[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF70211.1

[Show Plain Result]


## Summary of Sequence Search
    1::396
   70::440     5e-28  29%  440 aa  CYAD_BORPE RecName: Full=Protein cyaD;
   50::478     2e-26  28%  478 aa  HLYDP_ECOLX RecName: Full=Hemolysin secretion protein D, plasmid;
   50::478     8e-26  29%  478 aa  HLYDC_ECOLX RecName: Full=Hemolysin secretion protein D,
  329::478     4e-23  36%  478 aa  HLYD_PASHA RecName: Full=Leukotoxin secretion protein D;
  329::478     2e-22  36%  478 aa  HLYD_PASSP RecName: Full=Leukotoxin secretion protein D;
   50::477     4e-22  27%  477 aa  HLYD_ACTAC RecName: Full=Leukotoxin secretion protein D;
   50::461     1e-20  29%  477 aa  RTX1D_ACTPL RecName: Full=RTX-I toxin determinant D;AltName:
  218::477     4e-20  29%  477 aa  RTX3D_ACTPL RecName: Full=RTX-III toxin determinant D;AltName:
   36::431     5e-20  27%  432 aa  APRE_PSEAE RecName: Full=Alkaline protease secretion protein aprE;
   52::447     2e-19  27%  448 aa  PRTE_ERWCH RecName: Full=Proteases secretion protein prtE;
  112::279     1e-04  27%  371 aa  MACA_ECOLI RecName: Full=Macrolide-specific efflux protein
   98::279     2e-04  23%  371 aa  MACA_SHIFL RecName: Full=Macrolide-specific efflux protein
   98::279     2e-04  23%  371 aa  MACA_ECO57 RecName: Full=Macrolide-specific efflux protein
   27::120     7e-04  37%  646 aa  NDE1_USTMA RecName: Full=Nuclear distribution protein nudE homolog
    1::396

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxERAFSGAGRIVLICSLLFLILGIWAWFGRLDEVSTGNGKVIPSSREQVLQSLD
CYAD_BORPE      ---------------------------------------VWSVVGKTEIVVHAAGKVVPVGQSKIIAASE
HLYDP_ECOLX     -----------------ETPVSRRPRLVAYFIMGFLVIAILSVLGQVEIVATANGKLTHSGRSKEIKPIE
HLYDC_ECOLX     -----------------ETPVSRRPRLVAYFIMGFLVIAILSVLGQVEIVATANGKLTLSGRSKEIKPIE
HLYD_PASHA      ----------------------------------------------------------------------
HLYD_PASSP      ----------------------------------------------------------------------
HLYD_ACTAC      -----------------ETPVSNAPRFVSYSIMLFLTLAIISIFSNVEIIATASGKFALSGRSKEIKPIE
RTX1D_ACTPL     -----------------ETPVSKKPRLIAYLIMLFLFLAVISIVSHVEIVATATGKLAFSGRSKEIKPIE
RTX3D_ACTPL     ----------------------------------------------------------------------
APRE_PSEAE      ----------------------------------------------LDQGVAVPATVIISGQRKSVQHPL
PRTE_ERWCH      ----------------------------------------------LDKGVAVQGNVVVSGNRKVIQHMQ
MACA_ECOLI      ----------------------------------------------------------------------
MACA_SHIFL      ----------------------------------------------------------------------
MACA_ECO57      ----------------------------------------------------------------------
NDE1_USTMA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GGILAQLTVREGDRVQANQIVARLDPTRLASNVGEXXXXXXXXXXXXXXXXXEVNDLPLAFPAELNGWPD
CYAD_BORPE      TGRVARVLVADNSRVAAGDVLLRLDAGVTEAEERKWRVQAAQARQDEARSRAMIRALDTGRAAELPADPG
HLYDP_ECOLX     NSIVKEIIVKEGESVRKGDVLLKLEADTLKTQSSLLQARLEQTRYQILSRSIELNKLPLKLPEEVLRLTS
HLYDC_ECOLX     NSIVKEIIVKEGESVRKGDVLLKLEADTLKTQSSLLQARLEQIRYQILSRSIELNKLPLKLPEEVLRLTS
HLYD_PASHA      ----------------------------------------------------------------------
HLYD_PASSP      ----------------------------------------------------------------------
HLYD_ACTAC      NSLVKHIFVKEGEYVKKGELLLKLDTLKTKTSLSQAKLEEFRYKSLLEAVEKDQLDLPFMTENDQKRVTL
RTX1D_ACTPL     NALVKEIFVEDGQFVEKDQLLLHL--TALGADADQQKTKSSLSLTKLERYRYEIDRLPLATEEDKTRIRY
RTX3D_ACTPL     ----------------------------------------------------------------------
APRE_PSEAE      GGVVKHILVRDGQHVEAGEPLIRMEPTQARANVDSLLNRYANARLNQARLQAEYDEMPLAEQAPLPTLGX
PRTE_ERWCH      GGIVDRIQVKDGDRVAADQLIARLAATPRLTQARQRPEMAAIIALQEDLLRSRQQSLKLEIDASIDGLET
MACA_ECOLI      ----------------------------------------------------------------------
MACA_SHIFL      ----------------------------------------------------------------------
MACA_ECO57      ----------------------------------------------------------------------
NDE1_USTMA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LIAAETRLYKSRRAQLADTEAELRDALASVNKELAITQRLEKSGAASHVEVLRLQRQKSDLGLKITDLRS
CYAD_BORPE      MMAAQSYL----DSQYADYQAQLRSAIATYRRELGLVTQLRRDGDVSQQAYLEKEQARMTLEGRLRQSEX
HLYDP_ECOLX     LIKEQFSTWQNQKYQLDKKRAERLTVLARINRYENLSRLLHKQAIAKHVNELRVYKQLEQIESEILSAKE
HLYDC_ECOLX     LIKEQFSTWQNQKYQLDKKRAERLTILARINRYENVS-RVEKSRLDDFRSLLHKQAIAKHAVLE----QE
HLYD_PASHA      ----------------------------------------------------------------------
HLYD_PASSP      ----------------------------------------------------------------------
HLYD_ACTAC      LIEEQFSTWQKQRHQLNKKEAEKLSYLARIKKRLDDFRALYKEHAIAKHTVLDEENKYQD-AINELEVYK
RTX1D_ACTPL     LITEQFEAWQKQKYQLQRREAEKQTVLANINERLKDLKKLFNSKSTSKHDVLTQENRKSRLNEVESDLR-
RTX3D_ACTPL     -VLANIRKYESEKEKLSDLK-KLYD-VKSISKHELLAQENRYVEASNELSVYQLKEVESDLLKAQEDLKL
APRE_PSEAE      XXXXXXXXXHSRQTALANELSALRANIEGLRAQLEGLRQTEEEGYMPRNQLLEQERQLAEVNMRIAQREE
PRTE_ERWCH      SLGALQKVMSSKQSEQATLSQQLQGLLAADNNKMLETERLQVSGAQTSGEVGRTRRDXXXXXXXXXXXXX
MACA_ECOLI      ------------RAQRQQAEAELKLARVTYSRQ----QRLAQTKAVS----------QQDLDTAATEMAV
MACA_SHIFL      -------------------ENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTQAVSLQDLDT
MACA_ECO57      -------------------ENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTQAVSLQDLDT
NDE1_USTMA      ----EIKHWKSKVADMQDTESSLQDFVES-SKELE--QEMEKELSASNKTISDLKRRNEQLSGDLEDWKS


