[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF69863.1

[Show Plain Result]


## Summary of Sequence Search
    1::417
    1::417       0.0  83%  417 aa  YNFM_ECOLI RecName: Full=Inner membrane transport protein ynfM;
    6::397     2e-86  45%  403 aa  Y532_BUCBP RecName: Full=Uncharacterized transporter bbp_532;
   15::403     4e-77  40%  410 aa  Y588_BUCAI RecName: Full=Uncharacterized transporter BU588;
   51::362     9e-76  51%  413 aa  Y567_BUCAP RecName: Full=Uncharacterized transporter BUsg_567;
    3::382     7e-63  33%  404 aa  YYBF_BACSU RecName: Full=Uncharacterized MFS-type transporter yybF;
   16::277     8e-11  30%  395 aa  YDER_BACSU RecName: Full=Uncharacterized MFS-type transporter ydeR;
   16::208     2e-09  24%  405 aa  YJHB_ECOLI RecName: Full=Putative metabolite transport protein
   69::229     1e-08  27%  410 aa  MDTM_ECO57 RecName: Full=Multidrug resistance protein mdtM;
   69::229     2e-08  26%  410 aa  MDTM_ECOLI RecName: Full=Multidrug resistance protein mdtM;
   55::221     6e-08  24%  510 aa  NANT_YERPY RecName: Full=Putative sialic acid transporter;AltName:
   55::221     6e-08  24%  510 aa  NANT_YERPS RecName: Full=Putative sialic acid transporter;AltName:
   55::221     6e-08  24%  510 aa  NANT_YERPP RecName: Full=Putative sialic acid transporter;AltName:
   55::221     6e-08  24%  510 aa  NANT_YERPG RecName: Full=Putative sialic acid transporter;AltName:
   55::221     6e-08  24%  510 aa  NANT_YERPB RecName: Full=Putative sialic acid transporter;AltName:
   55::221     6e-08  24%  510 aa  NANT_YERP3 RecName: Full=Putative sialic acid transporter;AltName:
   43::217     1e-07  25%  457 aa  PCAK_ACIAD RecName: Full=4-hydroxybenzoate transporter;
   55::221     1e-07  24%  510 aa  NANT_YERPE RecName: Full=Putative sialic acid transporter;AltName:
   55::221     1e-07  24%  510 aa  NANT_YERPA RecName: Full=Putative sialic acid transporter;AltName:
  120::271     3e-07  25%  551 aa  S22AD_HUMAN RecName: Full=Solute carrier family 22 member
   13::250     4e-07  24%  394 aa  YGAY_ECOLI RecName: Full=Putative uncharacterized transporter ygaY;
   71::278     7e-07  24%  400 aa  YCEI_BACSU RecName: Full=Putative metabolite transport protein
   13::250     1e-06  23%  394 aa  YGAY_ECO57 RecName: Full=Uncharacterized transporter ygaY;
   59::192     1e-06  30%  410 aa  MDFA_ECOLI RecName: Full=Multidrug translocase mdfA;AltName:
   59::192     1e-06  30%  410 aa  MDFA_ECOL6 RecName: Full=Multidrug translocase mdfA;AltName:
   59::192     1e-06  30%  410 aa  MDFA_ECO57 RecName: Full=Multidrug translocase mdfA;AltName:
   45::188     2e-06  23%  466 aa  BENK_ACIAD RecName: Full=Benzoate transport protein;
   42::201     3e-06  22%  496 aa  NANT_SALTY RecName: Full=Putative sialic acid transporter;AltName:
   42::201     3e-06  22%  496 aa  NANT_SALTI RecName: Full=Putative sialic acid transporter;AltName:
   42::201     3e-06  22%  496 aa  NANT_SALSV RecName: Full=Putative sialic acid transporter;AltName:
   42::201     3e-06  22%  496 aa  NANT_SALPK RecName: Full=Putative sialic acid transporter;AltName:
   42::201     3e-06  22%  496 aa  NANT_SALPC RecName: Full=Putative sialic acid transporter;AltName:
   42::201     3e-06  22%  496 aa  NANT_SALPB RecName: Full=Putative sialic acid transporter;AltName:
   42::201     3e-06  22%  496 aa  NANT_SALPA RecName: Full=Putative sialic acid transporter;AltName:
   42::201     3e-06  22%  496 aa  NANT_SALNS RecName: Full=Putative sialic acid transporter;AltName:
   42::201     3e-06  22%  496 aa  NANT_SALHS RecName: Full=Putative sialic acid transporter;AltName:
   42::201     3e-06  22%  496 aa  NANT_SALG2 RecName: Full=Putative sialic acid transporter;AltName:
   42::201     3e-06  22%  496 aa  NANT_SALEP RecName: Full=Putative sialic acid transporter;AltName:
   42::201     3e-06  22%  496 aa  NANT_SALDC RecName: Full=Putative sialic acid transporter;AltName:
   42::201     3e-06  22%  496 aa  NANT_SALCH RecName: Full=Putative sialic acid transporter;AltName:
   42::201     3e-06  22%  496 aa  NANT_SALAR RecName: Full=Putative sialic acid transporter;AltName:
   71::201     4e-06  24%  496 aa  NANT_ESCF3 RecName: Full=Putative sialic acid transporter;AltName:
   71::201     4e-06  24%  496 aa  NANT_CITK8 RecName: Full=Putative sialic acid transporter;AltName:
  159::296     6e-06  28%  534 aa  YMPB_CAEEL RecName: Full=Putative transporter B0361.11;
   48::181     6e-06  20%  473 aa  PHDK_NOCSK RecName: Full=Probable 1-hydroxy-2-naphthoate
   71::201     6e-06  24%  496 aa  NANT_SHIFL RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_SHIF8 RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_SHIB3 RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECOSM RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECOSE RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECOLI RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECOLC RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECOL5 RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECOHS RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECODH RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECOBW RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECO8A RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECO7I RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECO5E RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECO57 RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECO55 RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECO45 RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECO27 RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT_ECO24 RecName: Full=Putative sialic acid transporter;AltName:
   71::201     6e-06  24%  496 aa  NANT1_ECOL6 RecName: Full=Putative sialic acid transporter
    6::222     1e-05  20%  394 aa  ARAJ_ECOLI RecName: Full=Protein araJ;
