[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF70405.1

[Show Plain Result]


## Summary of Sequence Search
    1::478
    3::480       0.0 100%  480 aa  MANC_SALTY RecName: Full=Mannose-1-phosphate guanylyltransferase
    1::478       0.0  89%  478 aa  MANC1_ECO57 RecName: Full=Mannose-1-phosphate guanylyltransferase
    1::478       0.0  89%  478 aa  MANC_ECOLI RecName: Full=Mannose-1-phosphate guanylyltransferase;  
    4::470     e-178  67%  471 aa  MANC_SALMO RecName: Full=Mannose-1-phosphate guanylyltransferase;  
    2::470     e-162  62%  471 aa  MANC9_ECOLX RecName: Full=Mannose-1-phosphate guanylyltransferase; 
    2::470     e-162  61%  471 aa  MANC_KLEPN RecName: Full=Mannose-1-phosphate guanylyltransferase;  
    1::478     e-155  56%  482 aa  MANC2_ECO57 RecName: Full=Mannose-1-phosphate guanylyltransferase
    5::469     e-155  59%  479 aa  RFBM_SALTY RecName: Full=Mannose-1-phosphate guanylyltransferase
    2::470     e-147  54%  473 aa  RFBM_SALMU RecName: Full=Mannose-1-phosphate guanylyltransferase;  
    6::466     e-142  57%  467 aa  XANB_XANCB RecName: Full=Xanthan biosynthesis protein
    6::466     e-142  57%  467 aa  XANB_XANCP RecName: Full=Xanthan biosynthesis protein
    4::465     e-142  58%  465 aa  RFBA_VIBCH RecName: Full=Putative mannose-1-phosphate
    1::468     e-135  53%  481 aa  ALGA_PSEAE RecName: Full=Alginate biosynthesis protein
    1::468     e-134  52%  483 aa  ALGA_PSESM RecName: Full=Alginate biosynthesis protein
    2::469     e-133  52%  485 aa  ALGA_PSEPK RecName: Full=Alginate biosynthesis protein
    5::446     e-131  51%  464 aa  MANC7_ECOLX RecName: Full=Mannose-1-phosphate guanylyltransferase; 
    1::468     e-128  50%  483 aa  ALGA_PSEFL RecName: Full=Alginate biosynthesis protein
   32::498     e-110  47%  512 aa  NOEJ_RHISN RecName: Full=Mannose-1-phosphate guanylyltransferase;  
    7::120     1e-05  25%  125 aa  Y1618_METJA RecName: Full=Uncharacterized protein MJ1618;
   52::117     1e-05  27%  149 aa  TCMJ_STRGA RecName: Full=Tetracenomycin polyketide synthesis
  502::606     7e-05  31% 1222 aa  SC160_YEAST RecName: Full=Protein SCP160;AltName: Full=Protein HX;
    1::478

