGSIPFTSTIPAQGTTSGTVEVVEPTAGTVTETII
HYAL_STRPU      PCTFNVVAVDTTPPTVNCANNIAQTIELGSTSAVVN--YAEPSATDISGTAFLVSRSS------------
TCNA_TRYCR      STPA-----DSSAHSTP--STPADSSAHSTPSTPADS--SAHSTPSTPVDSSAHSTPSTPADSSAHGTPS
OMPA_RICCN      NPVVVTGAIDNTGNANNGIVTFTGN--STVTGNIGNTNAVGAGIATLEGAVIKATTTKLTNAASVLTLTN
YKL1_SCHPO      EAGSVTTTIYSGSVETTVLADVVEPAAGTVTGTLTSGQFFTTTIAQASGSVSGNVEVIEPSGST---VTS
MUC19_HUMAN     ESTGLSAGVTGTIGSSAVVTETT-RLSSGVTGTIGSAEETGATGLSAEVTGTTGSLAEV-TGTTGLGVTG
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      DNKTVHFIGDTAAAKIIELAPVPDSIIAGTPQNSSGSVITNNGFPTVNFTSNAGQAVTNEQGKATVTYTN
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     GATSTPLMRATASEKMPSQAMNIQD-SGGVSTPLM--------RPVALGGVQMRSQGS---GTMSTPLLR
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       KGMAIDNVIDTAAP-----TVSVNQPAGGAT------LTTSD--VALNASAETGNWTYSVDGGPNQTATD
P2P_LACPA       KKTAPTVTPSTTEPAKTVTLTANAAATGETVQYSADGGKTYQDVPAAGVTVTANGTFKFKSTD-------
SUBF_BACSU      KTANGKLNMNT-----------------------------------------------------------
OMPB_RICRI      LTNAQTLTINGKI-----------GTIGANNKTLGQFNIGSSKTVLSNGNVAINELVIGNDGDTYLITRT
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     GIAVIHYTGD------------------------------------------------------------
INVA_YERPS      RSNSFTLSVTVQQPQLTLTAAVIGD------GAPANGKTAITVEFT----------VADFEGKPLAGITT
HYAL_LYTVA      ATATVTINIDTTPPTVNCINDVIRTVELGTT---------------------------------------
SLAP_LACBR      -STQFGSNVTGTLTATLVM---------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      NVTMPAGATDTVVTTTPAMPTGANDTANITTATPAG---AND---TANVTMPAGAT------DTVVTTTP
HPI1_DEIRA      NAGWNALQLPNGAGAVYLRALVVDRAGNATTPIVVNAKITNQARPLLGG----------FDAFK----RN
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       NNVLLTITVGQVVDQVGVTDFTADKTSAKADGTEA---ITYTATVKKNGVAQANVPVSIVSGTAVLSANS
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      GSHEFTTTLAEASGTVPGTVEVVEPLAGTVTTTIHSGSVENTTLATASGTV-PGTVEVV---EPAVGVTT
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       -TTSFNVTIKPLRDKYRVGTSSIANISNNATVSQANSLTFTSNAPNRNATASANEITS---------KTV
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      TTFKYEVT--------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      DAQPVTFVADKDSAVVVLQTSKAEIIGNGVDETTLTATVKD---PFDNAVKDLQVTFSTNPADTQLSQSK
MUC1_HUMAN      PAHGVTSAPDTTAPPAHGVTSAPDTPAPGSTAPPAHGVTSPDTRPAPGSTAPAHGVTSAPDTRPAPGSTA
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      PSTAXXXXXXXXXXXXXXXXXXXXGLAAMTVTETSVALTWNASTDT------GGSGLKGY--DVYRGATR
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      NGTKTTVTVKDADNKT------IDSGFYKPTYNLGDYVWEDTNKDGIQDDSESGVKVTLKDNGNAIGTTT
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:2590
query           ANASGAWSFTPTTGLNDGTRTLTVTATDPAGNVSPATSGFTIVVDTLAPTVPLITSIVDDVPNNTGAIGN
YHU2_SCHPO      SVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPIT
YBKF_SCHPO      SGSVGYTSTFPAQGTTSGTVEVTVTETIISGSVGPAQGTTSGTVEIVAPTAGTVTETI-----VSGSI-P
HYAL_STRPU      ---------SPGDSFPIGSTTVTYIFSDQSGNEAPPCV-FTVTIGTVDTMMPMFTSCPNNIVQSVELGVP
TCNA_TRYCR      TPADSSAHSTPSTPVDSSAHSTPSTPADSSAHGTPSTP-----ADSSAHSTP--STPADSSAHGTPSTPA
OMPA_RICCN      VNAVLTGAIDNTTGVNVGVLNLNGALSQVTGNIGNTNALATISVGAGKATLAVIKATTTKLTDNASAV--
YKL1_SCHPO      TIYSGSESFTTTLAVGSGTIPGTVEVILPA----------------------------------------
MUC19_HUMAN     TIGSSA-VVTGTTGLSTGTNGLSAEVTGTAGPLAGVTG-----TTGLSAGVTGTTGLSAGVTETTGQSAG
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      TRSSGARPDTVEASLENGSSTL---STSINVNADASTAHLTL-LQALFDTVSATTSLYIEVKDNYGGVPQ
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ASDSSEMSMLLTKAPSSGERPLLLVRPPASGEIAP-----------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ANGTKTLNVT-LSGLADGSHTATVYIKDDGGNIGIDTVSFTI---SSAPTV-------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      TNAAGQGKIIFNPVVNNGTTLAAGTATNPLAEINFGSKGVNVTVLNVGEGVNLYATNITTTDANVGSVFN
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      NNGALPNKITEKTDANGVARIALTNTTDGVTVVTAEVEGQRQSVDTVKGTIAADKSTLAAVPTSIIADGL
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      AMPAGANDTANVT--KPAGSTDTVVTTTPA----------------------------------------
HPI1_DEIRA      ASAQFMSNSNAISGVNGTAVTPNTTANSALDNILSLDSVGTLTTNAYLPRGATETAITEKI-RNVGAYGR
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ANTNGSGKATVT--LKSDKPGQVVVSAKTAEMTSALNANAVIFVD---QTKASITEIKAD---KTTAVAN
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      TIYSGSEEFTTTLASASGSISGTVEVIEPTAGTVTTTSGYTTILAEASGTVPGTVEVIE-----------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       SNVS-------RTG-NNAQVTVTVTYQD------GTTSTVTVPVKRVIPEI--VAHSHYTVQGQDFPTGN
