[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF70056.1

[Show Plain Result]


## Summary of Sequence Search
    1::128
   45::128     7e-34  99%  128 aa  YBGS_SALTY RecName: Full=Uncharacterized protein ybgS;Flags:
   45::128     7e-34  99%  128 aa  YBGS_SALTI RecName: Full=Uncharacterized protein ybgS;Flags:
   70::126     7e-27  84%  126 aa  YBGS_SHIFL RecName: Full=Uncharacterized protein ybgS;Flags:
   70::126     7e-27  84%  126 aa  YBGS_ECOLI RecName: Full=Uncharacterized protein ybgS;Flags:
    1::128

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVAPDARQXXXXXXXXXXXXXXXXXXX
YBGS_SALTY      --------------------------------------------VAPDARQXXXXXXXXXXXXXXXXXXX
YBGS_SALTI      --------------------------------------------VAPDARQXXXXXXXXXXXXXXXXXXX
YBGS_SHIFL      ----------------------------------------------------------------------
YBGS_ECOLI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           STMQHPDGSTMNHDGMTKDEEHKNTMCKDGRCPDINKKVETSNGVNNDVNTKTDGTTQ
YBGS_SALTY      STMQHPDGSTMNHDGMTKDEEHKNTMCKDGRCPDINKKVETGNGVNNDVNTKTDGTTQ
YBGS_SALTI      STMQHPDGSTMNHDGMTKDEEHKNTMCKDGRCPDINKKVETGNGVNNDVNTKTDGTTQ
YBGS_SHIFL      -TMLHSDGSSMNNDGMTKDEEHKNTMCKDGRCPDINKKVQTGDGINNDVDTKTDGTTQ
YBGS_ECOLI      -TMLHSDGSSMNNDGMTKDEEHKNTMCKDGRCPDINKKVQTGDGINNDVDTKTDGTTQ