    8::176     2e-05  29%  413 aa  MDTM_SALTY RecName: Full=Multidrug resistance protein mdtM;
    8::176     2e-05  29%  413 aa  MDTM_SALTI RecName: Full=Multidrug resistance protein mdtM;
  146::274     2e-05  26%  551 aa  S22AD_MOUSE RecName: Full=Solute carrier family 22 member
   97::179     4e-05  29%  487 aa  S22FL_XENLA RecName: Full=Solute carrier family 22 member 15-like;
   83::236     8e-05  29%  542 aa  YIM1_YEAST RecName: Full=Uncharacterized transporter YIL121W;
  132::275     8e-05  20%  572 aa  YB30_YEAST RecName: Full=Uncharacterized transporter YBR180W;
   97::179     1e-04  28%  487 aa  S22FL_XENTR RecName: Full=Solute carrier family 22 member 15-like;
   31::128     1e-04  41%  396 aa  BCR_ECOLI RecName: Full=Bicyclomycin resistance protein;AltName:
  114::249     1e-04  29%  531 aa  S22AF_XENLA RecName: Full=Solute carrier family 22 member 15;
  106::238     2e-04  28%  484 aa  YT13_CAEEL RecName: Full=Putative transporter B0252.3;
    9::183     2e-04  19%  422 aa  EXUT_BACSU RecName: Full=Hexuronate transporter;
   30::220     2e-04  24%  409 aa  BCRH_RICTY RecName: Full=Uncharacterized transporter RT0591;
   68::181     2e-04  19%  399 aa  PMRA_STRR6 RecName: Full=Multi-drug resistance efflux pump pmrA;
   68::181     2e-04  19%  399 aa  PMRA_STRPN RecName: Full=Multi-drug resistance efflux pump pmrA;
   21::197     2e-04  22%  396 aa  NEPI_ECO27 RecName: Full=Purine ribonucleoside efflux pump nepI;
  143::267     3e-04  26%  548 aa  ORCT_DROME RecName: Full=Organic cation transporter protein;
   63::292     3e-04  22%  413 aa  MUCK_ACIAD RecName: Full=Cis,cis-muconate transport protein;
   51::370     4e-04  22%  390 aa  YCEJ_BACSU RecName: Full=Uncharacterized MFS-type transporter yceJ;
   67::168     4e-04  21%  477 aa  BAIG_EUBSP RecName: Full=Bile acid transporter;
  139::243     7e-04  24%  537 aa  YCUD_SCHPO RecName: Full=Uncharacterized transporter C965.13;
  235::361     7e-04  25%  689 aa  S22AN_RAT RecName: Full=Solute carrier family 22 member 23;AltName:
  235::361     7e-04  25%  689 aa  S22AN_MOUSE RecName: Full=Solute carrier family 22 member 23;
   25::203     7e-04  26%  463 aa  ERDL7_ARATH RecName: Full=Sugar transporter ERD6-like 7;
    1::417

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSRTTILDDATASDIDEQRHSQPVQFIKRGTAPFMRVTLALFSAGLATFALLYCVQPILPVLSQEFGVXX
YNFM_ECOLI      MSRTTTVDGAPASDTDKQSISQPNQFIKRGTPQFMRVTLALFSAGLATFALLYCVQPILPVLSQEFGLTP
Y532_BUCBP      -------------------YSSNKNYIQRGTKAFTEVTIAFFLAGFSTFSTLYCVQPILFLFSKEFXXXX
Y588_BUCAI      -------------------------YIKKNTKKFNQVILALFSGGFATFSILYCVQSILPMFSKQFYLTP
Y567_BUCAP      --------------------------------------------------ILYCVQSILPVFSKQFCXXX
YYBF_BACSU      -------------------------YIRKGTPVFRKIXXXXXXXXXXXXXILYCVQPLMEEFTREFHVTP
YDER_BACSU      ------------------------------------LTLLLATACGIIVANLYYAQPLVGLISKAIGLSP
YJHB_ECOLI      ---------------------------------------ALFSAWLGDFMMIFY---ILHIIKADLGITD
MDTM_ECO57      ----------------------------------------------------------------------
MDTM_ECOLI      ----------------------------------------------------------------------
NANT_YERPY      ---------------------------------------------------------VLTDIKQEFGLTL
NANT_YERPS      ---------------------------------------------------------VLTDIKQEFGLTL
NANT_YERPP      ---------------------------------------------------------VLTDIKQEFGLTL
NANT_YERPG      ---------------------------------------------------------VLTDIKQEFGLTL
NANT_YERPB      ---------------------------------------------------------VLTDIKQEFGLTL
NANT_YERP3      ---------------------------------------------------------VLTDIKQEFGLTL
PCAK_ACIAD      --------------------------------------LIVFVDGIDTAAMGF----IAPALAQDWGVDR
NANT_YERPE      ---------------------------------------------------------VLTDIKQEFGLTL
NANT_YERPA      ---------------------------------------------------------VLTDIKQEFGLTL
S22AD_HUMAN     ----------------------------------------------------------LPSLKNEFNLVC
YGAY_ECOLI      ------------------------------------IVLMSIATGLAV-ASNYYAQPLLDTIARNFSLSA
YCEI_BACSU      ----------------------------------------------------------------------
YGAY_ECO57      ------------------------------------IVLMSIATGLAV-ASNYYAQPLLDTIARNFSLSA
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
BENK_ACIAD      ----------------------------------------------------------LPLLMKEWAIDP
NANT_SALTY      ---------------------------------------------------------VLTEVQSEFGLTT
NANT_SALTI      ---------------------------------------------------------VLTEVQSEFGLTT
NANT_SALSV      ---------------------------------------------------------VLTEVQSEFGLTT
NANT_SALPK      ---------------------------------------------------------VLTEVQSEFGLTT
NANT_SALPC      ---------------------------------------------------------VLTEVQSEFGLTT
NANT_SALPB      ---------------------------------------------------------VLTEVQSEFGLTT
NANT_SALPA      ---------------------------------------------------------VLTEVQSEFGLTT
NANT_SALNS      ---------------------------------------------------------VLTEVQSEFGLTT
NANT_SALHS      ---------------------------------------------------------VLTEVQSEFGLTT
NANT_SALG2      ---------------------------------------------------------VLTEVQSEFGLTT
NANT_SALEP      ---------------------------------------------------------VLTEVQSEFGLTT
NANT_SALDC      ---------------------------------------------------------VLTEVQSEFGLTT
NANT_SALCH      ---------------------------------------------------------VLTEVQSEFGLTT
NANT_SALAR      ---------------------------------------------------------VLTEVQSEFGLTT
NANT_ESCF3      ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
YMPB_CAEEL      ----------------------------------------------------------------------
PHDK_NOCSK      ---------------------------------------------------------LFPPVIRDWGVPV
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
