[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF70471.1

[Show Plain Result]


## Summary of Sequence Search
    1::94
    1::94      9e-50 100%   94 aa  RL25_SALTY RecName: Full=50S ribosomal protein L25;
    1::94      9e-50 100%   94 aa  RL25_SALTI RecName: Full=50S ribosomal protein L25;
    1::94      9e-50 100%   94 aa  RL25_SALSV RecName: Full=50S ribosomal protein L25;
    1::94      9e-50 100%   94 aa  RL25_SALPK RecName: Full=50S ribosomal protein L25;
    1::94      9e-50 100%   94 aa  RL25_SALPC RecName: Full=50S ribosomal protein L25;
    1::94      9e-50 100%   94 aa  RL25_SALPB RecName: Full=50S ribosomal protein L25;
    1::94      9e-50 100%   94 aa  RL25_SALPA RecName: Full=50S ribosomal protein L25;
    1::94      9e-50 100%   94 aa  RL25_SALNS RecName: Full=50S ribosomal protein L25;
    1::94      9e-50 100%   94 aa  RL25_SALHS RecName: Full=50S ribosomal protein L25;
    1::94      9e-50 100%   94 aa  RL25_SALEP RecName: Full=50S ribosomal protein L25;
    1::94      9e-50 100%   94 aa  RL25_SALDC RecName: Full=50S ribosomal protein L25;
    1::94      9e-50 100%   94 aa  RL25_SALCH RecName: Full=50S ribosomal protein L25;
    1::94      9e-50 100%   94 aa  RL25_SALA4 RecName: Full=50S ribosomal protein L25;
    1::94      3e-49  99%   94 aa  RL25_SALG2 RecName: Full=50S ribosomal protein L25;
    1::94      1e-48  97%   94 aa  RL25_SALAR RecName: Full=50S ribosomal protein L25;
    1::94      1e-48  97%   94 aa  RL25_CITK8 RecName: Full=50S ribosomal protein L25;
    1::94      3e-46  91%   94 aa  RL25_SHISS RecName: Full=50S ribosomal protein L25;
    1::94      3e-46  91%   94 aa  RL25_SHIFL RecName: Full=50S ribosomal protein L25;
    1::94      3e-46  91%   94 aa  RL25_SHIDS RecName: Full=50S ribosomal protein L25;
    1::94      3e-46  91%   94 aa  RL25_ECOSE RecName: Full=50S ribosomal protein L25;
    1::94      3e-46  91%   94 aa  RL25_ECOLI RecName: Full=50S ribosomal protein L25;
    1::94      3e-46  91%   94 aa  RL25_ECOLC RecName: Full=50S ribosomal protein L25;
    1::94      3e-46  91%   94 aa  RL25_ECOHS RecName: Full=50S ribosomal protein L25;
    1::94      3e-46  91%   94 aa  RL25_ECODH RecName: Full=50S ribosomal protein L25;
    1::94      3e-46  91%   94 aa  RL25_ECOBW RecName: Full=50S ribosomal protein L25;
    1::94      3e-46  91%   94 aa  RL25_ECO8A RecName: Full=50S ribosomal protein L25;
    1::94      3e-46  91%   94 aa  RL25_ECO55 RecName: Full=50S ribosomal protein L25;
    1::94      3e-46  91%   94 aa  RL25_ECO24 RecName: Full=50S ribosomal protein L25;
    1::94      8e-46  90%   94 aa  RL25_SHIB3 RecName: Full=50S ribosomal protein L25;
    1::94      8e-46  90%   94 aa  RL25_ECO5E RecName: Full=50S ribosomal protein L25;
    1::94      8e-46  90%   94 aa  RL25_ECO57 RecName: Full=50S ribosomal protein L25;
    1::94      1e-45  90%   94 aa  RL25_SHIBS RecName: Full=50S ribosomal protein L25;