                         .         .         .         +         .         .         .:280
query           QYYVQAREALSKANAEVDMLSAILKGREDSVTRLTVRSPVRGIVKNIQVTTIGGVIPPNGEMMEIVPVDD
CYAD_BORPE      ETLVLARKLAAQAEQEIARTSA-------QRSRLVLTAPVDGVVQQLVALTEGTAVAATQPLMMVVPSGA
HLYDP_ECOLX     EYQLVTQDKLRQTTDNIGLLTLELAKNEERQQASVIRAPVSVKVQQLKVHTEGGVVTTAETLMVIVPEDD
HLYDC_ECOLX     NKYVEAANELRVYKSQLEQISEILSAKEEYVTQLVIRAPVSGKVQQLKVHTEGGVVTTAETLMVIVPEDD
HLYD_PASHA      -----------------------------------IRAPVSGTVQQLKIHTIGGVVTTAETLMIIVPEDD
HLYD_PASSP      -----------------------------------IRAPVSGTVQQLKIHTIGGVVTTAETLMIIVPEDD
HLYD_ACTAC      ASLMQVENEVLLAKEEQELVTQLLKQATDNVNLLTIRAPVSGTVQQLKVHTIDGVVTTAETLMVVVPEED
RTX1D_ACTPL     ----QAKEEIHKQNVEAEQLSLELEKNEQRQIASVIRAPV-SYVQQLKTHTVGGVVTTAETLMVIAPEDD
RTX3D_ACTPL     VTQLFKSDILEKLQQNIQQLTLELEKNEQRQLASIIRAPVSGTVQQLKTHTKGGVVTTAETLMVIAPEDD
APRE_PSEAE      EYRKEVNGQLAETQVNARTLWEELSSARYELRHAEIRAPVSGYVAGLKVFTDGGVIGPGELLMYIVPNSD
PRTE_ERWCH      EYDKEVNSELSDVQAKLNEVISQREKADFNLANVQVRAPVAGTVVDMKIFTEGGVIAPGQVMMDIVPEDQ
MACA_ECOLI      K-----QAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVT--QITTLQGTVIAAQQAPNILTLAD
MACA_SHIFL      AATEMAQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVT--QITTLQGTVIAAQQAPNILTLAD
MACA_ECO57      AATEMAQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVT--QITTLQGTVIAAQQAPNILTLAD
NDE1_USTMA      KY----SRALSEHNATLTTLQKELGQLRESV---------------------------------------