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRQTKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVICNEQHRFIVAE
MANC_SALTY      MRQTKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPLVICNEQHRFIVAE
MANC1_ECO57     MAQSKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVICNEQHRFIVAE
MANC_ECOLI      MAQSKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVICNEQHRFIVAE
MANC_SALMO      -------PIIMAGGNGSRLWPLSRTLYPKQFLCLDGSQSMLQTTITRINNLNASDPIVICNEQHRFIVAE
MANC9_ECOLX     -----LLPVIMAGGTGSRLWPMSRELYPKQFLRLFGQNSMLQETITRLSGLEVHEPMVICNEEHRFLVAE
MANC_KLEPN      -----LLPVIMAGGTGSRLWPMSRELYPKQFLRLFGQNSMLQETITRLSGLEIHEPMVICNEEHRFLVAE
MANC2_ECO57     MSDAPIIAVVMAGGTGSRLWPLSRELYPKQFLQLSGDNXXXXXXXXXXXXXSCQKPLVITNEQHRFVVAE
RFBM_SALTY      -------PVIMAGGTGSRLWPLSREYHPKQFLSVEGKLSMLQNTIKRLASLSTEEPVVICNDRHRFLVAE
RFBM_SALMU      ---SKLIPVIMAGGIGSRLWPLSREEHPKQFLSVDGELSMLQNTIKRLTPLLAGEPLVICNDSHRFLVAE
XANB_XANCB      -------PIILSGGSGTRLWPLSRETYPKQFLPLVGEHSMLQATWLRSXXXXXXXXXXXXNEEHRFMAAE
XANB_XANCP      -------PIILSGGSGTRLWPLSRESYPKQFLPLVGEHSMLQATWLRSXXXXXXXXXXXXNEEHRFMAAE
RFBA_VIBCH      -------PVIMAGGSGSRLWPLSRSAFPKQFLSLDSSSTMLQATIERLQGLPIAEPIVISNEDHRFIVAE
ALGA_PSEAE      -----MIPVILSGGSGSRLWPLSRKQYPKQFLALTGDDTLFQQTIKRLAFDGMQAPLLVCNKEHRFIVQE
ALGA_PSESM      -----MIPVILSGGSGSRLWPLSRKQFPKQFLALTGEHTLFQQTLQRLVFEGMQEPIVVCNKDHRFIVNE
ALGA_PSEPK      -----MIPVILSGGSGSRLWPLSRKQFPKQFLALTGEHTLFQQTIERLVFEGMDTPIVVCNKDHKFIVQE
MANC7_ECOLX     -----LIPVILSGGNGTRLWPLSREEYPKQFLKLTDSISMLQSTISRLDSLNTSSPVVICNELHRFIVAE
ALGA_PSEFL      -----MIPVILSGGSGSRLWPLSRKQFPKQFLALTGEHTLFQQTLERLVFEGMDTPIVVCNKDHRFIVNE
NOEJ_RHISN      ----KIIPAIMAGGRGTRLWPLSRATAAKQFLKLIGEETLFQDTLKRVSDAKVYAPLVITNEEFRFLVAE
Y1618_METJA     ----------------------------------------------------------------------
TCMJ_STRGA      ----------------------------------------------------------------------
SC160_YEAST     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QLRQLNKLTENIILEPAGRNTXXXXXXXXXXXTRQHTDCDPLMLVLAADHAIANEEAFRDAVRGAMPYAD
MANC_SALTY      QLRQLNKLTENIILEPAGRNTXXXXXXXXXXXTRQHTDCDPLMLVLAADHAIANEEAFRDAVRGAMPYAD
MANC1_ECO57     QLRQLNKLTENIILEPAGRNTXXXXXXXXXXXKRHSPENDPLMLVLAADHVIADEDAFRAAVRNAMPYAE
MANC_ECOLI      QLRQLNKLTENIILEPAGRNTXXXXXXXXXXXKRHSPESDPLMLVLAADHVIADEDAFRAAVRNAMPYAE