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      SN------------------------TNDSGVAEVTFKGTVLGVHTAEATLP-------NGNNDTKIVNI
MUC1_HUMAN      PPAHGVTSAPDTRPAPGSTAVTSAPDTRPAGSTAPPAHGVTSAPDTTAPPAHGVTSAPDPAPGSTAPPAH
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      VGSTTTASYT-DTGLTAATAQYTVRATDNAGNV-------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      TDASGHYQF---KGLENG--SYTVEFETPSGTPTKANSGQDITVDSNGITTTGIINGADNLTIDSG----
SDRF_STAEP      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:2660
query           GQSTNDTQPTLNGTAEANSAVSIFDNGALVATVNANASGNWSWTPTAALGQGSHAYXXXXXXXXXXXXXX
YHU2_SCHPO      SSSVLNSSTPITSSTVLNSSTPITSSTALTSTPITSSSVLNSSTP---ITSSSVLNSSTPITSSTVVNSS
YBKF_SCHPO      FTSTIPAQGTTSGTVEVVEPTA----GTVTETIISGSVGYTSTFPAQGTTSGT-------------VEIV
HYAL_STRPU      GTVISWTTPTANDAAGIASIVSNLQPGSFF-TVGESATVTYVATDNSGLTDNSCSF--------------
TCNA_TRYCR      DSSAHSTPSTPAGSS-ANGTVLILPDGAALST--------------------------------------
OMPA_RICCN      -TFTNPVVVTIDNTGNANNGIATFTGD---STVTGNI-GNTNALATVNVGAGLRVQGGVVKSNTINLTDN
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     VTESTGLSPGVTGTIGSSAVVTGIKSAGVTGTTGPSAEETGATGPSAEXXXXXXXXXXXXXXXXXXXXXX
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      QEVTLSVSPSEGVTPSNNAIYTTNHDGNFYASFTATKAGVYQLTATLENG--------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      AGGTNIVSGTVGGQQGNKFNTVALENGTTVATFNGNTTGNYTADCVASAGTGIVEFVNTGPITVTLNKQA
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      MASTITLEKDTYGDPQAGANVAFDTTLGNMGVITDHNDGTYS-APLTSTTLG------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      FDATQNTDPTLR---------SAYVNAGNLANQRGN---NWRRTPWVELGSSDTA---------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       GQ--------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       GASASDYFKLSNGSAIPDATIT------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      APDASNAQVTLNIPAQ-QVVTNNSDSVQLTATVKDPSNH-----PVAGI---------------------
MUC1_HUMAN      GTSAPDTRPAPGSTAPAHGVTSAPDTRPAPGSTAPPAHGVTS-APDTRPAPGSTA-------------PP
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:2730
query           XPSITIIVDTIAPGAPGNLVINATGNRVTGTAEAGSTVTITSETGVVLGTATADGTGSFTATLTPAQTNG
YHU2_SCHPO      TPITSSSVLNSSTPITSSTALN-TSTPITSSSVLNSSTPITSSTVVNSSTPITSSTVVNTSTPITSSTVV
YBKF_SCHPO      APTAGTVTETIVSGSPFTSTIPAQGT-TSGTVETAGTVTETIISGSVGYTSTFPAQGTTSGTV-------
HYAL_STRPU      --TVTVFVDTTPPSV-------VCTNNVFQTVELGTNVFYTEPTASISGQANLVSRTNVPGDSFPVGTS-
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ASAVTFTNPVVVTGA-----IDNTGNANNGIVTFTGDSTVTGNIGNTNALATI-SVGAGKATL------G
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     XXXXPSAEVTGLPGVSAGLTTIGSPAAVRGTTWPSAVVTISGLSGEVTGTAGVTGIGGLSAGVTGTIGSS
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      APVNALKQITVS--GPGNVVINEIGN--AGNHHGAVTDTIAFE---------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      VATVTVKVDGAAFSVP-SVTVNFTADPIPDAGRSSFTVSTPD--------ILADGTMSSTLSFVPVDKNG
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      -----TVNFTMPQDVAANFTLENNGIAIT-QANGEAHVTLKGKKA---------GTHTVTATLSNNNTSD
MUC1_HUMAN      AHGVTSAPDTPAPGSPAHGVTSAPDTRPASTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:2800
query           QPLLAFAQDKAGNTGIAAGFTAPDTRVPEAPIITNVVDDVGIYTGAIANGQVTNDAQPTLNGTAQAGATV
YHU2_SCHPO      NTSTPITSSTVVNS--STPITSSTVLNSSTPITSSSVSSTPITSSTVVNTSTPITSSTVVNSSTPITSST
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      TVTYVFA-DNSGNTADACSFTAQDTTPPTVNCITNIVRTVELGTSSVQNEPTASDGQASLSRTAQPGDNF
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      GAIIKATTTKLTDNASAVTFTNP-------VVVTGAIDN----TGNANNGIVTFTGDSTVTGTVNVGAGV
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     AGVTALSAEATGTTGPSAGVTG------TTGLSAGVTGTTGLSAG--VTGTIRSSAVVTETTGLSAGVTG
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      HFISGMQGLSFTQNGVPVSI-SPITEQPDATVVGNTAGDVTI----------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      SQPVTFVADKTGNGVDSATLTATDNEVNNLPVTFSTASSGLTLTPGESNTNESGIAQATLAGVAEQTVTA
MUC1_HUMAN      TAPPAHGVTSAPDTRPAPGSTAPPAHVTSAP---------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:2870
query           SIYNNGALLGTTTANASGNWSFTPTGNLTEGSHXXXXXXXXXXXXXSVSTAATVIVDTLAPGTPSGTLSA
YHU2_SCHPO      VVNTSTPITSSTVVNSS-----TPITSSTALNTSTPITSSSVLNSSTPITSSTV-VNTSTPITSSSVLNS
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      PVGVNPVVFGDNSGNQADPCTFTITVNTQDTTPPTVTCISDITRVVELGTTSVGISYTEPTATDSGTATL
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      TLQAGGSL--------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     TTGPSAGIAGTNGLSA----EVTGTTGLSAGMTGTTGLSARVTESTGLSAGVTGTIGSSAVVTETTRLSA