ARAJ_ECOLI      ----------------------------------LSLALGTFGLGMAEFGIM----GVLTELAHNVGISI
MDTM_SALTY      -------------------------FSQRATTLFFPMALILYD--FAAYLTTDLIQPGIINVVRDFNADV
MDTM_SALTI      -------------------------FSQRATTLFFPMALILYD--FAAYLTTDLIQPGIINVVRDFNADV
S22AD_MOUSE     ----------------------------------------------------------------------
S22FL_XENLA     ----------------------------------------------------------------------
YIM1_YEAST      --------------------------------------------------------PVLSVIERKFDIDE
YB30_YEAST      --------------------------------------------------------PALPLLQREYDVSA
S22FL_XENTR     ----------------------------------------------------------------------
BCR_ECOLI       --------------------------------------------------------PALPVISAQFGVPA
S22AF_XENLA     ----------------------------------------------------------------------
YT13_CAEEL      ----------------------------------------------------------------------
EXUT_BACSU      ------------------------------------VILFLFLAGVINYLDRSALSIAAPFIQDDLTLSA
BCRH_RICTY      ----------------------------------------------------------LPSLTKYFSIDG
PMRA_STRR6      ----------------------------------------------------------------------
PMRA_STRPN      ----------------------------------------------------------------------
NEPI_ECO27      ----------------------------------------------AVFSVAFCVACLLPVMAQDLGISE
ORCT_DROME      ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
YCEJ_BACSU      ----------------------------------------------------------------------
BAIG_EUBSP      ----------------------------------------------------------------------
YCUD_SCHPO      ----------------------------------------------------------------------
S22AN_RAT       ----------------------------------------------------------------------
S22AN_MOUSE     ----------------------------------------------------------------------
ERDL7_ARATH     --------------------------------PWM-VYLSTFVAVCGSFAFGSCASPAQAAIRNDLSLTI


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXTAMLAIGLLFTGPLSDAIGRKPVMVXXXXXXXXXXXXXXMMTSWHGILIMRALIGLSLSG
YNFM_ECOLI      ANSSISLSISTAMLAIGLLFTGPLSDAIGRKPVMVTALLLASICTLLSTMMTSWHGILIMRALIGLSLSG
Y532_BUCBP      XXXXXXXXXXXXMMAFGMLFTGPLSDSIGRKVVMSSSLFLASFCTFCCSNMNSWESIIFMRALTGLALSG
Y588_BUCAI      AESSLALSAATITMSLGMLFTGPLSDIIGRKSIMSTSLFIAAMLTMICSMMTSWISIVLLRALTGLALSG
Y567_BUCAP      XXXXXXXXXXXXXMSIGTLFIGPLSDRIGRKSIMSSSLLIAAVLTIICSISNNWTVIVFLRALTGLALSG
YYBF_BACSU      TAASLSLSVTTMLLAVSMLVFGSLSEVWGRKPIMGISMLAASVLCLASAFSPSFHTLLVLRTIQGVALAG
YDER_BACSU      SGAGLIVTLTQIGYVAGLLFLVPLGDIIENKKLIVVXXXXXXXXXXXXXFVK--HGTLFLAAAFFVGLGS
YJHB_ECOLI      IQATLIGTVAFIARPIGGGFFGAMADKYGRKPMMMWAIFIYSVGTGLSGIATNLYMLAVCRFIVGLGMSG
MDTM_ECO57      ---------------------GPLSDRIGRKPVLITGALIFTLACAATMFTTSMTQFLIARAIQGTSICF
MDTM_ECOLI      ---------------------GPLSDRIGRRPVLITGALIFTLACAATMFTTSMTQFLIARAIQGTSICF
NANT_YERPY      IQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMIISIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAG
NANT_YERPS      IQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAG
NANT_YERPP      IQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAG
NANT_YERPG      IQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAG
NANT_YERPB      IQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAG
NANT_YERP3      IQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAG
PCAK_ACIAD      SQLGPVMSAALGGMIIGALVSGPTADRFGRKIVLSMSMLVFGGFTLACAYSTNLDSLVIFRFLTGIGLGA
NANT_YERPE      IQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAG
NANT_YERPA      IQATSLISAAFISRWFGGLVLGAMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAG
S22AD_HUMAN     DRKHLKDTTQSVFMAVGTLMFGPLCDRIGRKATILAQLLLFTLIGLATAFVPSFELYMALRFAVATAVAG
YGAY_ECOLI      SSAGFIVTAAQLGYAAGLLFLVPLGDMFERRRLIVSMTLLAAGGMLITASSQSLAMMILGTALTGL-FSV
YCEI_BACSU      -------------------------DRIGRKKVFIITLLCFSIGSGISAFVTSLSAFLILRFVIGMGLGG
YGAY_ECO57      SSAGFIVTAAQLGYAAGLLFLVPLGDMFERRRLIVSMTLLAAGGMLITASSQSLAMMILGTALTGL-FSV
MDFA_ECOLI      ----------TAYLAGGMFLQGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLCF
MDFA_ECOL6      ----------TAYLAGGMFLQGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLCF
MDFA_ECO57      ----------TAYLAGGMFLQGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLCF
BENK_ACIAD      VTAGFIGSIALFGMMFGALIFGTIADGVSRKKVIAVCIILFSLCTVLCGFSETTTQFSIFRFLAGVGIGG
NANT_SALTY      VQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAG
NANT_SALTI      VQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAG
NANT_SALSV      VQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAG
NANT_SALPK      VQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAG
NANT_SALPC      VQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAG
NANT_SALPB      VQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAG
NANT_SALPA      VQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAG
NANT_SALNS      VQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAG
NANT_SALHS      VQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAG
NANT_SALG2      VQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAG
NANT_SALEP      VQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAG
NANT_SALDC      VQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAG
NANT_SALCH      VQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAG
NANT_SALAR      VQAASLISAAFISRWFGGLLLGAMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAG
NANT_ESCF3      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSVGTLACGFAPGYITMFIARLVIGMGMAG
NANT_CITK8      ----------------GGLMLGAMGDRYGRRLAMVTSIILFSMGTLACGFAPGYTTMFIARLVIGMGMAG
YMPB_CAEEL      ---------------IAVPFMSMLADRYGRKPIIVTTAILAFLANMAASFSPNFAIFLILRAFIGACSDS
PHDK_NOCSK      SAVTLVVSLGVVAMAIGALVSGPVADRWGRKGVTVVGFVLFCLATAGLGLTGDIHSFAALRIISCFGLGA