MANC_SALMO      QLKELSKSSGDIILEPVGRNTAPXXXXXXXXXXXXXXXXXXXXX----DHIIKDEETFCKTIQDARKYAE
MANC9_ECOLX     QLRQLNKLSSNIILEPVGRNTXXXXXXXXXXXTR-HGD-DPLMLVLAADHIINNQPVFHDAIRVAEQYAD
MANC_KLEPN      QLRQLNKLSNNIILEPVGRNTXXXXXXXXXXXTR-HGD-DPLMLVLAADHIINNQPVFHDAIRVAEQYAD
MANC2_ECO57     QLREINKLNGNIILEPCGRNTAPAIAISAFHALKRNPQEDPLLLVLAADHVIAKESVFCDAIKNATPIAN
RFBM_SALTY      QLREIDKLANNIILEPVGRNTXXXXXXXXXXXXXXXDNADPLLLVLAADHVIQDEIAFTKAVRHAEEYAA
RFBM_SALMU      QLRAINKLANNIILEPVGRNTAPAIALAAFCSLQNVVDEDPLLLVLAADHVIRDEKVFLKAINHAEFFAT
XANB_XANCB      QLQQLGVKPSAILLEPKGRNTAPAIAVAALEATRNGGD--PLLLVLPSDHVIRDXXXXXXXXXXXXXXXX
XANB_XANCP      QLQQLGVKPSAILLEPKGRNTAPAIAVAALEATRNGGD--PLLLVLPSDHVIRDXXXXXXXXXXXXXXXX
RFBA_VIBCH      QIRRYGKKSR-IILEPAGRNXXXXXXXXXXXXXEQEDD--PVLLVLAADHFVKNKSXXXXXXXXXXXXXX
ALGA_PSEAE      QLEAQNLASQAILLEPFGRNTAPAVAIAAMKLVAEGRD--ELLLILPADHVIEDQRAFQQALALATNAAE
ALGA_PSESM      QLAALNLETQAILMEPFGRNTAPAVALTAMKLVNEGND--GLMLVLPADHVIEDQKALQRALALATVTAE
ALGA_PSEPK      QLAALKLETQGILMEPFGRNTAPAVAMAAMKLVNEGRD--ELMLVLPADHVIDDQKALQRALALATVAAE
MANC7_ECOLX     QLRHLNKLDNNIILEPSGRNTAPAICIAALILKMKHPNENPLMLVLPADHSVKKVKTFCNTIKSAIPFAE
ALGA_PSEFL      QLANRKLECQRILMEPFGRNTAPAVALTAMMLVNEGRD--ELMLVLPADHVIDDQKALQRALALATVAAE
NOEJ_RHISN      QARELGVTLSSIVLEPVPRNTXXXXXXXXXXXXDRFGE-DALLLVLPSDHAITVDDTYKKCVRSACIAAA
Y1618_METJA     ----------------------------------------------------------------------
TCMJ_STRGA      ----------------------------------------------------------------------
SC160_YEAST     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AGKLVTFGIVPDLPETGYGYIRRGDVVPGATDAVAFEVAQFVEKPGLETAQAYVASGDYYWNSGMFLFRA
MANC_SALTY      AGKLVTFGIVPDLPETGYGYIRRGDVVPGATDAVAFEVAQFVEKPGLETAQAYVASGDYYWNSGMFLFRA
MANC1_ECO57     AGKLVTFGIVPDLPETGYGYIRRGEVSAGEQDTVAFEVAQFVEKPNLETAQAYVASGEYYWNSGMFLFRA
MANC_ECOLI      AGKLVTFGIVPDLPETGYGYIRRGEVSAGEQDMVAFEVAQFVEKPNLETAQAYVASGEYYWNSGMFLFRA
MANC_SALMO      AGKLVTFGIVPTMPETGYGYIRRGQALFSAENSLAFRVAEFVEKPNLETAQSYLDSGEYYWNSGMFLFRA
MANC9_ECOLX     EGHLVTFGIVPNAPETGYGYIQRGVAVTDSAHT-PYQVARFVEKPDRERAGAYLASGEYYWNSGMFMFRA
MANC_KLEPN      EGHLVTFGIVPNAPETGYGYIQRGVALTDSAHT-PYQVARFVEKPDRERAEAYLASGEYYWNSGMFMFRA
MANC2_ECO57     QGKIVTFGIIPEYAETGYGYIERGELLQGHENTGFYYVNKFVEKPNRETAELYMTSGNHYWNSGIFMFKA
