[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF70265.1

[Show Plain Result]


## Summary of Sequence Search
    1::324
   21::300     3e-35  32%  315 aa  Y209_BRUME RecName: Full=Putative peptide transport system permease
   20::299     3e-35  32%  314 aa  Y1092_BRUSU RecName: Full=Putative peptide transport system
   20::299     3e-35  32%  314 aa  Y1050_BRUA2 RecName: Full=Putative peptide transport system
   20::299     3e-35  32%  314 aa  Y1031_BRUAB RecName: Full=Putative peptide transport system
   23::332     3e-30  29%  339 aa  DPPB_ECOLI RecName: Full=Dipeptide transport system permease
   23::332     3e-30  29%  339 aa  DPPB_ECOL6 RecName: Full=Dipeptide transport system permease
   23::332     3e-30  29%  339 aa  DPPB_ECO57 RecName: Full=Dipeptide transport system permease
   23::315     5e-29  26%  316 aa  APPB_BACSU RecName: Full=Oligopeptide transport system permease
   31::303     1e-27  32%  306 aa  GSIC_SALTY RecName: Full=Glutathione transport system permease
   31::303     2e-27  32%  306 aa  GSIC_SALTI RecName: Full=Glutathione transport system permease
   31::303     2e-27  32%  306 aa  GSIC_SALCH RecName: Full=Glutathione transport system permease
   31::274     3e-27  34%  306 aa  GSIC_SHISS RecName: Full=Glutathione transport system permease
   31::274     6e-27  34%  306 aa  GSIC_ECOL6 RecName: Full=Glutathione transport system permease
   31::274     1e-26  34%  306 aa  GSIC_SHIDS RecName: Full=Glutathione transport system permease
   31::303     1e-26  32%  306 aa  GSIC_SALPA RecName: Full=Glutathione transport system permease
   31::274     1e-26  34%  306 aa  GSIC_ECOUT RecName: Full=Glutathione transport system permease
   31::274     1e-26  34%  306 aa  GSIC_ECOLI RecName: Full=Glutathione transport system permease
   31::274     1e-26  34%  306 aa  GSIC_ECOL5 RecName: Full=Glutathione transport system permease
   31::274     1e-26  34%  306 aa  GSIC_ECOK1 RecName: Full=Glutathione transport system permease
   31::274     1e-26  34%  306 aa  GSIC_ECO57 RecName: Full=Glutathione transport system permease
   31::274     3e-26  33%  306 aa  GSIC_SHIFL RecName: Full=Glutathione transport system permease
   31::274     3e-26  33%  306 aa  GSIC_SHIF8 RecName: Full=Glutathione transport system permease
   31::274     9e-26  33%  306 aa  GSIC_SHIBS RecName: Full=Glutathione transport system permease
   56::303     9e-26  32%  306 aa  GSIC_ERWCT RecName: Full=Glutathione transport system permease
   24::287     1e-25  28%  313 aa  Y4TP_RHISN RecName: Full=Probable peptide ABC transporter permease
   23::314     7e-25  27%  333 aa  DPPB_BACPF RecName: Full=Dipeptide transport system permease
   24::308     3e-24  27%  314 aa  NIKB_ECOLI RecName: Full=Nickel transport system permease protein
   25::301     3e-23  30%  328 aa  OPPB2_STAAW RecName: Full=Putative oligopeptide transport system
   25::301     3e-23  30%  328 aa  OPPB2_STAAS RecName: Full=Putative oligopeptide transport system
   25::301     3e-23  30%  328 aa  OPPB2_STAAN RecName: Full=Putative oligopeptide transport system
   25::301     3e-23  30%  328 aa  OPPB2_STAAM RecName: Full=Putative oligopeptide transport system
   25::301     3e-23  30%  328 aa  OPPB2_STAAC RecName: Full=Putative oligopeptide transport system
   25::301     3e-23  30%  328 aa  OPPB2_STAA8 RecName: Full=Putative oligopeptide transport system
   25::301     3e-23  30%  328 aa  OPPB2_STAA3 RecName: Full=Putative oligopeptide transport system
   23::301     5e-23  29%  306 aa  OPPB_SHIFL RecName: Full=Oligopeptide transport system permease
   23::301     5e-23  29%  306 aa  OPPB_ECOLI RecName: Full=Oligopeptide transport system permease
   23::301     5e-23  29%  306 aa  OPPB_ECOL6 RecName: Full=Oligopeptide transport system permease
   23::301     5e-23  29%  306 aa  OPPB_ECO57 RecName: Full=Oligopeptide transport system permease
   23::301     7e-23  28%  306 aa  OPPB_SALTY RecName: Full=Oligopeptide transport system permease
   33::301     3e-22  30%  306 aa  OPPB_HAEIN RecName: Full=Oligopeptide transport system permease
   25::301     6e-22  30%  328 aa  OPPB2_STAAB RecName: Full=Putative oligopeptide transport system
   26::301     2e-21  29%  328 aa  OPPB2_STAAR RecName: Full=Putative oligopeptide transport system
