[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF69765.1

[Show Plain Result]


## Summary of Sequence Search
    1::115
    1::114     3e-46  79%  114 aa  YFEC_SHIFL RecName: Full=Uncharacterized protein yfeC;
    1::114     3e-46  79%  114 aa  YFEC_ECOLI RecName: Full=Uncharacterized protein yfeC;
    1::114     3e-46  79%  114 aa  YFEC_ECOL6 RecName: Full=Uncharacterized protein yfeC;
    1::122     8e-19  39%  123 aa  YFED_ECOLI RecName: Full=Uncharacterized protein yfeD;
  527::594     7e-04  26%  636 aa  DNAK_ROSDO RecName: Full=Chaperone protein dnaK;AltName: Full=Heat
    1::115

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTPEELANLTGYSRQTINKWVRKEGWATSPKPGVQGGKARLVHVNEQVREYIRSAERSVDHHADTFTPAS
YFEC_SHIFL      MTPDELARLTGYSRQTINKWVRKEGWTTSPKPGVQGGKARLVHVNEQVREYIRNAERP-EGQGEAPALSG
YFEC_ECOLI      MTPDELARLTGYSRQTINKWVRKEGWTTSPKPGVQGGKARLVHVNEQVREYIRNAERP-EGQGEAPALSG
YFEC_ECOL6      MTPDELARLTGYSRQTINKWVRKEGWTTSPKPGVQGGKARLVHVNEQVREYIRNAERP-EGQGEAPALSG
YFED_ECOLI      MTTEELAECLGVAKQTVNRWIREKGWKTEKFPGVKGGRARLILVDTQVCEFIQNTPMEAEERIAEYAPGA
DNAK_ROSDO      ----------------------------------------LIEAKNQAESLIHSTEKSLEEHSDKVDPTT


                         .         .         *         .         .         .         .:140
query           NASLEALLMTLAKEMTSSEQKQFTSLLVREGITGLLQRLGIRDSK
YFEC_SHIFL      DAPLEVLLVTLAKEMTPVEQKQFTSLLLREGIIGLLQRLGIRDSK
YFEC_ECOLI      DAPLEVLLVTLAKEMTPVEQKQFTSLLLREGIIGLLQRLGIRDSK
YFEC_ECOL6      DAPLEVLLVTLAKEMTPVEQKQFTSLLLREGIIGLLQRLGIRDSK
YFED_ECOLI      RAPAYRQIINAIDNMTDIEQEKVAQFLSREGIRNFLARLDIDES-
DNAK_ROSDO      VEAIELAIAALKDEMESENADKIKSGI--QNVTEAAMKLG-----