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      SLANNGA---------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:2940
query           DGGSLSGLAEANSXXXXXXXXXXXXXXXAGSNGAWSLTLPTKQIEGQLINVTATDAAGNASGTLGITAPV
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      DSRS------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     GTGTIGPSAEETGATGLSAEVTRTTGSLAGVTGT---TGPSAVVTGK------TELSAEVTGTTELSAEV
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:3010
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:3080
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:3150
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:3220
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:3290
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:3360
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:3430
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:3500
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:3570
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:3640
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:3710
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:3780
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
DIG1_CAEEL      ----------------------------------------------------------------------
YEEJ_ECOLI      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
RGAG1_HUMAN     ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
OMPB_RICRI      ----------------------------------------------------------------------
INLI_LISMF      ----------------------------------------------------------------------
Y1033_SULSO     ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
HYAL_LYTVA      ----------------------------------------------------------------------
SLAP_LACBR      ----------------------------------------------------------------------
P2P_LACLC       ----------------------------------------------------------------------
P3P_LACLS       ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
P1P_LACLC       ----------------------------------------------------------------------
MAGE1_MACFA     ----------------------------------------------------------------------
YO13_BPL2       ----------------------------------------------------------------------
MUC16_HUMAN     ----------------------------------------------------------------------
HPI2_DEIRA      ----------------------------------------------------------------------
VG50_ICHV1      ----------------------------------------------------------------------
HPI1_DEIRA      ----------------------------------------------------------------------
CADH3_CAEEL     ----------------------------------------------------------------------
SDRF_STAES      ----------------------------------------------------------------------
EAE_ECO27       ----------------------------------------------------------------------
EAE_ECO11       ----------------------------------------------------------------------
YQ39_SCHPO      ----------------------------------------------------------------------
INLI_LISMO      ----------------------------------------------------------------------
EBH_STAAR       ----------------------------------------------------------------------
VPS27_USTMA     ----------------------------------------------------------------------
SRAP_STAAU      ----------------------------------------------------------------------
INLJ_LISMF      ----------------------------------------------------------------------
FAT4_MOUSE      ----------------------------------------------------------------------
YBKF_SCHPO      ----------------------------------------------------------------------
HYAL_STRPU      ----------------------------------------------------------------------
TCNA_TRYCR      ----------------------------------------------------------------------
OMPA_RICCN      ----------------------------------------------------------------------
YKL1_SCHPO      ----------------------------------------------------------------------
MUC19_HUMAN     ----------------------------------------------------------------------
YEEJ_ECO57      ----------------------------------------------------------------------
MUC1_HUMAN      ----------------------------------------------------------------------
MUC1_MESAU      ----------------------------------------------------------------------
RGAG1_MOUSE     ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
GUXB_CELFI      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------