   23::328     3e-21  27%  333 aa  DPPB_HAEIN RecName: Full=Dipeptide transport system permease
   25::315     1e-20  31%  340 aa  DDPB_ECOLI RecName: Full=Probable D,D-dipeptide transport system
   24::276     2e-19  23%  319 aa  OPPB_LACLS RecName: Full=Oligopeptide transport system permease
   24::276     2e-19  23%  319 aa  OPPB_LACLA RecName: Full=Oligopeptide transport system permease
   40::310     8e-19  28%  321 aa  SAPB_ECOLI RecName: Full=Peptide transport system permease protein
   40::310     8e-19  28%  321 aa  SAPB_ECO57 RecName: Full=Peptide transport system permease protein
   49::284     8e-19  27%  308 aa  DPPB_BACSU RecName: Full=Dipeptide transport system permease
   40::310     2e-16  28%  321 aa  SAPB_SALTY RecName: Full=Peptide transport system permease protein
   40::310     2e-16  28%  321 aa  SAPB_SALTI RecName: Full=Peptide transport system permease protein
   23::276     8e-16  25%  311 aa  OPPB_BACSU RecName: Full=Oligopeptide transport system permease
   31::313     1e-15  24%  319 aa  Y3860_BRUME RecName: Full=Putative peptide permease protein
   31::313     1e-15  24%  319 aa  Y2551_BRUO2 RecName: Full=Putative peptide permease protein
   31::313     2e-14  23%  319 aa  Y3408_BRUSU RecName: Full=Putative peptide permease protein
   29::319     6e-13  23%  325 aa  Y1314_MYCBO RecName: Full=Putative peptide transport permease
   29::319     6e-13  23%  325 aa  Y1283_MYCTU RecName: Full=Putative peptide transport permease
  292::486     7e-12  30%  498 aa  AMIC_STRR6 RecName: Full=Oligopeptide transport system permease
  292::486     7e-12  30%  498 aa  AMIC_STRPN RecName: Full=Oligopeptide transport system permease
   83::348     2e-11  26%  364 aa  YEJB_ECOLI RecName: Full=Inner membrane ABC transporter permease
   83::348     2e-11  26%  364 aa  YEJB_ECO57 RecName: Full=Inner membrane ABC transporter permease
    9::272     8e-11  25%  389 aa  OPPB_MYCPN RecName: Full=Oligopeptide transport system permease
   39::276     9e-10  24%  321 aa  SAPB_HAEIN RecName: Full=Peptide transport system permease protein
  100::224     1e-05  28%  304 aa  DPPC_BACPF RecName: Full=Dipeptide transport system permease
   99::218     8e-05  30%  301 aa  GSID_ERWCT RecName: Full=Glutathione transport system permease
    1::324

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxAVGTFILLSFSPVDPIRAYIGNDLLHVPPEQYARIAARWGLDQPLWERFGHW
Y209_BRUME      ------------------AILTFLLMKLLPGDPAILIAGDG---ASPETVERIRVELGLDQPTVVQLGQW
Y1092_BRUSU     ------------------AILTFLLMKLLPGDPAILIAGDG---ASPETVERIRVELGLDQPTVVQLGQW
Y1050_BRUA2     ------------------AILTFLLMKLLPGDPAILIAGDG---ASPETVERIRVELGLDQPTVVQLGQW
Y1031_BRUAB     ------------------AILTFLLMKLLPGDPAILIAGDG---ASPETVERIRVELGLDQPTVVQLGQW
DPPB_ECOLI      ---------------------TFAFVHMIPGDPVMIMAGER--GISPERHAQLLAELGLDKPMWQQYLHY
DPPB_ECOL6      ---------------------TFAFVHMIPGDPVMIMAGER--GISPERHAQLLAELGLDKPMWQQYLHY
DPPB_ECO57      ---------------------TFAFVHMIPGDPVMIMAGER--GISPERHAQLLAELGLDKPMWQQYLHY
APPB_BACSU      ---------------------SFVIMKAAPGDPMTLMMDPKISQADREQFIE---KYGLNDPQYVQYLKW
GSIC_SALTY      -----------------------------PGDPARLIAGPE---ADAQVIALVRQQLGLDQPLHVQFWHY
GSIC_SALTI      -----------------------------PGDPARLIAGPE---ADAQVIALVRQQLGLDQPLHVQFWHY
GSIC_SALCH      -----------------------------PGDPARLIAGPE---ADAQVIALVRQQLGLDQPLHVQFWHY
GSIC_SHISS      -----------------------------PGDPARLIAG---LEADAQVIELVRQQLGLDQPLYHQFWHY
GSIC_ECOL6      -----------------------------PGDPARLIAGPE---ADAQVIELVRQQLGLDQPLYHQFWHY
GSIC_SHIDS      -----------------------------PGDPARLIAGPE---ADAQVIELVRQQLGLDQPLYHQFWHY
GSIC_SALPA      -----------------------------PGDPARLIAGPE---ADAQVIALVRQQLGLDQPLHVQFWRY
GSIC_ECOUT      -----------------------------PGDPARLIAGPE---ADAQVIELVRQQLGLDQPLYHQFWHY
GSIC_ECOLI      -----------------------------PGDPARLIAGPE---ADAQVIELVRQQLGLDQPLYHQFWHY
GSIC_ECOL5      -----------------------------PGDPARLIAGPE---ADAQVIELVRQQLGLDQPLYHQFWHY
GSIC_ECOK1      -----------------------------PGDPARLIAGPE---ADAQVIELVRQQLGLDQPLYHQFWHY
GSIC_ECO57      -----------------------------PGDPARLIAGPE---ADAQVIELVRQQLGLDQPLYHQFWHY
GSIC_SHIFL      -----------------------------PGDPARLIAGPE---ADAQVIELVRQQLGLDQPLYHQFWHY
GSIC_SHIF8      -----------------------------PGDPARLIAGPE---ADAQVIELVRQQLGLDQPLYHQFWHY