NANT_SHIFL      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_SHIF8      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_SHIB3      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECOSM      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECOSE      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECOLI      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECOLC      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECOL5      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECOHS      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECODH      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECOBW      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECO8A      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECO7I      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECO5E      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECO57      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECO55      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECO45      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECO27      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT_ECO24      ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
NANT1_ECOL6     ----------------GGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAG
ARAJ_ECOLI      PAAGHMISYYALGVVVGAPIIALFSSRYSLKHILLFLVALCVIGNAMFTLSSSYLMLAIGRLVSGFPHGA
MDTM_SALTY      SLAPASVSLYLAGGMALQWLLGPLSDRIGRRPVLIAGXXXXXXXXXXXXXXXSMTQFLVARFVQGTSICF
MDTM_SALTI      SLAPASVSLYLAGGMALQWLLGPLSDRIGRRPVLIAGXXXXXXXXXXXXXXXSMTQFLVARFVQGTSICF
S22AD_MOUSE     -----------AGLLVGALVFGPVCDWIGRRPSLLMQVLLSGITSMATAFVSSFELYLALRFVLATANAG
S22FL_XENLA     -----------AGLLIGNVFFGPLSDKLGRRPVYLSGLFFDIIFGYFTALAPSYEVFAVSRFFVGVMNGG
YIM1_YEAST      ELXXXXXXXXXXFQGLAPTFMGGFADSLGRRPVVLVAIVIYFGACIGLACAQTYAQIIVLRCLQAAGISP
YB30_YEAST      TTINATVSVFMAVFSVGPLFWGALADFGGRKFLMVSLSLMLIVNILLAAVPVNIAALFVLRIFQAFASSS
S22FL_XENTR     -----------AGLLIGNILFGPLSDKLGRRPVYLSGLFFDITFGYCTALAPSYEVFAVSRFFVGIMNGG
BCR_ECOLI       GSTQMTLSTYILGFALGQLIYGPMADSFGRKPXXXXXXXXXXXXXXXXXXXNTIDQLIVMRFFHGLXXXX
S22AF_XENLA     ---------------IGVICFGQLSDRFGRKPVYVTGLALEVTFAVMNALTPIFSMFLITRFLVGVMNGG
YT13_CAEEL      ---------------IGGMFIPPLADHYGRLPVFVATVLLMAVGGMISAFSTSIMMFCIMRMIHGIFYTA
EXUT_BACSU      TQMGLIFSSFSIGYAIFNFLGGVASDRYGAKLTLFVAMVVWSLFSGAVALAFGFVSLLIIRILFGMGEGP
BCRH_RICTY      CITQITSTLYFLGFAVGILSLGRLSDIYGRRPIVLLGLXXXXXXXXXXXXXXXXEMLMIARFIQAFGVSV
PMRA_STRR6      ---------------------GILADKYGRKPMMIRAGLAMTITMGGLAFVPNIYWLIFLRLLNGV-FAG
PMRA_STRPN      ---------------------GILADKYGRKPMMIRAGLAMTITMGGLAFVPNIYWLIFLRLLNGV-FAG
NEPI_ECO27      GVAGQSVTVTAFVAMFASLFITQTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGG
ORCT_DROME      ---------------LGSLIFGQMSDKLGRKPTFFASLVLQLIFGVLAAVAPEYFSYTISRMIVGATTSG
MUCK_ACIAD      -----------AGMAIGGIFGGWACDRFGRVRIVVISILTFSILTCGLGLTQSFIQFGVLRFFASLGLGS
YCEJ_BACSU      --------------ALFAFIAGPISDRLNRKTVMLWGLAGFIVSTFLCGIAPSFAAMCLFRFAAGVSAAF
BAIG_EUBSP      ---------------------GKLGDVLGRRTTLLLGIVIFAAGNVLTAVATSLIFMLAARFIVGIGTAA
YCUD_SCHPO      --------------AFGPMLLGPMSDIFGRKWVYVGSLILYIIFQIPQALAYNLPMMAINSAIAGAFGSS
S22AN_RAT       -------------LIFGYLITGCIADWVGRRPVLLFSVIFILIFGLTVALSVNVTMFSTLRFFEGFCLAG
S22AN_MOUSE     -------------LIFGYLITGCIADWVGRRPVLLFSTIFILIFGLTVALSVNVTMFSTLRFFEGFCLAG
ERDL7_ARATH     AEFSLFGSLLTFGAMIGAITSGPIADLVGRKGAM---------RVSSAFCVVGWLAIIFAKGVVALDLGR


                         +         .         .         .         .         *         .:210
query           VAAVGMTYLSEEIHPSFVAFSMGLYISGNSIGGMSGRLLSGVMTDFFNWRIALAAIGCFALASALMFWKI
YNFM_ECOLI      VAAVGMTYLSEEIHPSFVAFSMGLYISGNSIGGMSGRLISGVFTDFFNWRIALAAIGCFALASALMFWKI
Y532_BUCBP      VAAVAMTYLSEEMHPSVLSFSIGLYISGNTIGGFLGRFLSSLFSEYFSWNIALEFISFLAFTSAVLFVYL
Y588_BUCAI      VVAVAMTYISEEIHPNSLSFCMGLYISGNTIGGFLGRLLSSILAEKFSWSISLMVIGLFSFISSCFFLYF
Y567_BUCAP      VVAVAMTYIVEEVHPNSVSFCMGLYISGNTIGGCSGRILSSILAEYFSWHIAFIVIGFFSLMSSCLFLYF
YYBF_BACSU      LPSIAMAYLGEEIEPGSLGSAMGLYISGNAIGAVFGRIVSGLLSEYLNWHMAMGTIGVISLIASVIFFIN
YDER_BACSU      IAAQVLSYLASDAARGRV---VGNVMSGLLLGIMLSRPISSLVADIWGWNAIFALSAVVSVILAIVLSKV
YJHB_ECOLI      EYACASTYAVESWPKNLQSKASAFLVSGFSVGNIIAAQIIPQFAEVYGWRNSF-FIGLLPVLLVLWIRKS
MDTM_ECO57      IATVGYVTVQEAFGQTKGIKLMAIITSIVLIAPIIGPLSGAALMHFVHWKVLFAIIAVMGFISFVGLLLA
MDTM_ECOLI      IATVGYVTVQEAFGQTKGIKLMAIITSIVLIAPIIGPLSGAALMHFMHWKVLFAIIAVMGFISFVGLLLA
NANT_YERPY      EYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVLAAQAYSYVVPAFGWRM-LFYIGLLPIIFALWLRKN
NANT_YERPS      EYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVLAAQAYSYVVPAFGWRM-LFYIGLLPIIFALWLRKN
NANT_YERPP      EYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVLAAQAYSYVVPAFGWRM-LFYIGLLPIIFALWLRKN
NANT_YERPG      EYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVLAAQAYSYVVPAFGWRM-LFYIGLLPIIFALWLRKN
NANT_YERPB      EYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVLAAQAYSYVVPAFGWRM-LFYIGLLPIIFALWLRKN
NANT_YERP3      EYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVLAAQAYSYVVPAFGWRM-LFYIGLLPIIFALWLRKN
PCAK_ACIAD      AMPNATTLFSEYCPARIRSLLVTCMFCGYNLGMAIGGFISSWLIPAFGWHSLFLLGGWAPLILMLLVIFF
NANT_YERPE      EYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVLAAQAYSYVVLAFGWRM-LFYIGLLPIIFALWLRKN
NANT_YERPA      EYGSSSTYVMESWPKNMRNKASGFLISGFSIGAVLAAQAYSYVVLAFGWRM-LFYIGLLPIIFALWLRKN
S22AD_HUMAN     LSFSNVTLLTEWVGPSWRTQAVVLAQCNFSLGQM---VLAGLAYGFRNWRLLQITGTAPGLLLFFYFWAL
YGAY_ECOLI      VAQILVPLAATLASPDKRGKVVGTIMSGLLLGILLARTVAGLLANLGGWRTVFWXXXXXXXXXXXXXWRG
YCEI_BACSU      ELPVASTLVSEAVVPEKRGRVIVLLESFWAVGWLAAALISYFVIPSFGWQXXXXXXXXXXXXXXXXRTS-
YGAY_ECO57      VAQILVPLAATLASPDKRGKVVGTIMSGLLLGILLARTVAGLLANLGGWRTVFWXXXXXXXXXXXXXWRG
MDFA_ECOLI      IGAVGYAAIQESFEEAVCIKITALMANVALIAPLLGPLVGAAWIHVLPWEAALAAISFFGLQRAM-----
MDFA_ECOL6      IGAVGYAAIQESFEEAVCIKITALMANVALIAPLLGPLVGAAWIHVLPWEAALAAISFFGLQRAM-----
MDFA_ECO57      IGAVGYAAIQESFEEAVCIKITALMANVALIAPLLGPLVGAAWIHVLPWEAALAAISFFGLQRAM-----
BENK_ACIAD      VMPNVIALVSEYAPKKFKSFFVTLMFSGYAIGGMTAAFLGSILVPLYGWKIMFMIAG-------------
