[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF69930.1

[Show Plain Result]


## Summary of Sequence Search
    1::152
    1::152     3e-91 100%  152 aa  T200_SALTY RecName: Full=Transposase for insertion sequence element
    1::152     3e-91 100%  152 aa  T200_SALTI RecName: Full=Transposase for insertion sequence element
    1::152

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKLCEWKNVRILEAECCADHIHMLLEIPP
T200_SALTY      MGDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKLCEWKNVRILEAECCADHIHMLLEIPP
T200_SALTI      MGDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKLCEWKNVRILEAECCADHIHMLLEIPP


                         .         .         *         .         .         .         .:140
query           KMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLS
T200_SALTY      KMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLS
T200_SALTI      KMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLS


                         +         .         .         .         .         *         .:210
query           IPYPGSPFTGRK
T200_SALTY      IPYPGSPFTGRK
T200_SALTI      IPYPGSPFTGRK