GSIC_SHIBS      -----------------------------PGDPARLIAGPE---ADAQVIELVRQQLGLDQPLYHQFWHY
GSIC_ERWCT      ---------------------------------------------------------GLDKPLPHQFWHF
Y4TP_RHISN      ----------------------FLLLRLAPGDPAAVIAGPTATE---QMVANIREELGLNEPLPVQFVHW
DPPB_BACPF      ---------------------TFSIIHLIPGNPAQTILGEQ---ASPQAIADLEERLGLNEPYWVQYGLY
NIKB_ECOLI      ----------------------FLMLRLGTGDPALDYLRLSNLPPTPEMLASTRTMLGLDQPLYVQYGTW
OPPB2_STAAW     ---------------------TFILMKLSPGNPVDKILHLDVAQVSTEQINATKDKLGLNDSLLVQWWHW
OPPB2_STAAS     ---------------------TFILMKLSPGNPVDKILHLDVAQVSTEQINATKDKLGLNDSLLVQWWHW
OPPB2_STAAN     ---------------------TFILMKLSPGNPVDKILHLDVAQVSTEQINATKDKLGLNDSLLVQWWHW
OPPB2_STAAM     ---------------------TFILMKLSPGNPVDKILHLDVAQVSTEQINATKDKLGLNDSLLVQWWHW
OPPB2_STAAC     ---------------------TFILMKLSPGNPVDKILHLDVAQVSTEQINATKDKLGLNDSLLVQWWHW
OPPB2_STAA8     ---------------------TFILMKLSPGNPVDKILHLDVAQVSTEQINATKDKLGLNDSLLVQWWHW
OPPB2_STAA3     ---------------------TFILMKLSPGNPVDKILHLDVAQVSTEQINATKDKLGLNDSLLVQWWHW
OPPB_SHIFL      ---------------------SFFMMRLAPGSP---FTGERTL--PPEVMANIEAKYHLNDPIMTQYFSY
OPPB_ECOLI      ---------------------SFFMMRLAPGSP---FTGERTL--PPEVMANIEAKYHLNDPIMTQYFSY
OPPB_ECOL6      ---------------------SFFMMRLAPGSP---FTGERTL--PPEVMANIEAKYHLNDPIMTQYFSY
OPPB_ECO57      ---------------------SFFMMRLAPGSP---FTGERTL--PPEVMANIEAKYHLNDPIMTQYFSY
OPPB_SALTY      ---------------------SFFMMRLAPGSP---FTGERAL--PPEVLANIEAKYHLNDPIMTQYFSY
OPPB_HAEIN      ----------------------------SPFTSERAY--------PPEVMANIEAKYHLNEPLYKQYFLY
OPPB2_STAAB     ---------------------TFILMKLSPGNPVDKILHLDVAQVSMEQINATKDKLGLNDSLLVQWWHW
OPPB2_STAAR     ----------------------FILMKLSPGNPVDKILHLDVAQVSTEQINATKDKLGLNDSLLVQWWHW
DPPB_HAEIN      ---------------------TFALVHFIPGDPVEIMMGERGLTA--EVHQQMMHQLGLDLPLYQQYFHY
DDPB_ECOLI      ---------------------TFIISHLIPGDPARLLAGDRASDAIVEN---IRQQLGLDQPLYVQFYRY
OPPB_LACLS      ----------------------FFFAKLMPGDPFSGLIGP---HTDPHEVEALRRAAGLYDPWWEQYLRW
OPPB_LACLA      ----------------------FFFAKLMPGDPFSGLIGP---HTDPHEVEALRRAAGLYDPWWEQYLRW
SAPB_ECOLI      --------------------------------------------------------------LWNAWVFW
SAPB_ECO57      --------------------------------------------------------------LWNAWVFW
DPPB_BACSU      ----------------------------------------------------LEAYYHLDDPLIFQYIFY
SAPB_SALTY      --------------------------------------------------------------LWNAWVFW
SAPB_SALTI      --------------------------------------------------------------LWNAWVFW
OPPB_BACSU      ---------------------TFFLMQAAPGGP---FSGEKKL--PPEIEANLNAHYGLDKPLFVQYVSY
Y3860_BRUME     -----------------------------PGDPIDAYINPNVAMTQAEMDA-LRAQLGLDRPLPVQYLAW
Y2551_BRUO2     -----------------------------PGDPIDAYINPNVAMTQAEMDA-LRAQLGLDRPLPVQYLAW
Y3408_BRUSU     -----------------------------PGDPIDAYINPNVAMTQAEMDA-LRAQLGLDRPLPVQYLAW
Y1314_MYCBO     -------------------------LAFSPLESLMQRSPR-----PPQAVIDAKAHLGLDRPILARYANW
Y1283_MYCTU     -------------------------LAFSPLESLMQRSPR-----PPQAVIDAKAHLGLDRPILARYANW
AMIC_STRR6      ----------------------------------------------------------------------
AMIC_STRPN      ----------------------------------------------------------------------
YEJB_ECOLI      ----------------------------------------------PEVIAEITHRYGFDKPIHERYFKM
YEJB_ECO57      ----------------------------------------------PEVIAEITHRYGFDKPIHERYFKM
OPPB_MYCPN      ----------------------FFLVNSTGQTPLSATSSKDLEAVKTQLDA-----FGFNDPLIVRYGRY
SAPB_HAEIN      ------------------------------------------------------------QNIYIGYFHY
DPPC_BACPF      ----------------------------------------------------------------------
GSID_ERWCT      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FWRLLQGDMGYSMLFNMPVASVIRERFATSFALLAGAWLLSGVLGVTLGFLAGRFLHRWPDKMICRISYL
Y209_BRUME      LWNLFHFDLGRSFLLSQPVSQAIAERLPVTISLALLAFAITIPVGIIMGVVAAYLRDSWFDTGVMSLALL
Y1092_BRUSU     LWNLFHFDLGRSFLLSQPVSQAIAERLPVTISLALLAFAITIPVGIIMGVVAAYLRDSWFDMGVMSLALL
Y1050_BRUA2     LWNLFHFDLGRSFLLSQPVSQAIAERLPVTISLALLAFAITIPVGIIMGVVAAYLRDSWFDTGVMSLALL
Y1031_BRUAB     LWNLFHFDLGRSFLLSQPVSQAIAERLPVTISLALLAFAITIPVGIIMGVVAAYLRDSWFDTGVMSLALL
DPPB_ECOLI      IWGVMHGDLGISMKSRIPVWEEFVPRFQATLELGVCAMIFATAVGIPVGVLAAVKRGSIFDHTAVGLALT
DPPB_ECOL6      IWGVMHGDLGISMKSRIPVWEEFVPRFQATLELGVCAMIFATAVGIPVGVLAAVKRGSIFDHTAVGLALT