RFBM_SALTY      NGKLVTFGIVPTHAETGYGYIRRGELIGND----AYAVAEFVEKPDIDTAGDYFKSGKYYWNSGMFLFRA
RFBM_SALMU      QGKLVTFGIVPTQAETGYGYICRGEAI----GEDAFSVAEFVEKPDFDTARHYVESEKYYWNSGMFLFRA
XANB_XANCB      XGKLVTFGIKPTAPETGYGYIKAG----AGTGATAVE--RFVEKPDLATAQGYLASGEYYWNSGMFLFRA
XANB_XANCP      XGKLVTFGIKPTAPETGYGYIKAG-VGTGAT-----AVERFVEKPDLATAQGYLASGEYYWNSGMFLFRA
RFBA_VIBCH      XGKLATFGIVPTTPETGYGYIHRGEEVTQGT----YEINSFVEKPQLNIAEQYLASGEYYWNSGCFMFKA
ALGA_PSEAE      KGEMVLFGIPASRPETGYGYIR------ASADAQLPEVQSFVEKPDEARAREFVAAGGYYWNSGMFLFRA
ALGA_PSESM      RGEMVLFGVPANKPETGYGYIK------STADALLPEVSQFVEKPDEKRAKEFVEAGGYYWNSGMFLFRA
ALGA_PSEPK      RGEMVLFGVPATKPETGYGYIRSSQLLP---EGVA-RVAQFVEKPDEKRAAEFVQAGGYFWNSGMFLFRA
MANC7_ECOLX     AGNLVSFGIKPTHPETGYGYIQKGKVLSDSDIYEVSEVRTFVEKPNLKTAESFIEKDEYYWNSGMYLFSV
ALGA_PSEFL      RGEMVLFGVPATRPETGYGYIKNDSLLPEGVS----RVQQFVEKPDEKRAVEFVKSGGYFWNSGMFLFRA
NOEJ_RHISN      EGKLVTFGIQPTWPATGYGYIERGTYLGKDVHAVQC----FVEKPSLEKAAALLETGNYYWNSGMFLFQA
Y1618_METJA     ----------------------------------------------------------------------
TCMJ_STRGA      ----------------------------------------------------------------------
SC160_YEAST     -----------------------------------------------ESSVAFVQFGDYYPNDNSILLVA


                         .         .         .         +         .         .         .:280
query           GRYLEELKKFRPDILAACEQAMRGVDPDLDFIRVDEEAFLACPEESIDYAVMERTADAVVMPMDAGWSDV
MANC_SALTY      GRYLEELKKFRPDILAACEQAMRGVDPDLDFIRVDEEAFLACPEESIDYAVMERTADAVVMPMDAGWSDV
MANC1_ECO57     GRYLEELKKYRPDILDACEKAMSAVDPDLDFIRVDEDAFLACPEESVDYAVMERTADAVVVPMDAGWSDV
MANC_ECOLI      GRYLEELKKYRPDILDACEKAMSAVDPDLNFIRVDEEAFLACPEESVDYAVMERTADAVVVPMDAGWSDV
MANC_SALMO      DRYIEELK-IRPDIYKACSLAMESAVTDLDFIRVDEDSFCACPDESIDYAVMEKTNDAVVVPLNAGWSDV
MANC9_ECOLX     KKYLSELAKFRPDILEACQAAVNAADNGSDFISIPHDIFCECPDESVDYAVMEKTADAVVVGLDADWSDV
MANC_KLEPN      KKYLSELAKFRPDILEACQAAVNAADNGSDFISIPHDIFCECPDESVDYAVMEKTADAVVVGLDADWSDV
MANC2_ECO57     SVYLEELRKFRPDIYNVCEQVASSSYIDLDFIRLSKEQFQDCPAESIDFAVMEKTEKCVVCPVDIGWSDV
RFBM_SALTY      SSYLNELKYLSPEIYKACEKAVGHINPDLDFIRIDKEEFMSCPSDSIDYAVMEHTQHAVVIPMSAGWSDV
RFBM_SALMU      SSYLQELKDLSPDIYQACENAVGSINPDLDFIRIDKEAFAMCPSDSIDYAVMEHTRHAVVVPMNAGWSDV