NANT_SALTY      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_SALTI      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_SALSV      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_SALPK      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_SALPC      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_SALPB      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_SALPA      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_SALNS      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_SALHS      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_SALG2      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_SALEP      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_SALDC      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_SALCH      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_SALAR      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ESCF3      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPLWGWR-ALFFIGILPIIFALWLRKN
NANT_CITK8      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
YMPB_CAEEL      YLSVASVATCEYLSEKARAWITVVYNVAWSL-GMVWTLLVTLMTDDWRWRYFIVSLGVYGFA----LWYF
PHDK_NOCSK      VMPVALTIVADWMPKARRAQMVSIAFAGVGVGSIIGAYLAAAVIPTLGWQV-------------------
NANT_SHIFL      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_SHIF8      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_SHIB3      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECOSM      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECOSE      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECOLI      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECOLC      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECOL5      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECOHS      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECODH      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECOBW      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECO8A      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECO7I      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECO5E      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECO57      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECO55      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECO45      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECO27      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT_ECO24      EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
NANT1_ECOL6     EYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWR-ALFFIGILPIIFALWLRKN
ARAJ_ECOLI      FFGVGAIVLSKIIKPGKVTAAVAGMVSGMTVANLLGIPLGTYLSQEFSWRYTFLLIAVFAVMASVYFW--
MDTM_SALTY      IATVGYVTVQEAFGQTKAIKLMAIITSIVLVAPVIGPLSGAALMHFVHWKVLFGII--------------
MDTM_SALTI      IATVGYVTVQEAFGQTKAIKLMAIITSIVLVAPVIGPLSGAALMHFVHWKVLFGII--------------
S22AD_MOUSE     FLLSTNVLISEWVGPSWRTQAVVLAQSNVALGQM---VLAGLAYGVRNWRL-LQITGTAPVLLLFFYFWV
S22FL_XENLA     MALVSFVLTQEYVGKSYWALTGSL----------------------------------------------
YIM1_YEAST      VIAINSGIMGDVTRGGYVGYVAGFQVLGSAFGALIGAGLSGWRAIF--WFLAIGSGICF-LASFLI----
YB30_YEAST      VISLGAGTVTDVVPPKHRGKAIAYFMMGPNMGPIIAPIVAGLILNYWRWLFGFTSI--------------
S22FL_XENTR     MALVSFVLTQEYVGKSYWALTGSL----------------------------------------------
BCR_ECOLI       XSVV-INALMRDIYP-------------------------------------------------------
S22AF_XENLA     MSLVAFVLLNECIGSSYWAIAGSLGSMCFAVGIAQFALIGYFIR---SWRL-LAVLVNVQGAGVLALSLC
YT13_CAEEL      AGLAGWV-LGYENTPLRLRFFTSVYFGVMVVGACFLGLLAYILPD---WRYLMFCISVPNIFVALLIYMT
EXUT_BACSU      LSATINKMVNNWFPPTQRASVIGVTNSGTPLGGAISGPIVGMIAVAFSWKVSFVLIMIIGLIWAVLWFKF
BCRH_RICTY      GSVIGQSMARDSYQGAELSYVYAILSPWLLFIPSLGSYIGGYIIEYSSWHYVFVFFSLIGTILLALYYKI
PMRA_STRR6      FVPNATALIASQVPKEKSGSALGTLSTGVVAGTLTGPFIGGFIAELFGIRTVFLLVGSFLFLAAIL----
PMRA_STRPN      FVPNATALIASQVPKEKSGSALGTLSTGVVAGTLTGPFIGGFIAELFGIRTVFLLVGSFLFLAAIL----
NEPI_ECO27      FWAISASLTMRLVPPRTVPKALSVIFGAVSIALVIAAPLGGFLGELIGWRNVFNAAAAMGVLCIFWIIKS
ORCT_DROME      VFLVAYVIALEMVGSSYRLFAGVAMQMFFSVGFM---LTAGFAYFIHDWRWLQIAITLPGLLFLCYYW-I
MUCK_ACIAD      LYIACNTLMAEYVPTKYRTTVLGTLQAGWTVGYIVATLLAGWLIPDHGWRV-LFYVAIIPVLMAVLMHFF
YCEJ_BACSU      VTPQIWASIPVIVQPSQIIKGMGIATAGLAASQMLGLPIGGFLAS-FTWHTPFFVXXXXXXXXXXXXXXV
BAIG_EUBSP      ISPIVMAYIVTEYPQEETGKAFGLYMLISSGAVVVGPTCGGLIMNAAGWRVMM-----------------
YCUD_SCHPO      ALANVASSMCDIFTPETVGFGISLFVWGANAGASIGSPIGEALYDHWRW---------------------
S22AN_RAT       I-ILTLYALRIELCPPGKRFIITMVASFVAMAGQF--LMPGLAALCRDWQVLQALIICPFLL-MLLYWSI
S22AN_MOUSE     I-ILTLYALRIELCPPGKRFIITMVASFVAMAGQF--LMPGLAALCRDWQVLQALIICPFLL-MLLYWSI
ERDL7_ARATH     LAGYGMGAFSYVV-PIFIATFRGALTTLNQILICTGVSVSFIIGTLVTWRV-LALIGIIPCAASFLGLFF


                         .         .         .         +         .         .         .:280
query           LPASQHFRPTSLRPKTLFINFRLHWRDRGLPLLFAEGFLLMGAFVTLFNYIGYRLMLSPWELSQAVVGLL
YNFM_ECOLI      LPESRHFRPTSLRPKTLFINFRLHWRDRGLPLLFAEGFLLMGSFVTLFNYIGYRLMLSPWHVSQAVVGLL
Y532_BUCBP      LPKSKNFCSSPLDLRKILLYFIFQWRDPVLSKLFFMGCILMGSFITLFNYVGYRLISQPFFLGQTTIGLL
Y588_BUCAI      LPPSKNFLSVSINFHKCLHRFYLQLKNRVXXXXXXXXXXXMGSFVTIFNYIGYRLMLEPFFLCQSSIGLL
Y567_BUCAP      LPSSKNFYPISIDFNKFLKNFYLHLKNPTLLILFAIGFMLMGSFITIFNYISYRLMLSPFFLSSSNIGFL
YYBF_BACSU      LPPSRHFTPRKLKLGKLGMSLIGHLRDRKXXXXXXXXXXXXXXNVALFNYIVYVLLGPPYSLNKAFSSWI
YDER_BACSU      LPAR---KPTANTNYTALLGSM--WKLRTTPVLRRRAIFVFGAFSLFWTTVPLLLSGPDFHFSQKAIALY
YJHB_ECOLI      APESQEWIEDKYKDKSTFLS--------------------------------------------------
MDTM_ECO57      MPETVKRGAVPFSAKSVLRDFR---------NVFCNRLFLFGAATISLSYI-------------------
MDTM_ECOLI      MPETVKRGAVPFSAKSVLRDFR---------NVFCNRLFLFGAATISLSYI-------------------
NANT_YERPY      LPEAEDWEKAQSKQK-------------------------------------------------------
NANT_YERPS      LPEAEDWEKAQSKQK-------------------------------------------------------
NANT_YERPP      LPEAEDWEKAQSKQK-------------------------------------------------------