DPPB_ECO57      IWGVMHGDLGISMKSRIPVWEEFVPRFQATLELGVCAMIFATAVGIPVGVLAAVKRGSIFDHTAVGLALT
APPB_BACSU      LGNMVQGDFGTSIVRKTPVSELIMARLPNTLLLMLVSTILALMISIPFGVLSAKRPYSKIDYGITFTSFI
GSIC_SALTY      ITHVLQGDFGTSMVSRRPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAAVWRNRWPDRLGMTLAVT
GSIC_SALTI      ITHVLQGDFGTSMVSRRPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAAVWRNRWPDRVGMTLAVT
GSIC_SALCH      ITHVLQGDFGTSMVSRRPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAAVWRNRWPDRVGMTLAVT
GSIC_SHISS      ISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVS
GSIC_ECOL6      ISNAVQGDLGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVS
GSIC_SHIDS      ISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVS
GSIC_SALPA      ITHVLQGDFGTSMVSRRPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAAVWRNRWPDRLGMTLAVT
GSIC_ECOUT      ISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVS
GSIC_ECOLI      ISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVS
GSIC_ECOL5      ISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVS
GSIC_ECOK1      ISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVS
GSIC_ECO57      ISNAVQGDFGLSMVSRRPVADEIARRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVS
GSIC_SHIFL      ISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVS
GSIC_SHIF8      ISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVS
GSIC_SHIBS      ISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVS
GSIC_ERWCT      LTNILQGDLGTSMVSKRPVTQEIALRFMPTFWLTVCSMAWAVIFGMAIGIVSAVWRNGWPDRIGMTLAVS
Y4TP_RHISN      ASDVLRGNFGASVFTGVPVLQLLSQRLEPTISLSVLTMILSVTVGVSFGVLAAWRSGGFVDRALATFSAI
DPPB_BACPF      MKDLATGDLGTSLRTNKPIMEEIWPYLAATIELTIFAMIFAIIIGVNAGIVSAWKQNSWFDYLSMFIALV
NIKB_ECOLI      LWKALHLDFGISFASQRPVLDDMLNFLPATLELAGAALVLILLTSVPLGIWAARHRDRLPDFAVRFIAFL
OPPB2_STAAW     MNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKWTDKVIRVISTL
OPPB2_STAAS     MNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKWTDKVIRVISTL
OPPB2_STAAN     MNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKWTDKVIRVISTL
OPPB2_STAAM     MNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKWTDKVIRVISTL
OPPB2_STAAC     MNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKWTDKVIRVISTL
OPPB2_STAA8     MNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKWTDKVIRVISTL
OPPB2_STAA3     MNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKWTDKVIRVISTL
OPPB_SHIFL      LKQLAHGDFGPSFKYDYSVNDLVASSFPVSAKLGAAAFFLAVILGVSAGVIAALKQNTKWDYTVMGLAMT
OPPB_ECOLI      LKQLAHGDFGPSFKYDYSVNDLVASSFPVSAKLGAAAFFLAVILGVSAGVIAALKQNTKWDYTVMGLAMT
OPPB_ECOL6      LKQLAHGDFGPSFKYDYSVNDLVASSFPVSAKLGAAAFFLAVILGVSAGVIAALKQNTKWDYTVMGLAMT
OPPB_ECO57      LKQLAHGDFGPSFKYDYSVNDLVASSFPVSAKLGAAAFFLAVILGVSAGVIAALKQNTKWDYTVMGLAMT
OPPB_SALTY      LKQLAHGDFGPSFKYDYTVNDLVAASFPVSAKLGAAAFLLAVIIGVSAGVIAALKQNTRWDYTVMGFAMT
OPPB_HAEIN      LENLSKGDFGPSFKYDQSVNDLIASAFPVSIKLGMVAFAFAVVLGVTAGTLAALNQNSRWDYILMSFSML
OPPB2_STAAB     MNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVLSLCISIPLGIIAAKRFHKLSDKVIRVISTL
OPPB2_STAAR     MNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKLSDKVIRVISTL
DPPB_HAEIN      IGNVIQGDFGASFRTQQPVLTEFFTLFPATLAFFALFWSLLG--GIILGTIAAVKKDSWISHTVTAASLT
DDPB_ECOLI      VSDLFHGDLGTSIRTGRPVLEELRIFFPATXXXXXXXXXXXXXXXXXXXXXSAVWRNRWLDHLVRIMAIT
OPPB_LACLS      LGNAIHGNLGMSYNLKEPVMTVIGHRAINTFWMSLLSVILTYLFAIPMSIVAARNEGKWQDQLWLTYNSI
OPPB_LACLA      LGNAIHGNLGMSYNLKEPVMTVIGHRAINTFWMSLLSVILTYLFAIPMSIVAARNEGKWQDQLWLTYNSI
SAPB_ECOLI      FNGLIHWDFGVSSINGQPIAEQLKEVFPATMELCILAFGFALIVGIPVGMIAGITRHKWQDNLINAIALL
SAPB_ECO57      FNGLIHWDFGVSSINGQPIAEQLKEVFPATMELCILAFGFALIVGIPVGMIAGITRHKWQDNLINAIALL
DPPB_BACSU      LKSIITFDFGPSIKKPSDSVNDMLERFPVSFELGMTAIVIAVISGLVLGVIAALRRNGFLDYAAMSLAVL
SAPB_SALTY      FNGLLHWDFGVSSINGQLISEQLKEVFPATMELCILAFGFALMVGIPVGMLAGVTRSKWPDRFISALALL
SAPB_SALTI      FNGLLHWDFGVSSINGQLISEQLKEVFPATMELCILAFGFALMVGIPVGMLAGVTRSKWPDRFISALALL
OPPB_BACSU      LKSVAMWDFGPSFKYKQSVNDLISSGFPVSFTXXXXXXXXXXXXXXXXXXXXXXYHNKWQDYTVAILTIF
Y3860_BRUME     LGQAVQGNLGHSLRFNETVSGLIASRIGPTXXXXXXXXXXXXXXXXXXXXXSAVRRNSFPDYSFSVLALL
Y2551_BRUO2     LGQAVQGNLGHSLRFNETVSGLIASRIGPTXXXXXXXXXXXXXXXXXXXXXSAVRRNSFPDYSFSVLALL
Y3408_BRUSU     LGQAVQGNLGHSLRFNETVSGLIASRIGPTXXXXXXXXXXXXXXXXXXXXXSAVRRNSFLDYSFSVLALL
