[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF69854.1

[Show Plain Result]


## Summary of Sequence Search
    1::71
    1::70      1e-32  86%   70 aa  YAIZ_ECOLI RecName: Full=Uncharacterized protein yaiZ;
    1::70      1e-32  86%   70 aa  YAIZ_ECOL6 RecName: Full=Uncharacterized protein yaiZ;
    1::71

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRLPVKIRRDWHYYAFSIGLIFILNGVVGLLGFEAKGWQTYGVGLVTWIISFWLAGFIIRRREDDEVKDA
YAIZ_ECOLI      MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIRRR-DEETENA
YAIZ_ECOL6      MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIRRR-DEETENA


                         .         .         *         .         .         .         .:140
query           R
YAIZ_ECOLI      Q
YAIZ_ECOL6      Q