P2P_LACPA       ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
SUBF_BACSU      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
INVA_YERPS      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------
SDRF_STAEP      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:3850
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHU2_SCHPO      --------------------------------------------
YBKF_SCHPO      --------------------------------------------
HYAL_STRPU      --------------------------------------------
TCNA_TRYCR      --------------------------------------------
OMPA_RICCN      --------------------------------------------
YKL1_SCHPO      --------------------------------------------
MUC19_HUMAN     --------------------------------------------
YEEJ_ECO57      --------------------------------------------
DIG1_CAEEL      --------------------------------------------
YEEJ_ECOLI      --------------------------------------------
MUC1_HUMAN      --------------------------------------------
MUC1_MESAU      --------------------------------------------
RGAG1_MOUSE     --------------------------------------------
GUXB_CELFI      --------------------------------------------
RGAG1_HUMAN     --------------------------------------------
HMU_HALWD       --------------------------------------------
P2P_LACPA       --------------------------------------------
SUBF_BACSU      --------------------------------------------
OMPB_RICRI      --------------------------------------------
INLI_LISMF      --------------------------------------------
Y1033_SULSO     --------------------------------------------
INVA_YERPS      --------------------------------------------
HYAL_LYTVA      --------------------------------------------
SLAP_LACBR      --------------------------------------------
P2P_LACLC       --------------------------------------------
P3P_LACLS       --------------------------------------------
SDRF_STAEP      --------------------------------------------
P1P_LACLC       --------------------------------------------
MAGE1_MACFA     --------------------------------------------
YO13_BPL2       --------------------------------------------
MUC16_HUMAN     --------------------------------------------
HPI2_DEIRA      --------------------------------------------
VG50_ICHV1      --------------------------------------------
HPI1_DEIRA      --------------------------------------------
CADH3_CAEEL     --------------------------------------------
SDRF_STAES      --------------------------------------------
EAE_ECO27       --------------------------------------------
EAE_ECO11       --------------------------------------------
YQ39_SCHPO      --------------------------------------------
INLI_LISMO      --------------------------------------------
EBH_STAAR       --------------------------------------------
VPS27_USTMA     --------------------------------------------
SRAP_STAAU      --------------------------------------------
INLJ_LISMF      --------------------------------------------
FAT4_MOUSE      --------------------------------------------
YBKF_SCHPO      --------------------------------------------
HYAL_STRPU      --------------------------------------------
TCNA_TRYCR      --------------------------------------------
OMPA_RICCN      --------------------------------------------
YKL1_SCHPO      --------------------------------------------
MUC19_HUMAN     --------------------------------------------
YEEJ_ECO57      --------------------------------------------
MUC1_HUMAN      --------------------------------------------
MUC1_MESAU      --------------------------------------------
RGAG1_MOUSE     --------------------------------------------
GUXB_CELFI      --------------------------------------------
GUXB_CELFI      --------------------------------------------
HMU_HALWD       --------------------------------------------
HMU_HALWD       --------------------------------------------
P2P_LACPA       --------------------------------------------
SUBF_BACSU      --------------------------------------------
SUBF_BACSU      --------------------------------------------
SUBF_BACSU      --------------------------------------------
SUBF_BACSU      --------------------------------------------
SUBF_BACSU      --------------------------------------------
INVA_YERPS      --------------------------------------------
INVA_YERPS      --------------------------------------------
SDRF_STAEP      --------------------------------------------
SDRF_STAEP      --------------------------------------------