Y1314_MYCBO     VSHAVRGDFG-TTITGQPVGTEXXXXXXXXXXXXXXXXXXXTVAGVVIGAWGAIRQYRLSDRVMTTLALL
Y1283_MYCTU     VSHAVRGDFG-TTITGQPVGTEXXXXXXXXXXXXXXXXXXXTVAGVVIGAWGAIRQYRLSDRVMTTLALL
AMIC_STRR6      --------------------------------------VLAYALAVPLGSAMARFKNTWIDSLSTGALTF
AMIC_STRPN      --------------------------------------VLAYALAVPLGSAMARFKNTWIDSLSTGALTF
YEJB_ECOLI      LWDYIRFDFGDSLFRSASVLTLIKDSLPVSITL--GLWLVSIPLGIRKAVYNGSRFDVWSSAFII-IGYX
YEJB_ECO57      LWDYIRFDFGDSLFRSASVLTLIKDSLPVSITL--GLWLVSIPLGIRKAVYNGSRFDVWSSAFII-IGYX
OPPB_MYCPN      WQTLFSGSLGYYSSPNQTIDQIVFGRVPNTLYVVLISFFIGSLLGIIFGMISGLFRGKLIDAVINVLVVL
SAPB_HAEIN      LGTLLQGDFGITYNGGKSLMNLILTVLPPTLELCFITLFLAFIFGLPLGIISAVNSEQVFAKSLQILSYV
DPPC_BACPF      --------------------------YGARLSLQVGFFAVTGALGTTLGLIAG-YYGRWIDMLISRIFDI
GSID_ERWCT      ----------------------------TRISLAAGIFLVGMMIGTTLGLLAG-YYEGWADRIIMRICDV


                         +         .         .         .         .         *         .:210
query           LSSLPTFWIAMLLLALFAVRWPVLPVCCAWDPGNNAGTALLSERLRHLVLPVCALSLLGMGQIALHTREK
Y209_BRUME      GVSVPSFWLAILAVILFS-------VTLGWFPSAGYVPFLDSPLLRSLILPASILALFQIGYLARMTRSE
Y1092_BRUSU     GVSVPSFWLAILAVILFS-------VTLGWFPSAGYVPFLDSPLLRSLILPASILALFQIGYLARMTRSE
Y1050_BRUA2     GVSVPSFWLAILAVILFS-------VTLGWFPSAGYVPFLDSPLLRSLILPASILALFQIGYLARMTRSE
Y1031_BRUAB     GVSVPSFWLAILAVILFS-------VTLGWFPSAGYVPFLDSPLLRSLILPASILALFQIGYLARMTRSE
DPPB_ECOLI      GYSMPIFWWGMMLIMLVSVHWNLTPVMVFLDDSNPIDTAIWGEAVAHMILPAIVLGTIPLAVIVRMTRSS
DPPB_ECOL6      GYSMPIFWWGMMLIMLVSVHWNLTPVMVFLDDSNPIDTAIWGEAVAHMILPAIVLGTIPLAVIVRMTRSS
DPPB_ECO57      GYSMPIFWWGMMLIMLVSVHWNLTPVMVFLDDSNPIDTAIWGEAVAHMILPAIVLGTIPLAVIVRMTRSS
APPB_BACSU      GLAIPNFWFGLILIM-------VLSVNLGWFPTGGVETLNIFDRIHHLILPAFVLATADMAGLTRYTRSN
GSIC_SALTY      GISFPAFALGMLLMQIFSVDLGWLPTVGA-------------DSWQHYILPSLTLGAAVASVMARFTRSS
GSIC_SALTI      GISFPAFALGMLLMQIFSVDLGWLPTVGA-------------DSWQHYILPSLTLGAAVASVMARFTRSS
GSIC_SALCH      GISFPAFALGMLLMQIFSVDLGWLPTVGA-------------DSWQHYILPSLTLGAAVASVMARFTRSS
GSIC_SHISS      GISFPAFALGMLLIQVFSVELGWLPTVGA-------------DSWQHYILPSLTLGAAVAAVMARFTRAS
GSIC_ECOL6      GISFPAFALGMLLIQVFSVELGWLPTVGA-------------DSWQHYILPSLTLGAAVAAVMARFTRAS
GSIC_SHIDS      GISFPAFALGMLLIQVFSVELGWLPTVGA-------------DSWQHYILPSLTLGAAVAAVMARFTRAS
GSIC_SALPA      GISFPAFALGMLLMQIFSVDLGWLPTVGA-------------DSWQHYILPSLTLGAAVASVMARFTRSS
GSIC_ECOUT      GISFPAFALGMLLIQVFSVELGWLPTVGA-------------DSWQHYILPSLTLGAAVAAVMARFTRAS
GSIC_ECOLI      GISFPAFALGMLLIQVFSVELGWLPTVGA-------------DSWQHYILPSLTLGAAVAAVMARFTRAS
GSIC_ECOL5      GISFPAFALGMLLIQVFSVELGWLPTVGA-------------DSWQHYILPSLTLGAAVAAVMARFTRAS
GSIC_ECOK1      GISFPAFALGMLLIQVFSVELGWLPTVGA-------------DSWQHYILPSLTLGAAVAAVMARFTRAS
GSIC_ECO57      GISFPAFALGMLLIQVFSVELGWLPTVGA-------------DSWQHYILPSLTLGAAVAAVMARFTRAS
GSIC_SHIFL      GISFPAFALGMFLIQVFSVELGWLPTVGA-------------DSWQHYILPSLTLGAAVAAVMARFTRAS
GSIC_SHIF8      GISFPAFALGMFLIQVFSVELGWLPTVGA-------------DSWQHYILPSLTLGAAVAAVMARFTRAS
GSIC_SHIBS      GISFPAFALGMLLIQVFSVELGWLPTVGA-------------DSWQHYILSSLTLGAAVAAVMARFTRAS
GSIC_ERWCT      GLSFPAFALGMLLMQIFSVE-------LGWLPTVGADTWL------HYILPSLTLGAAVAAVMARFTRAS
Y4TP_RHISN      GYSVPVFVIGYILIYFFAIQTRWLPV-----QGYTSINQGVAPWFLHLILPTVTLSVPYIAFIARITRGS
DPPB_BACPF      GVSMPIFWLALMEQWIFAQELGWLPAFGRDNPGLYVFDTIISESIKHLILPGIALGTIPMAIIARMTRSS
NIKB_ECOLI      GVSMPNFWLAFLLVMAFSVYLQWLP-------------AMGYGGWQHIILPAVSIAFMSLAINARLLRAS
OPPB2_STAAW     SISLPAFFIGIILLFIVTNLM-------------NIDSVILSQ----FILPVITLSLGMCAYIIRLVRSN
OPPB2_STAAS     SISLPAFFIGIILLFIVTNLM-------------NIDSVILSQ----FILPVITLSLGMCAYIIRLVRSN
OPPB2_STAAN     SISLPAFFIGIILLFIVTNLM-------------NIDSVILSQ----FILPVITLSLGMCAYIIRLVRSN
OPPB2_STAAM     SISLPAFFIGIILLFIVTNLM-------------NIDSVILSQ----FILPVITLSLGMCAYIIRLVRSN
OPPB2_STAAC     SISLPAFFIGIILLFIVTNLM-------------NIDSVILSQ----FILPVITLSLGMCAYIIRLVRSN
OPPB2_STAA8     SISLPAFFIGIILLFIVTNLM-------------NIDSVILSQ----FILPVITLSLGMCAYIIRLVRSN
OPPB2_STAA3     SISLPAFFIGIILLFIVTNLM-------------NIDSVILSQ----FILPVITLSLGMCAYIIRLVRSN
OPPB_SHIFL      GVVIPSFVVAPLLVMIFAI-------ILHWLPGGNGGA------LKFMILPMVALSLAYIASIARITRGS
OPPB_ECOLI      GVVIPSFVVAPLLVMIFAI-------ILHWLPGGNGGA------LKFMILPMVALSLAYIASIARITRGS
OPPB_ECOL6      GVVIPSFVVAPLLVMIFAI-------ILHWLPGGNGGA------LKFMILPMVALSLAYIASIARITRGS