    1::94      1e-45  89%   94 aa  RL25_ECOSM RecName: Full=50S ribosomal protein L25;
    1::94      1e-45  89%   94 aa  RL25_ECOLU RecName: Full=50S ribosomal protein L25;
    1::94      1e-45  89%   94 aa  RL25_ECOL6 RecName: Full=50S ribosomal protein L25;
    1::94      1e-45  89%   94 aa  RL25_ECOL5 RecName: Full=50S ribosomal protein L25;
    1::94      1e-45  89%   94 aa  RL25_ECO81 RecName: Full=50S ribosomal protein L25;
    1::94      1e-45  89%   94 aa  RL25_ECO7I RecName: Full=50S ribosomal protein L25;
    1::94      1e-45  89%   94 aa  RL25_ECO45 RecName: Full=50S ribosomal protein L25;
    1::94      1e-45  89%   94 aa  RL25_ECO27 RecName: Full=50S ribosomal protein L25;
    1::94      5e-45  88%   94 aa  RL25_ENTS8 RecName: Full=50S ribosomal protein L25;
    1::94      4e-44  86%   94 aa  RL25_ESCF3 RecName: Full=50S ribosomal protein L25;
    1::94      1e-43  86%   94 aa  RL25_KLEP3 RecName: Full=50S ribosomal protein L25;
    1::94      2e-41  80%   94 aa  RL25_PHOLL RecName: Full=50S ribosomal protein L25;
    1::94      5e-41  82%   94 aa  RL25_ERWT9 RecName: Full=50S ribosomal protein L25;
    1::93      5e-40  77%   94 aa  RL25_SERP5 RecName: Full=50S ribosomal protein L25;
    1::94      6e-39  76%   94 aa  RL25_SODGM RecName: Full=50S ribosomal protein L25;
    1::94      1e-38  77%   94 aa  RL25_ENT38 RecName: Full=50S ribosomal protein L25;
    1::94      1e-38  76%   94 aa  RL25_EDWI9 RecName: Full=50S ribosomal protein L25;
    1::94      2e-38  80%   94 aa  RL25_KLEP7 RecName: Full=50S ribosomal protein L25;
    1::93      8e-38  76%   94 aa  RL25_YERPY RecName: Full=50S ribosomal protein L25;
    1::93      8e-38  76%   94 aa  RL25_YERPS RecName: Full=50S ribosomal protein L25;
    1::93      8e-38  76%   94 aa  RL25_YERPP RecName: Full=50S ribosomal protein L25;
    1::93      8e-38  76%   94 aa  RL25_YERPN RecName: Full=50S ribosomal protein L25;
    1::93      8e-38  76%   94 aa  RL25_YERPG RecName: Full=50S ribosomal protein L25;
    1::93      8e-38  76%   94 aa  RL25_YERPE RecName: Full=50S ribosomal protein L25;
    1::93      8e-38  76%   94 aa  RL25_YERPB RecName: Full=50S ribosomal protein L25;
    1::93      8e-38  76%   94 aa  RL25_YERPA RecName: Full=50S ribosomal protein L25;
    1::93      8e-38  76%   94 aa  RL25_YERP3 RecName: Full=50S ribosomal protein L25;
    1::93      8e-38  75%   94 aa  RL25_PECCP RecName: Full=50S ribosomal protein L25;
    1::94      3e-37  70%   94 aa  RL25_PROMH RecName: Full=50S ribosomal protein L25;
    1::93      1e-36  73%   94 aa  RL25_ERWCT RecName: Full=50S ribosomal protein L25;
    1::94      2e-36  77%   95 aa  RL25_YERE8 RecName: Full=50S ribosomal protein L25;
    3::95      3e-32  66%   95 aa  RL25_ACTSZ RecName: Full=50S ribosomal protein L25;
    3::95      4e-32  67%   95 aa  RL25_HAEIN RecName: Full=50S ribosomal protein L25;
    1::93      5e-32  65%   94 aa  RL25_PASMU RecName: Full=50S ribosomal protein L25;