NANT_YERPG      LPEAEDWEKAQSKQK-------------------------------------------------------
NANT_YERPB      LPEAEDWEKAQSKQK-------------------------------------------------------
NANT_YERP3      LPEAEDWEKAQSKQK-------------------------------------------------------
PCAK_ACIAD      LPESYRF---------------------------------------------------------------
NANT_YERPE      LPEAEDWEKAQSKQK-------------------------------------------------------
NANT_YERPA      LPEAEDWEKAQSKQK-------------------------------------------------------
S22AD_HUMAN     ----------------------------------------------------------------------
YGAY_ECOLI      LP--QMKSETHLNPQLLGSVFSMFISDKILRTRALLGCLTFANFSILWTSMAFLLAAPPFNYSDGVI---
YCEI_BACSU      LPDSPKYESLSAKKRSMWENVKSVWARRPTVMLSIVWFCVVFSYYGMFLWLPSVMLLKGFSMIQSYVLLM
YGAY_ECO57      LP--QMKSETHLNPQLLGSVFSMFISNKILRTRALLGCLTFANFSILWTSMAFLLAAPPFNYSDGVI---
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
BENK_ACIAD      ----------------------------------------------------------------------
NANT_SALTY      IPEAEDWK--------------------------------------------------------------
NANT_SALTI      IPEAEDWK--------------------------------------------------------------
NANT_SALSV      IPEAEDWK--------------------------------------------------------------
NANT_SALPK      IPEAEDWK--------------------------------------------------------------
NANT_SALPC      IPEAEDWK--------------------------------------------------------------
NANT_SALPB      IPEAEDWK--------------------------------------------------------------
NANT_SALPA      IPEAEDWK--------------------------------------------------------------
NANT_SALNS      IPEAEDWK--------------------------------------------------------------
NANT_SALHS      IPEAEDWK--------------------------------------------------------------
NANT_SALG2      IPEAEDWK--------------------------------------------------------------
NANT_SALEP      IPEAEDWK--------------------------------------------------------------
NANT_SALDC      IPEAEDWK--------------------------------------------------------------
NANT_SALCH      IPEAEDWK--------------------------------------------------------------
NANT_SALAR      IPEAEDWK--------------------------------------------------------------
NANT_ESCF3      IPEAEDWK--------------------------------------------------------------
NANT_CITK8      IPEAEDWK--------------------------------------------------------------
YMPB_CAEEL      LPESPHWLITKNKTEKL-----------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
NANT_SHIFL      IPEAEDWK--------------------------------------------------------------
NANT_SHIF8      IPEAEDWK--------------------------------------------------------------
NANT_SHIB3      IPEAEDWK--------------------------------------------------------------
NANT_ECOSM      IPEAEDWK--------------------------------------------------------------
NANT_ECOSE      IPEAEDWK--------------------------------------------------------------
NANT_ECOLI      IPEAEDWK--------------------------------------------------------------
NANT_ECOLC      IPEAEDWK--------------------------------------------------------------
NANT_ECOL5      IPEAEDWK--------------------------------------------------------------
NANT_ECOHS      IPEAEDWK--------------------------------------------------------------
NANT_ECODH      IPEAEDWK--------------------------------------------------------------
NANT_ECOBW      IPEAEDWK--------------------------------------------------------------
NANT_ECO8A      IPEAEDWK--------------------------------------------------------------
NANT_ECO7I      IPEAEDWK--------------------------------------------------------------
NANT_ECO5E      IPEAEDWK--------------------------------------------------------------
NANT_ECO57      IPEAEDWK--------------------------------------------------------------
NANT_ECO55      IPEAEDWK--------------------------------------------------------------
NANT_ECO45      IPEAEDWK--------------------------------------------------------------
NANT_ECO27      IPEAEDWK--------------------------------------------------------------
NANT_ECO24      IPEAEDWK--------------------------------------------------------------
NANT1_ECOL6     IPEAEDWK--------------------------------------------------------------
ARAJ_ECOLI      VPDIRDEAKGNLREQFHFLRSPAPW------LIFAATMFGNAGVFAWFSYV-------------------
MDTM_SALTY      ----------------------------------------------------------------------
MDTM_SALTI      ----------------------------------------------------------------------
S22AD_MOUSE     LPES------------------------------------------------------------------
S22FL_XENLA     ----------------------------------------------------------------------
YIM1_YEAST      ----------------------------------------------------------------------
YB30_YEAST      ----------------------------------------------------------------------
S22FL_XENTR     ----------------------------------------------------------------------
BCR_ECOLI       ----------------------------------------------------------------------
S22AF_XENLA     IPES---------PRWLYAQGRLH----------------------------------------------
YT13_CAEEL      VPESLHFLVSS-----------------------------------------------------------
EXUT_BACSU      V---------------------------------------------------------------------
BCRH_RICTY      LPETNYYIDFSQSSK-YFEVFNIIIKDK---ILWLYAFII-GAF--------------------------
PMRA_STRR6      ----------------------------------------------------------------------
PMRA_STRPN      ----------------------------------------------------------------------
NEPI_ECO27      LPS-------------------------------------------------------------------
ORCT_DROME      IPES------------------------------------------------------------------
MUCK_ACIAD      VPEPAAWQQSRLAPQTETVKFKLIFQDKRNRNMFILWALTAG--FLQFGYYGVNNWMPSYLESELGMKFK
YCEJ_BACSU      MPGIRPSEPLA-RPSIVNPYRELFSLPKTSVILLAYFLFQTGNFAS-FSFLGYHLTVSQIGAAMLVLGLG