OPPB_ECO57      GVVIPSFVVAPLLVMIFAI-------ILHWLPGGNGGA------LKFMILPMVALSLAYIASIARITRGS
OPPB_SALTY      GVVIPSFVVAPLLVMVFAITLQWLP-----GGGWNGGA------LKFMILPMVALSLAYIASIARITRGS
OPPB_HAEIN      GVIMPSFVFAPVLVLIFAIYLGWLPA-----GGWNGGTAM------YMILPVASLTIAYVAGIARIMRGS
OPPB2_STAAB     SISLPAFFIGIILLFIVTNLM-------------NIDSVILSQ----FILPVITLSLGMCAYIIRLVRSN
OPPB2_STAAR     SISLPAFFIGIILLFIVTNLM-------------NIDSVILSQ----FILPVLTLSLGMCAYIIRLVRSN
DPPB_HAEIN      GYSMPIFWWGLILILYVSPQWIDTPTFMLIDSWLSGVSGAFENAVKSLILPAIVLGTVPLAIITRMTRSA
DDPB_ECOLI      GISTPAFWLGLGVIVLFYGHLQILPGGGRLDPTHVTGFYLLDNALQHLILPALTLAFVHLGIVARQIRSA
OPPB_LACLS      TFGIPPYVFYLLIIFIFGYSLNWFPTGGTVSPDAMGIIPVFFSKIYHMILPAFSLAVFGTVGIFTYFRSG
OPPB_LACLA      TFGIPPYVFYLLIIFIFGYSLNWFPTGGTVSPDAMGIIPVFFSKIYHMILPAFSLAVFGTVGIFTYFRSG
SAPB_ECOLI      GFSIPVXXXXXXVSGRFDLLYEVKPIIDAWLSDSPWRDEMIMSAIRHMILPVITLSVAPTTEVIRLMRIS
SAPB_ECO57      GFSIPVXXXXXXVSGRFDLLYEVKPIIDAWLSDSPWRDEMIMSAIRHMILPVITLSVAPTTEVIRLMRIS
DPPB_BACSU      GISIPNFILATLLIQQFAVNLKLFPAATWTSP-------------IHMVLPTAALAVGPMAIIARLTRSS
SAPB_SALTY      GFSIPVXXXXXXVSGRFDLLYEVKPVIDAWISDSPWRDEMVMSAIRHMVLPVLTLSVAPTTEVIRLMRIS
SAPB_SALTI      GFSIPVXXXXXXVSGRFDLLYEVKPVIDAWISDSPWRDEMVMSAIRHMVLPVLTLSVAPTTEVIRLMRIS
OPPB_BACSU      GISVPSFIMAAVLQYVFSMKLGLFPVA-GWDSW------------AYTFLPSIALASMPMAFIARLSRSS
Y3860_BRUME     GISSPAFLTALLGLYVFSVRLKWAPSGGMLTPATDFS---IPDXXXXXXXXXXXXSIGHAALIMRYMRSS
Y2551_BRUO2     GISSPAFLTALLGLYVFSVRLKWAPSGGMLTPATDFS---IPDXXXXXXXXXXXXSIGHAALIMRYMRSS
Y3408_BRUSU     GISSPAFLTALLGLYVFSVRLKWAPSGGMLTPATDFS---IPDXXXXXXXXXXXXSIGHAALIMRYMRSS
Y1314_MYCBO     VLSTPTFVVALLILGALRVNWAVGIQLFDYTGETSPGVARLGDRLQHXXXXXXXXXXXXXXGFSRYQRNA
Y1283_MYCTU     VLSTPTFVVALLILGALRVNWAVGIQLFDYTGETSPGVARLGDRLQHXXXXXXXXXXXXXXGFSRYQRNA
AMIC_STRR6      LLALPT--IALVYIVRLIGSSIALP---------DSFPILGAGDWRSYVLPAVILGLLGAPGTAIWIRRY
AMIC_STRPN      LLALPT--IALVYIVRLIGSSIALP---------DSFPILGAGDWRSYVLPAVILGLLGAPGTAIWIRRY
YEJB_ECOLI      XXXXXSYFDLFPLRGLVSANFDSLP----W-------YQKITDYLWHITLPVLATVIGGFAALTMLTKNS
YEJB_ECO57      XXXXXSYFDLFPLRGLVSANFDSLP----W-------YQKITDYLWHITLPVLATVIGGFAALTMLTKNS
OPPB_MYCPN      FVSIPSFVVXXXXXXXXXFRLPPRFIXXXXXXXXXXXXXXXS------IIPILSLVFYTSAAFTYRVRNE
SAPB_HAEIN      GLSIPIFWLAPILLYVAALHWEIFPVIDMWFMEVPYRTKIVQNILQHLALPTLVLCILPTMEIIRIIHQR
DPPC_BACPF      MLAFPSXXXXXXXXXXX---------------GPSLQNALI------------AIAIVNVPIFGRLVRSK
GSID_ERWCT      LFAFPG-----ILLAIAVV-------------------AIMGSGMANVVVAVAIFSIPAFARL---VRGN


                         .         .         .         +         .         .         .:280
query           IASVMKSEFIRFARAQGDKGWSLLCHQVLRHAITPALCLQFASXXXXXXXXXXXXKVFAYPGLGQATIDA
Y209_BRUME      MLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVLTVSGYIFSLLIGGSVVIEQIFALPGLGRLLVQA
Y1092_BRUSU     MLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVLTVSGYIFSLLIGGSVVIEQIFALPGLGRLLVQA
Y1050_BRUA2     MLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVLTVSGYIFSLLIGGSVVIEQIFALPGLGRLLVQA
Y1031_BRUAB     MLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVLTVSGYIFSLLIGGSVVIEQIFALPGLGRLLVQA
DPPB_ECOLI      MLEVLGEDYIRTARAKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDA
DPPB_ECOL6      MLEVLGEDYIRTARAKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDA
DPPB_ECO57      MLEVLGEDYIRTARAKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDA
APPB_BACSU      MLDVLNQDYIRTARAKGFKENRVLFKHGLRNALLPVITIFGLMIPSFIGGSVVVEQIFTWPGLGKLFVDS
GSIC_SALTY      FVDVLSEDYMRTARAKGSETWVVLKHG-LRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
GSIC_SALTI      FVDVLSEDYMRTARAKGSETWVVLKHG-LRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
GSIC_SALCH      FVDVLSEDYMRTARAKGSETWVVLKHG-LRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
GSIC_SHISS      FVDVLSEDYMRTARAKGSETWVVLKHG-LRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
GSIC_ECOL6      FVDVLSEDYMRTARAKGSETWVVLKHG-LRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
GSIC_SHIDS      FVDVLSEDYMRTARAKGSETWVVLKHG-LRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
GSIC_SALPA      FVDVLSEDYMRTARAKGSETWVVLKHG-LRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
GSIC_ECOUT      FVDVLSEDYMRTARAKGSETWVVLKHG-LRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
GSIC_ECOLI      FVDVLSEDYMRTARAKGSETWVVLKHG-LRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