    3::95      1e-31  66%   95 aa  RL25_HAEIG RecName: Full=50S ribosomal protein L25;
    3::95      1e-31  66%   95 aa  RL25_HAEIE RecName: Full=50S ribosomal protein L25;
    3::95      1e-31  66%   95 aa  RL25_HAEI8 RecName: Full=50S ribosomal protein L25;
    3::95      1e-30  63%   95 aa  RL25_MANSM RecName: Full=50S ribosomal protein L25;
    3::94      2e-30  61%   95 aa  RL25_HAES2 RecName: Full=50S ribosomal protein L25;
    3::94      2e-30  61%   95 aa  RL25_HAES1 RecName: Full=50S ribosomal protein L25;
    3::95      8e-30  61%   95 aa  RL25_TOLAT RecName: Full=50S ribosomal protein L25;
    5::91      1e-29  67%   92 aa  RL25_PASPI RecName: Full=50S ribosomal protein L25;
    5::91      2e-29  67%   92 aa  RL25_VIBF1 RecName: Full=50S ribosomal protein L25;
    3::95      3e-29  63%   95 aa  RL25_ACTPJ RecName: Full=50S ribosomal protein L25;
    3::95      3e-29  63%   95 aa  RL25_ACTP7 RecName: Full=50S ribosomal protein L25;
    5::91      7e-29  66%   92 aa  RL25_VIBFM RecName: Full=50S ribosomal protein L25;
    5::91      7e-29  67%   92 aa  RL25_ALISL RecName: Full=50S ribosomal protein L25;
    3::95      9e-29  57%   95 aa  RL25_SHEB9 RecName: Full=50S ribosomal protein L25;
    3::95      9e-29  57%   95 aa  RL25_SHEB8 RecName: Full=50S ribosomal protein L25;
    3::95      9e-29  57%   95 aa  RL25_SHEB5 RecName: Full=50S ribosomal protein L25;
    3::95      9e-29  57%   95 aa  RL25_SHEB2 RecName: Full=50S ribosomal protein L25;
    3::94      9e-29  63%   95 aa  RL25_ACTP2 RecName: Full=50S ribosomal protein L25;
    5::91      2e-28  62%   92 aa  RL25_VIBVY RecName: Full=50S ribosomal protein L25;
    5::91      2e-28  62%   92 aa  RL25_VIBVU RecName: Full=50S ribosomal protein L25;
    3::92      2e-28  59%   95 aa  RL25_SHESH RecName: Full=50S ribosomal protein L25;
    3::95      3e-28  55%   95 aa  RL25_SHESR RecName: Full=50S ribosomal protein L25;
    3::95      3e-28  55%   95 aa  RL25_SHESM RecName: Full=50S ribosomal protein L25;
    3::95      3e-28  55%   95 aa  RL25_SHESA RecName: Full=50S ribosomal protein L25;
    5::91      3e-28  67%   92 aa  RL25_VIBSL RecName: Full=50S ribosomal protein L25;
    5::91      3e-28  63%   92 aa  RL25_VIBCM RecName: Full=50S ribosomal protein L25;
    5::91      3e-28  63%   92 aa  RL25_VIBCH RecName: Full=50S ribosomal protein L25;
    5::91      3e-28  63%   92 aa  RL25_VIBC3 RecName: Full=50S ribosomal protein L25;
    3::95      3e-28  56%   95 aa  RL25_SHEON RecName: Full=50S ribosomal protein L25;
    3::95      1e-27  55%   95 aa  RL25_SHEAM RecName: Full=50S ribosomal protein L25;
    3::94      1e-27  62%   95 aa  RL25_HAEPS RecName: Full=50S ribosomal protein L25;
    3::94      1e-27  61%   95 aa  RL25_HAEDU RecName: Full=50S ribosomal protein L25;
    3::93      2e-27  56%   95 aa  RL25_SHEDO RecName: Full=50S ribosomal protein L25;
    3::95      2e-27  54%   95 aa  RL25_SHESW RecName: Full=50S ribosomal protein L25;