XANB_XANCB      SRYLEELRKFQPAIADACQKAWEGGKRDADFTRLDKDAFASSPSDSIDYAVMEKTADAVVVPLDAGWNDV
XANB_XANCP      SRYLEELRKFQPAIADACQKAWEGGKRDADFTRLDKDAFASSPSDSIDYAVMEKTADAVVVPLDAGWNDV
RFBA_VIBCH      SVFLNELKQHSPEIYRQCELAMQGLSHDYDFIRVGVEEFLKCPDDSIDYAVMEHTKLGVVVSMDAGWSDV
ALGA_PSEAE      SRYLEELKKHDADIYDTCLLALERSQHDGDLVNIDAATFECCPDNSIDYAVMEKTSRACVVPLSAGWNDV
ALGA_PSESM      SRFLEELKKHDPDIYDTCLLTLERSVQDGDALEIDASTFACCPDNSIDYAVMEKTQRACVVPLSAGWSDV
ALGA_PSEPK      SRFLEELKKHDGDIYDTCVLALERSQEDGDVLSIDEATFACCPDNSIDYAVMEKTQRACVVPMSAGWSDV
MANC7_ECOLX     ERYLQELSLYRPDIVKVCQETVKNIHYDMDFIRLDDKIFRNCPQESIDYAVMEKTKDAVVATMDIGWNDV
ALGA_PSEFL      SRFLEELKKHDPDIYDTCVLTLERSEQTADTVTLDDATFACCPDNSIDYAVMEKTQRACVVPLSAGWSDV
NOEJ_RHISN      ASIIAELEEHAPDVLSAVHAAVRGSTVDADFIRLAPESFSQAPSISIDYALMEKTANAAVVCSDFAWSDL
Y1618_METJA     ----------------------------------------------------------------------
TCMJ_STRGA      ----------------------------------------------------------------------
SC160_YEAST     ---LTEDEDFKPSI-EEIQASLNKANESLNSLRTKQNNM-----ETKTYEFSEEVQDSLFKPSSATWEDI


                         .         *         .         .         .         .         +:350
query           GSWSSLWEISAHTPEGNVHHGDVISHKTENSYVYAESXXXXXXXXXXXXXXQTKDAVLIADRHAVQDVKK
MANC_SALTY      GSWSSLWEISAHTPEGNVHHGDVISHKTENSYVYAESXXXXXXXXXXXXXXQTKDAVLIADRHAVQDVKK
MANC1_ECO57     GSWSSLWEISAHTAEGNVCHGDVINHKTENSYVYAESXXXXXXXXXXXXXXQTKDAVLIADRNAVQDVKK
MANC_ECOLI      GSWSSLWEISAHTAEGNVCHGDVINHKTENSYVYAESXXXXXXXXXXXXXXQTKDAVLIADRNAVQDVKK
MANC_SALMO      GSWSSLWEISDKDSNGNVTKGDVLSHNADNCYLHAETGLVTAVGVKDLIVVQTKDAVLVANTNCVQDVKK
MANC9_ECOLX     GSWSALWEVSPKDGQGNVLSGDAWVHNSENCYINSDEKLVAAIGVENLVIVSTKDAVLVMNRERSQDVKK
MANC_KLEPN      GSWSALWEVSPKDEQGNVLSGDAWVHNSENCYINSDEKLVAAIGVENLVIVSTKDAVLVMNRERSQDVKK
MANC2_ECO57     GSWQSLWDISLKSKTGDVCKGDILTYDTKNNYIYSESALVAAIGIEDMVIVQTKDAVLVSKKSDVQHVKK
RFBM_SALTY      GSWSSLWDISNKDHQRNVLKGDIFAHACNDNYIYSEDMFISAIGVSNLVIVQTTDALLVANKDTVQDVKK
RFBM_SALMU      GSWSSLWDISKKDPQRNVLHGDIFAYNSKDNYIYSEKSFISTIGVNNLVIVQTADALLXXXXXXXXXXXX
XANB_XANCB      GSWSSLLDVSEQDGQGNAHHGDVIQLDCKNTYAYG-SRLIAMVGLENXXXXXXXXXXXXGHRDRIQEVKE
XANB_XANCP      GSWSSLLDVSEQDGQGNAHHGDVIQLDCKNTYAYG-SRLIAMVGLENXXXXXXXXXXXXGHRDRIQEVKE
RFBA_VIBCH      GSWSALWEVSDKDADGNVCQGDAILSGTSNCYIYAPNKLVAAVGLKDIVVVETKDAVLVADKNQVQEVKK