BAIG_EUBSP      ----------------------------------------------------------------------
YCUD_SCHPO      ----------------------------------------------------------------------
S22AN_RAT       FPES------------------------------------------------------------------
S22AN_MOUSE     FPES------------------------------------------------------------------
ERDL7_ARATH     IPES------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SVAYLTGTWSSPKAGAMTSRYGRGPVMLFSTAVMXXXXXXXXXXXXXXIFAGMLLFSAGFFAAHSVASSW
YNFM_ECOLI      SLAYLTGTWSSPKAGTMTTRYGRGPVMLFSTGVMLFGLLMTLFSSLWLIFAGMLLFSAGFFAAHSVASSW
Y532_BUCBP      SIIYLIGVYSSPQAGVLIERYRKGVILTLALTMMIFGVLITQCNIVLLIIVGLTLXXXXXXXXHSVTSTW
Y588_BUCAI      STIYLTGVYSSPKAGVLINKYNRNNILIVSLMLMIIGLFITQYNQXXXXXXXXXXXXXXXXASHSTASSW
Y567_BUCAP      SIIYLTGVYSSPKAGILINQYNRSSXXXXXXXXXXXXXXMTQYNEIFIIILGLVIFSSGFFASHSIASSW
YYBF_BACSU      FIVMIVGIFSSSFIGRMVDRYGYPKILVMNIFIVIAGALFTINNMLAVKILGIALFTFGFFGGHSVASSW
YDER_BACSU      ALVGIAGAVTAPIGGRLADR--------------------------------------------------
YJHB_ECOLI      ----------------------------------------------------------------------
MDTM_ECO57      ----------------------------------------------------------------------
MDTM_ECOLI      ----------------------------------------------------------------------
NANT_YERPY      ----------------------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
PCAK_ACIAD      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
S22AD_HUMAN     ----------------------------------------------------------------------
YGAY_ECOLI      ----------------------------------------------------------------------
YCEI_BACSU      TLAYFSAAWLIEKAG-------------------------------------------------------
YGAY_ECO57      ----------------------------------------------------------------------
MDFA_ECOLI      ----------------------------------------------------------------------
MDFA_ECOL6      ----------------------------------------------------------------------
MDFA_ECO57      ----------------------------------------------------------------------
BENK_ACIAD      ----------------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
NANT_ESCF3      ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
YMPB_CAEEL      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
ARAJ_ECOLI      ----------------------------------------------------------------------
MDTM_SALTY      ----------------------------------------------------------------------
MDTM_SALTI      ----------------------------------------------------------------------
S22AD_MOUSE     ----------------------------------------------------------------------
S22FL_XENLA     ----------------------------------------------------------------------
YIM1_YEAST      ----------------------------------------------------------------------
YB30_YEAST      ----------------------------------------------------------------------
S22FL_XENTR     ----------------------------------------------------------------------
BCR_ECOLI       ----------------------------------------------------------------------
S22AF_XENLA     ----------------------------------------------------------------------
YT13_CAEEL      ----------------------------------------------------------------------
EXUT_BACSU      ----------------------------------------------------------------------
BCRH_RICTY      ----------------------------------------------------------------------
PMRA_STRR6      ----------------------------------------------------------------------
PMRA_STRPN      ----------------------------------------------------------------------
NEPI_ECO27      ----------------------------------------------------------------------
ORCT_DROME      ----------------------------------------------------------------------
MUCK_ACIAD      EMAYMVGTYTAMLAGFMADKLGR-----------------------------------------------
YCEJ_BACSU      NLGSLIGSRVSEKLG------------MFKT-LISGMLLMGALYFALPFFPNLFLVEAGFFLTFFTAGQS
BAIG_EUBSP      ----------------------------------------------------------------------
YCUD_SCHPO      ----------------------------------------------------------------------
S22AN_RAT       ----------------------------------------------------------------------
S22AN_MOUSE     ----------------------------------------------------------------------
ERDL7_ARATH     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IGPRARRAKGQAXXXXXXXXXXXXXIAGTLGGVFWHSYGWNGVGGFIALMLVLAILVGTRLHHRLHA
YNFM_ECOLI      IGPRAKRAKGQAXXXXXXXXXXXXXIAGTLGGVFWHNYGWNGVGAFIALMLVIALLVGTRLHRRLHA
Y532_BUCBP      ISQCSKINKGSTSSIYLFSYYLGSSIFGTFSGIFWITEKWLGISIFIITFLCIGILLSIRL------
Y588_BUCAI      VGSYSNIAKIQATSLYLFFYYLGSSVXXXXXXXXXXHMQWLGISVFIITMLFFGVFLSFKLKQK---
Y567_BUCAP      IGFHAKIAKVQA-------------------------------------------------------
YYBF_BACSU      VGRRALHNKAQASSLYLFFYYAGSSVFGTIGGLFWSGFHWLGVVGMITFMLLVAL------------
YDER_BACSU      -------------------------------------------------------------------
YJHB_ECOLI      -------------------------------------------------------------------
MDTM_ECO57      -------------------------------------------------------------------
MDTM_ECOLI      -------------------------------------------------------------------
NANT_YERPY      -------------------------------------------------------------------
NANT_YERPS      -------------------------------------------------------------------
NANT_YERPP      -------------------------------------------------------------------
NANT_YERPG      -------------------------------------------------------------------
NANT_YERPB      -------------------------------------------------------------------
NANT_YERP3      -------------------------------------------------------------------
PCAK_ACIAD      -------------------------------------------------------------------
NANT_YERPE      -------------------------------------------------------------------
NANT_YERPA      -------------------------------------------------------------------