GSIC_ECOL5      FVDVLSEDYMRTARAKGSETWVVLKHG-LRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
GSIC_ECOK1      FVDVLSEDYMRTARAKGSETWVVLKHG-LRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
GSIC_ECO57      FVDVLSEDYMRTARAKGSETWVVLKHG-LRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
GSIC_SHIFL      FVDVLSEDYMRTARAKGSETWVVLKHG-LRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
GSIC_SHIF8      FVDVLSEDYMRTARAKGSETWVVLKHG-LRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
GSIC_SHIBS      FVDVLSEDYMRTARAKGSETWVVLKHG-LRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
GSIC_ERWCT      FVDVLQEDYMRTARAKGVRESLVVLKHGLRNALIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDS
Y4TP_RHISN      MLEVLSEDYMRTAAAKGASPFAMLFHHALKNAGVPILTVIGISFAYMIGGVVLTETVFNVPGIGRLVVDA
DPPB_BACPF      MLEVLRSDYIRTVNAKGSGQGVVIYKHALKNALIPVLTVVGLQTGNLLGGAILTETIFSWPGIGRYIFEA
NIKB_ECOLI      MLDVAGQRHVTWARLRGLNDKQTERRHILRNASLPMITAVGMHIGELIGGTMIIENIFAWPGVGRYAVSA
OPPB2_STAAW     LLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDS
OPPB2_STAAS     LLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDS
OPPB2_STAAN     LLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDS
OPPB2_STAAM     LLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDS
OPPB2_STAAC     LLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDS
OPPB2_STAA8     LLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDS
OPPB2_STAA3     LLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDS
OPPB_SHIFL      MIEVLHSNFIRTARAKGLPMRRIILRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQLFVNG
OPPB_ECOLI      MIEVLHSNFIRTARAKGLPMRRIILRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQLFVNG
OPPB_ECOL6      MIEVLHSNFIRTARAKGLPMRRIILRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQLFVNG
OPPB_ECO57      MIEVLHSNFIRTARAKGLPMRRIILRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQLFVNG
OPPB_SALTY      MIEVLHSNFIRTARAKGLPMRRIIFRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQLFVNG
OPPB_HAEIN      MIEVLHSNFIRTAKAKGLSMSRIILKHALRPALLPVITYLGPAFVGIITGSMVIESVFGLPGMGLLFVNG
OPPB2_STAAB     LLMLLQSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDS
OPPB2_STAAR     LLILLKSNIVQASRLRGMNERYILIHDLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDS
DPPB_HAEIN      MLEVLGEDYIRTAKAKGLSYTRIVIVHALRNALIPVVTVVGLIVAQLLSGAVLTETIFSWPGIGKWIIDA
DDPB_ECOLI      MLEQLSEDYIRTARASGLPGWYIVLCYALPNALIPSITXXXXXXXXXXXXXXXTETVFAWPGMGAWVVTS
OPPB_LACLS      ILDEQTQDYVRTARAKGVKEKVIFRRHILRNASLPIASNFGFVITGLLGGAIFAETIFGYPGLGQLFI--
OPPB_LACLA      ILDEQTQDYVRTARAKGVKEKVIFRRHILRNASLPIASNFGFVITGLLGGAIFAETIFGYPGLGQLFI--
SAPB_ECOLI      TIEVYDQNYVKAAATRGLSRFTILRRHVLHNAVIPRLGLQFST---MLTLAMITEMVFSWPGLGRWLINA
SAPB_ECO57      TIEVYDQNYVKAAATRGLSRFTILRRHVLHNAVIPRLGLQFST---MLTLAMITEMVFSWPGLGRWLINA
DPPB_BACSU      MVEVLTQDYIRTAKAKGLSPFKIIVKHALRNALMPVITVLGTLVASILTGSFVIEKIFAIPGMGKYFVES
SAPB_SALTY      TIEVYDQNYVKAAATRGLSRFTILRRHVLHNAVIPRLGLQFST---MLTLAMITEMVFSWPGLGRWLIHA
SAPB_SALTI      TIEVYDQNYVKAAATRGLSRFTILRRHVLHNAVIPRLGLQFST---MLTLAMITEMVFSWPGLGRWLIHA
OPPB_BACSU      MIEVLNSDYIRTAKAKGLSRPAVTVRHAIRNALLPVVTYMGPMAAQVLTGSFIIETIFGIPGLGAHFVNS
Y3860_BRUME     MLETLNQDYVRTARAKGVREFWVVVKHTLRNAMLPVVTLIGSTIGLAVGGAIFIESVFNWPGMGLLLINA
Y2551_BRUO2     MLETLNQDYVRTARAKGVREFWVVVKHTLRNAMLPVVTLIGSTIGLAVGGAIFIESVFNWPGMGLLLINA
Y3408_BRUSU     MLETLNQDYVRTARAKGVREFWVVVKHTLRNAMLPVVTLIGSTIGLAVGGAIFIESVFNWPGMGLLLINA
Y1314_MYCBO     MLDVLGQDFIRTARAKGLTRRRALLKHGLRTALIPMATLFAYGVAGLVTGAVFVEKIFGWHGMGEWMVRG
Y1283_MYCTU     MLDVLGQDFIRTARAKGLTRRRALLKHGLRTALIPMATLFAYGVAGLVTGAVFVEKIFGWHGMGEWMVRG
AMIC_STRR6      MIDLQSQDFVRFARAKGLSEKEISNKHIFKNAMVPLVSXXXXXXXXXXXXXTLTETVFAFPGMGKMLIDS
AMIC_STRPN      MIDLQSQDFVRFARAKGLSEKEISNKHIFKNAMVPLVSXXXXXXXXXXXXXTLTETVFAFPGMGKMLIDS
YEJB_ECOLI      FLDEVRKQYVVTARAKGVSEKNILWKHVFRNAMLLVIAGFPATFISMFFTGSLLIEVFSLNGLGLLGYEA
YEJB_ECO57      FLDEVRKQYVVTARAKGVSEKNILWKHVFRNAMLLVIAGFPATFISMFFTGSLLIEVFSLNGLGLLGYEA
OPPB_MYCPN      VVEVMNQDYIKTARSKGLSTFAVALYHIFRNSIIPSVPLFVXXXXXXXXXXXXXXXLFGVQGVSRILIDS
SAPB_HAEIN      AEYILNQNFSKVATTRGWSKWKILHQYVFRNTF-PLLVPQVPRVFTLVLTQCMLVEALGWPGIGRWLINA
DPPC_BACPF      VISLREEEFIMAAKAQGMKNGRIIFHHILPNSLAPII---------------------------------
GSID_ERWCT      TLVLKQLTYIESARSMGANDWTILFRHILPGSVS------------------------------------