ALGA_PSEAE      GSWSSIWDVHAKDANGNVTKGDVLVHDSHNCLVHGNGKLVSVIGLEDIVVVETKDAMMIAHKDRVQDVKH
ALGA_PSESM      GCWSSLWEVNAKDAHGNVTKGDVVIQDSRNCMIHGNGKLVSVIGLDNIVVVETKDAMMIAHKDKVQGVKQ
ALGA_PSEPK      GCWSSLWEVHEKDDNGNVTKGDVVVQDSRNCMIHGNGKLVSVIGLENIVVVETKDAMMIAHKDKVQGVKQ
MANC7_ECOLX     GAWSSLWELGKKDSSGNVITGDIVCHETENSYIYTESGLVATIGIQDLVIIHTKDSLLVSRRDSVQNVKN
ALGA_PSEFL      GCWASLWAVNDKDIHGNVSKGDVVIQDSRNCMIHGNGKLVSVIGLDNIVVVETKDAMMIAHKDKVQGVKQ
NOEJ_RHISN      GSWDAVWKNEEQNADGNVLKGNVTACNTKNSLVLSHTAHLAVQGMDGVAVIASEDAVFVGRLEEAHEIGN
Y1618_METJA     -------------------------------------------------------------------IKT
TCMJ_STRGA      ----------------------------------------------------------------------
SC160_YEAST     SEQEGHLQIKLHTPEEN-----------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VVEKIKADGRHEHHMHREVYRPWGKYDSIDAGERYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTARVT
MANC_SALTY      VVEKIKADGRHEHHMHREVYRPWGKYDSIDAGERYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTARVT
MANC1_ECO57     VVEQIKADGXXXXXXXXXXYRPWGKYDSIDAGDRYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTAKVT
MANC_ECOLI      VVEQIKADGXXXXXXXXXXYRPWGKYDSIDAGDRYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTAKVT
MANC_SALMO      IVEKIKLENRHEHITHREVYRPWGKYDSIDFGERYQVKRITVKPGEGISEQQHYHRAEHWIIVAGTAKIT
MANC9_ECOLX     AVEFLKQNQRTEYKRHREIYRPWGRCDVVVQTPRFNVNRITVKPGGAFSMQMHHHRAEHWVILAGTGQVT
MANC_KLEPN      AVEFLKQNQRSEYKRHREIYRPWGRCDVVVQTPRFNVNRITVKPGGAFSMQMHHHRAEHWVILAGTGQVT
MANC2_ECO57     IVEMLKLQQRTEYISHREVFRPWGKFDSIDQGERYKVKKIIVKPGEGLSLRMHHHRSEHWIVLSGTAKVT
RFBM_SALTY      IVDYLKRNDRNEYKQHQEVFRPWGKYNVIDSGKNYLVRCITVKPGEKFVAQMHHHRAEHWIVLSGTARVT
RFBM_SALMU      XXXYLKANNRNEHKKHLEVFRPWGKFSVIHSGDNYLVKRITVKPGAKFAAQMHLHRAEHWIVVSGTACIT
XANB_XANCB      VVSQIKSAGRSEATWHRKVYRPWGAYDSIDMGQRFQVKRITVKPGATLSLQMHHHRAEHWIVVSGTAEVT
XANB_XANCP      VVSQIKSAGRSEATWHRKVYRPWGAYDSIDMGQRFQVKRITVKPGATLSLQMHHHRAEHWIVVSGTAEVT
RFBA_VIBCH      IVEHLKXXXXXXXXXXXXXXXPWGKSDAIDKGERYKVNRITVEPGKKQSLQMHYHRAEHWVVVSGTAKVT
ALGA_PSEAE      VVKDLDAQGRSETQNHCEVYRPWGSYDSVDMGGRFQVKHITVKPGARLSLQMHHHRAEHWIVVSGTAQVT
ALGA_PSESM      MVATLNEQGRTETQNHLEVYRPWGSYDSVDMGGRFQVKRISVKPGACLSLQMHHHRAEHWIVVSGTAQVT
ALGA_PSEPK      MVKTLDEQGRTETQNHLEVYRPWGSYDSVDMGGRFQVKHITVKPGASLSLQMHHHRAEHWIVVSGTAEVT