                         .         *         .         .         .         .         +:350
query           RLLIETRLSPRDIAFIHPGQRALVKITAYDYAIYGGLDGVVETISPDTIQDKVKPEIFYYRVFIRTHQDY
CYAD_BORPE      GIQVQAQLDSKDIGFVRAGAPATVKVGAYDYTKYGTLEGKVLYVSPDTVVDDRQQH--SYRVTIALAHPA
HLYDP_ECOLX     TLEVTALVQNKDIGFINVGQNAIIKVEAFPYTRYGYLVGKVKNINLDAIEDQRLGLVF--NVIISIEENC
HLYDC_ECOLX     TLEVTALVQNKDIGFINVGQNAIIKVEAFPYTRYGYLVGKVKNINLDAIEDQKLGLVF--NVIVSVEEND
HLYD_PASHA      VLEATALVPNKDIGFVAAGQEVIIKVETFPYTRYGYLTGRIKHISPDAIE---QPNVLVFNATIAIDRKN
HLYD_PASSP      VLEATALIQNKDIGFVAAGQEVIIKVETFPYTRYGYITGRIKHISPDAIEQPNLGLVFNATVSI--DKQA
HLYD_ACTAC      SLEVTALIQNKDIGFVKEGQEVVIKVEAFPYTRYGYLTGKVKNITLDAIE---HPKLLVFNTIIELDKKT
RTX1D_ACTPL     VLEVTALIQNKDIGFIEVGQDAVIKVETFPYTRYGYLMGKVKNITLEAIE---HPQLLVFNSIISIDRKT
RTX3D_ACTPL     VLEVSALIQNKDVGFVEIGQEAVIKVETFPYTRYGYLYGKVKTITLDAIE---HPQLLVFNSIIEINKKT
APRE_PSEAE      SLEVEGQLAVNLVDRIHSGLPVEMLFTAFNQSKTPRVTGEVTMVSADRLLDEQNKQPYY---ALRAQVDA
PRTE_ERWCH      PLLVDGRIPVEMVDKVWSGLPVELQFTAFSQSTTPRVPGTVTLLSADRLVDE-KDGTPYYGLRIQVSEEG
MACA_ECOLI      MMLVKAQVSEADVIHLKPGQKAWFTVLGDPLTRY---EGQIKDVLP--TPEKVNDAIFYYARF-------
MACA_SHIFL      MMLVKAQVSEADVIHLKPGQKAWFTVLGDPLTRY---EGQIKDVLP--TPEKVNDAIFYYARF-------
MACA_ECO57      MMLVKAQVSEADVIHLKPGQKAWFTVLGDPLTRY---EGQIKDVLP--TPEKVNDAIFYYARF-------
NDE1_USTMA      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LQNKSGRRFSIVPGMIATVDIKTGEKTIVDYLIKPFNRAKEALRER
CYAD_BORPE      LE-VDGKPRLLKEGMAVQADIRTGSRRLIEYLLSPVARAGESLGER
HLYDP_ECOLX     L-STGNKNIPLSSGMAVTAEIKTGMRSVISYLLSPLEESTESLRER
HLYDC_ECOLX     L-STGNKHIPLSSGMAVTAEIKTGMRSVISYLLSPLEESTESLHER
HLYD_PASHA      LTSPDGRKIDLSSGMTITAEIKTGERSVMSYLLSPLEESTESLRER
HLYD_PASSP      LSSPDGHKIELGLGMTITAEIKTGERSVMSYLLSPLEESTESLRER
HLYD_ACTAC      LSTEE-KEIPLSAGMEITAEIKTGMRSVISYLLSPLEESDKSLRER
RTX1D_ACTPL     LSGKDGKEIELGSGMSVTAEIKTGERSVISY---------------
RTX3D_ACTPL     LTD-GDKEIQLGSGMSVIAEIKTGERSVISFLLSPLEESTESLRER
APRE_PSEAE      AAMGKLKGLQIRPGMAVQVFVRTGERSLLNYLFKPFDRAHVALAE-
PRTE_ERWCH      KRSLHG--LEIKPGMPVQGFVRTGERSFINYLFKPMDRMHLALTE-
MACA_ECOLI      ----------------------------------------------
MACA_SHIFL      ----------------------------------------------
MACA_ECO57      ----------------------------------------------
NDE1_USTMA      ----------------------------------------------