                         .         *         .         .         .         .         +:350
query           GLRGDVPLLMGIVLFCTLLVFAGNTISAWLVVVLNRSLERxxxx
Y209_BRUME      ILARDLPVVQGTMLFLGFLFVAINVL------------------
Y1092_BRUSU     ILARDLPVVQGTMLFLGFLFVAINVL------------------
Y1050_BRUA2     ILARDLPVVQGTMLFLGFLFVAINVL------------------
Y1031_BRUAB     ILARDLPVVQGTMLFLGFLFVAINVL------------------
DPPB_ECOLI      LQRRDYPVVQGGVLLVATMIILVNLLVDLLYGVVN---------
DPPB_ECOL6      LQRRDYPVVQGGVLLVATMIILVNLLVDLLYGVVN---------
DPPB_ECO57      LQRRDYPVVQGGVLLVATMIILVNLLVDLLYGVVN---------
APPB_BACSU      AFQRDYPVIMAMTVISAVLVVVGNLIADILYAIVDPRIE-----
GSIC_SALTY      VDMRDYPVIQAEVLLFSLEFILINLVVDVLYAAINPAI------
GSIC_SALTI      VDMRDYPVIQAEVLLFSLEFILINLVVDVLYAAINPAI------
GSIC_SALCH      VDMRDYPVIQAEVLLFSLEFILINLVVDVLYAAINPAI------
GSIC_SHISS      VEMRDYPVI-----------------------------------
GSIC_ECOL6      VEMRDYPVI-----------------------------------
GSIC_SHIDS      VEMRDYPVI-----------------------------------
GSIC_SALPA      VDMRDYPVIQAEVLLFSLEFILINLVVDVLYAAINPAI------
GSIC_ECOUT      VEMRDYPVI-----------------------------------
GSIC_ECOLI      VEMRDYPVI-----------------------------------
GSIC_ECOL5      VEMRDYPVI-----------------------------------
GSIC_ECOK1      VEMRDYPVI-----------------------------------
GSIC_ECO57      VEMRDYPVI-----------------------------------
GSIC_SHIFL      VEMRDYPVI-----------------------------------
GSIC_SHIF8      VEMRDYPVI-----------------------------------
GSIC_SHIBS      VEMRDYPVI-----------------------------------
GSIC_ERWCT      VEMRDYPVIQAEVLLFSLEFILINLLVDMLYAAINPAI------
Y4TP_RHISN      IKNRDYPIIQTVLV------------------------------
DPPB_BACPF      INYRDYPVIQGILVVATIFV------------------------
NIKB_ECOLI      IFNRDYPVIQCFTLMMVVVFVVCNLIVDLLNAALDPRIRR----
OPPB2_STAAW     IKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLLD---------
OPPB2_STAAS     IKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLLD---------
OPPB2_STAAN     IKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLLD---------
OPPB2_STAAM     IKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLLD---------
OPPB2_STAAC     IKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLLD---------
OPPB2_STAA8     IKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLLD---------
OPPB2_STAA3     IKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLLD---------
OPPB_SHIFL      ALNRDYSLVLSLTILVGALTILFNAIVDVLYAVID---------
OPPB_ECOLI      ALNRDYSLVLSLTILVGALTILFNAIVDVLYAVID---------
OPPB_ECOL6      ALNRDYSLVLSLTILVGALTILFNAIVDVLYAVID---------
OPPB_ECO57      ALNRDYSLVLSLTILVGALTILFNAIVDVLYAVID---------
OPPB_SALTY      ALNRDYSLVLSLTILVGALTILFNAIVDVLYAVID---------
OPPB_HAEIN      ALNRDYSLVLSLTILVGTLTILFNAIVDILYAIID---------
OPPB2_STAAB     IKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLLD---------
OPPB2_STAAR     IKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLLD---------
DPPB_HAEIN      IQARDYPVLQGSVLIIATIIIVVNLTVDLLYGVVN---------
DDPB_ECOLI      IQALDFPAVMG---FAVVVSFA----------------------
OPPB_LACLS      --------------------------------------------
OPPB_LACLA      --------------------------------------------
SAPB_ECOLI      IRQQDYAAISAGVMVCGSLVIIVNVISDILGAMAN---------
SAPB_ECO57      IRQQDYAAISAGVMVCGSLVIIVNVISDILGAMAN---------
DPPB_BACSU      INQRDYPVIMGTTVFYSVIL------------------------
SAPB_SALTY      IRQQDYAAISAGVMVIGSLVIVVNVISDILGAMAN---------
SAPB_SALTI      IRQQDYAAISAGVMVIGSLVIVVNVISDILGAMAN---------
OPPB_BACSU      ITNRDYTVIMGV--------------------------------
Y3860_BRUME     VETRDYPVIMGATLVIGACVIIVNILTDLAYAVID---------
Y2551_BRUO2     VETRDYPVIMGATLVIGACVIIVNILTDLAYAVID---------
Y3408_BRUSU     VETRDYPVIMGATLVIGACVIIVNILTDLAYAVID---------
Y1314_MYCBO     ISTQDTNIVAAITVFSGAVVLLAGLLSDVIYAALD---------
Y1283_MYCTU     ISTQDTNIVAAITVFSGAVVLLAGLLSDVIYAALD---------
AMIC_STRR6      VKASNNSMVVGLVIFTCISIFSRLLGDIWMTII-----------
AMIC_STRPN      VKASNNSMVVGLVIFTCISIFSRLLGDIWMTII-----------
YEJB_ECOLI      TVSRDYPVMFGTLYIFTLIGLLLNIVS-----------------
YEJB_ECO57      TVSRDYPVMFGTLYIFTLIGLLLNIVS-----------------
OPPB_MYCPN      VQSNETNLVMFNIMF-----------------------------
SAPB_HAEIN      --------------------------------------------
DPPC_BACPF      --------------------------------------------
GSID_ERWCT      --------------------------------------------