MANC7_ECOLX     IVQHLDLSGRKEHKEHREVFKSWGRCDSIDSSEKYQVKRITVNPSENYRCNYIITVRNIGVVVMGIAKLT
ALGA_PSEFL      MVSTLNDQGRSETQNHCEVYRPWGSYDSVDMGGRFQVKHISVKPGACLSLQMHHHRAEHWIVVSGTAEVT
NOEJ_RHISN      LVKRLAADENTARELHPTLIRPWGGYTTMLNGDRFQVRRLFVRPGKMLSLHKHFHRSEHWICVKGTAEVT
Y1618_METJA     EYDKIKPYITKDGSIIRELLHP-----NIYKGVKQSLAEAIVPVGSKTLLHKHYTSEEIYYILEGRGLMT
TCMJ_STRGA      ---------------------------------------IELAPGESVTEHYHPFSDKYLYLIEGSLVVR
SC160_YEAST     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           INGEVKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFEDRYGRI
MANC_SALTY      INGEVKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFEDRYGRV
MANC1_ECO57     IDGDIKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFADRYGRV
MANC_ECOLI      IDGDIKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFADRYGRV
MANC_SALMO      IKGEVKILTENESVYIPVGVKHCLENPGKIALELIEVRSGAYLGEDDIVRFSDKYGR-
MANC9_ECOLX     VNGKQFLLSENQSTFIPIGAEHCLENPGCIPLEVLEIQSGSYLGEDDIIRIKDQYGR-
MANC_KLEPN      VNGKQFLLTENQSTFIPIGAEHSLENPGRIPLEVLEIQSGSYLGEDDIIRIKDQYGR-
MANC2_ECO57     LGDKTKLVTANESIYIPLGAAYSLENPGIIPLNLIEVSSGDYLGEDDIIRQKERY---
RFBM_SALTY      KGEQTYMVSENESTFIPPNTIHALENPGMTPLKLIEIQSGTYLGEDDIIRLEQRSG--
RFBM_SALMU      KGEEIFTISENESTFIPANTVHTLKNPATIPLELIEIQSGTYLAEDDIIRLEKHSG--
XANB_XANCB      RGDEVLLLTENQSTYIPLGVTHRLKNPGKLPLELIEVQSGSYLGEDDIVRFEDTYGR-
XANB_XANCP      RGEEVLLLTENQSTYIPLGVTHRLKNPGKLPLELIEVQSGSYLGEDDIVRFEDTYGR-
RFBA_VIBCH      CEGNVKVITENQSLYIPIGTNHMIENPGKIPLELIEIQSGSYLNEDDVVRFEDK----
ALGA_PSEAE      CDDKTFLLTENQSTYIPIASVHRLANPGKIPLEIIEVQSGSYLGEDDIERLEDVYGR-
ALGA_PSESM      CDENVFLLTENQSTYIPIASVHRLRNPGKIPLEIIEVQSGSYLGEDDIERFEDIYGR-
ALGA_PSEPK      CDENVFLLTENQSTYIPIASVHRLRNPGKIPLEIIEVQSGSYLGEDDIERFEDVYGR-
MANC7_ECOLX     VAEEIKILKENESVYIPAGIKHSLK---------------------------------
ALGA_PSEFL      CDENVFLLTENQSTYIPIASVHRLRNPGKIPLEIIEVQSGSYLGEDDIERFEDIYGR-
NOEJ_RHISN      IEDRVTILHENQSIYIPEGAIHRLGNPGKIMLELVEIQTGAYLGEDDIIRVAD-----
Y1618_METJA     LDNEKFEVKKGDTIYIPPKTPHKIENIGNVPLKILCCSYPPYSHED------------
TCMJ_STRGA      VNGEEVRLERDEALFVTRGQRHRIENRGNVPARVV-----------------------
SC160_YEAST     ----------------------------------------------------------