S22AD_HUMAN     -------------------------------------------------------------------
YGAY_ECOLI      -------------------------------------------------------------------
YCEI_BACSU      -------------------------------------------------------------------
YGAY_ECO57      -------------------------------------------------------------------
MDFA_ECOLI      -------------------------------------------------------------------
MDFA_ECOL6      -------------------------------------------------------------------
MDFA_ECO57      -------------------------------------------------------------------
BENK_ACIAD      -------------------------------------------------------------------
NANT_SALTY      -------------------------------------------------------------------
NANT_SALTI      -------------------------------------------------------------------
NANT_SALSV      -------------------------------------------------------------------
NANT_SALPK      -------------------------------------------------------------------
NANT_SALPC      -------------------------------------------------------------------
NANT_SALPB      -------------------------------------------------------------------
NANT_SALPA      -------------------------------------------------------------------
NANT_SALNS      -------------------------------------------------------------------
NANT_SALHS      -------------------------------------------------------------------
NANT_SALG2      -------------------------------------------------------------------
NANT_SALEP      -------------------------------------------------------------------
NANT_SALDC      -------------------------------------------------------------------
NANT_SALCH      -------------------------------------------------------------------
NANT_SALAR      -------------------------------------------------------------------
NANT_ESCF3      -------------------------------------------------------------------
NANT_CITK8      -------------------------------------------------------------------
YMPB_CAEEL      -------------------------------------------------------------------
PHDK_NOCSK      -------------------------------------------------------------------
NANT_SHIFL      -------------------------------------------------------------------
NANT_SHIF8      -------------------------------------------------------------------
NANT_SHIB3      -------------------------------------------------------------------
NANT_ECOSM      -------------------------------------------------------------------
NANT_ECOSE      -------------------------------------------------------------------
NANT_ECOLI      -------------------------------------------------------------------
NANT_ECOLC      -------------------------------------------------------------------
NANT_ECOL5      -------------------------------------------------------------------
NANT_ECOHS      -------------------------------------------------------------------
NANT_ECODH      -------------------------------------------------------------------
NANT_ECOBW      -------------------------------------------------------------------
NANT_ECO8A      -------------------------------------------------------------------
NANT_ECO7I      -------------------------------------------------------------------
NANT_ECO5E      -------------------------------------------------------------------
NANT_ECO57      -------------------------------------------------------------------
NANT_ECO55      -------------------------------------------------------------------
NANT_ECO45      -------------------------------------------------------------------
NANT_ECO27      -------------------------------------------------------------------
NANT_ECO24      -------------------------------------------------------------------
NANT1_ECOL6     -------------------------------------------------------------------
ARAJ_ECOLI      -------------------------------------------------------------------
MDTM_SALTY      -------------------------------------------------------------------
MDTM_SALTI      -------------------------------------------------------------------
S22AD_MOUSE     -------------------------------------------------------------------
S22FL_XENLA     -------------------------------------------------------------------
YIM1_YEAST      -------------------------------------------------------------------
YB30_YEAST      -------------------------------------------------------------------
S22FL_XENTR     -------------------------------------------------------------------
BCR_ECOLI       -------------------------------------------------------------------
S22AF_XENLA     -------------------------------------------------------------------
YT13_CAEEL      -------------------------------------------------------------------
EXUT_BACSU      -------------------------------------------------------------------
BCRH_RICTY      -------------------------------------------------------------------
PMRA_STRR6      -------------------------------------------------------------------
PMRA_STRPN      -------------------------------------------------------------------
NEPI_ECO27      -------------------------------------------------------------------
ORCT_DROME      -------------------------------------------------------------------
MUCK_ACIAD      -------------------------------------------------------------------
YCEJ_BACSU      IAPNAR---GTIASLSNAAMYAGTTVGTSIAGFLYQSQHFGAVTGFTAILFILSM------------
BAIG_EUBSP      -------------------------------------------------------------------
YCUD_SCHPO      -------------------------------------------------------------------
S22AN_RAT       -------------------------------------------------------------------
S22AN_MOUSE     -------------------------------------------------------------------
ERDL7_ARATH     -------------------------------------------------------------------