    3::95      2e-27  54%   95 aa  RL25_SHEPC RecName: Full=50S ribosomal protein L25;
    4::91      1e-26  62%   92 aa  RL25_PHOPR RecName: Full=50S ribosomal protein L25;
    3::92      2e-26  52%   95 aa  RL25_SHELP RecName: Full=50S ribosomal protein L25;
    5::97      2e-26  57%  210 aa  RL25_ALTMD RecName: Full=50S ribosomal protein L25;AltName:
    3::94      6e-26  57%   95 aa  RL25_AERS4 RecName: Full=50S ribosomal protein L25;
    3::95      7e-26  52%   95 aa  RL25_SHEWM RecName: Full=50S ribosomal protein L25;
    1::92      9e-26  55%   95 aa  RL25_BUCAT RecName: Full=50S ribosomal protein L25;
    1::92      9e-26  55%   95 aa  RL25_BUCAI RecName: Full=50S ribosomal protein L25;
    1::92      9e-26  55%   95 aa  RL25_BUCA5 RecName: Full=50S ribosomal protein L25;
    3::92      2e-25  52%   95 aa  RL25_SHEHH RecName: Full=50S ribosomal protein L25;
    3::92      4e-25  53%   95 aa  RL25_SHEPW RecName: Full=50S ribosomal protein L25;
    6::97      4e-25  55%  221 aa  RL25_IDILO RecName: Full=50S ribosomal protein L25;AltName:
    3::95      6e-25  51%   95 aa  RL25_SHEFN RecName: Full=50S ribosomal protein L25;
    3::92      1e-24  51%   95 aa  RL25_SHEPA RecName: Full=50S ribosomal protein L25;
    1::94      1e-24  48%   96 aa  RL25_BUCAP RecName: Full=50S ribosomal protein L25;
    4::95      5e-24  51%   96 aa  RL25_FRATO RecName: Full=50S ribosomal protein L25;
    4::95      5e-24  51%   96 aa  RL25_FRATH RecName: Full=50S ribosomal protein L25;
    4::95      5e-24  51%   96 aa  RL25_FRATF RecName: Full=50S ribosomal protein L25;
    5::97      1e-23  49%  213 aa  RL25_PSEA6 RecName: Full=50S ribosomal protein L25;AltName:
    4::95      3e-23  50%   96 aa  RL25_FRATW RecName: Full=50S ribosomal protein L25;
    4::95      3e-23  50%   96 aa  RL25_FRATT RecName: Full=50S ribosomal protein L25;
    4::95      3e-23  50%   96 aa  RL25_FRATN RecName: Full=50S ribosomal protein L25;
    4::95      3e-23  50%   96 aa  RL25_FRATM RecName: Full=50S ribosomal protein L25;
    4::95      3e-23  50%   96 aa  RL25_FRAT1 RecName: Full=50S ribosomal protein L25;
    4::96      3e-23  51%  211 aa  RL25_COLP3 RecName: Full=50S ribosomal protein L25;AltName:
    3::94      3e-22  48%  203 aa  RL25_DECAR RecName: Full=50S ribosomal protein L25;AltName:
    5::91      5e-22  56%   92 aa  RL25_VIBPA RecName: Full=50S ribosomal protein L25;
    6::97      6e-22  46%  204 aa  RL25_PSEHT RecName: Full=50S ribosomal protein L25;AltName:
    5::97      1e-21  51%  208 aa  RL25_HAHCH RecName: Full=50S ribosomal protein L25;AltName:
    5::91      2e-21  55%   92 aa  RL25_VIBHB RecName: Full=50S ribosomal protein L25;
    6::96      1e-20  50%  207 aa  RL25_XYLFT RecName: Full=50S ribosomal protein L25;AltName:
    6::96      1e-20  50%  207 aa  RL25_XYLF2 RecName: Full=50S ribosomal protein L25;AltName:
    5::96      1e-20  48%  202 aa  RL25_METCA RecName: Full=50S ribosomal protein L25;AltName:
    6::96      3e-20  50%  207 aa  RL25_XYLFM RecName: Full=50S ribosomal protein L25;AltName:
    6::96      3e-20  50%  208 aa  RL25_XYLFA RecName: Full=50S ribosomal protein L25;AltName:
    5::94      6e-20  47%  228 aa  RL25_NITMU RecName: Full=50S ribosomal protein L25;AltName:
    3::94      8e-20  43%   95 aa  RL25_CHRVO RecName: Full=50S ribosomal protein L25;
    7::96      1e-19  47%  211 aa  RL25_XANOR RecName: Full=50S ribosomal protein L25;AltName:
    7::96      1e-19  47%  211 aa  RL25_XANOM RecName: Full=50S ribosomal protein L25;AltName:
    7::94      1e-19  49%  201 aa  RL25_THIDA RecName: Full=50S ribosomal protein L25;AltName:
    5::96      3e-19  48%  212 aa  RL25_THISH RecName: Full=50S ribosomal protein L25;AltName:
    8::100     3e-19  46%  225 aa  RL25_DICNV RecName: Full=50S ribosomal protein L25;AltName:
    6::96      4e-19  48%  219 aa  RL25_LEGPL RecName: Full=50S ribosomal protein L25;AltName:
    6::96      4e-19  48%  219 aa  RL25_LEGPH RecName: Full=50S ribosomal protein L25;AltName:
    6::96      4e-19  48%  219 aa  RL25_LEGPC RecName: Full=50S ribosomal protein L25;AltName:
    6::96      4e-19  48%  219 aa  RL25_LEGPA RecName: Full=50S ribosomal protein L25;AltName:
    4::93      5e-19  44%  198 aa  RL25_BORA1 RecName: Full=50S ribosomal protein L25;AltName:
    7::96      7e-19  46%  209 aa  RL25_XANCP RecName: Full=50S ribosomal protein L25;AltName:
    7::96      7e-19  46%  209 aa  RL25_XANCB RecName: Full=50S ribosomal protein L25;AltName:
    7::96      7e-19  46%  209 aa  RL25_XANC8 RecName: Full=50S ribosomal protein L25;AltName:
    7::96      7e-19  46%  211 aa  RL25_XANC5 RecName: Full=50S ribosomal protein L25;AltName:
    7::96      7e-19  46%  211 aa  RL25_XANAC RecName: Full=50S ribosomal protein L25;AltName:
    4::97      9e-19  44%  214 aa  RL25_NITOC RecName: Full=50S ribosomal protein L25;AltName:
    4::94      2e-18  47%  222 aa  RL25_RUTMC RecName: Full=50S ribosomal protein L25;AltName:
    5::97      3e-18  43%  203 aa  RL25_CELJU RecName: Full=50S ribosomal protein L25;AltName:
    4::94      4e-18  46%  225 aa  RL25_VESOH RecName: Full=50S ribosomal protein L25;AltName:
    8::92      4e-18  48%  203 aa  RL25_RALME RecName: Full=50S ribosomal protein L25;AltName:
    5::92      4e-18  45%  208 aa  RL25_LEPCP RecName: Full=50S ribosomal protein L25;AltName:
    8::92      4e-18  48%  205 aa  RL25_CUPTR RecName: Full=50S ribosomal protein L25;AltName:
    8::92      6e-18  48%  203 aa  RL25_RALEJ RecName: Full=50S ribosomal protein L25;AltName:
    8::92      6e-18  46%  213 aa  RL25_POLSQ RecName: Full=50S ribosomal protein L25;AltName:
    5::97      7e-18  46%  212 aa  RL25_MARAV RecName: Full=50S ribosomal protein L25;AltName:
    8::92      1e-17  47%  205 aa  RL25_RALEH RecName: Full=50S ribosomal protein L25;AltName:
    5::92      1e-17  48%  214 aa  RL25_JANMA RecName: Full=50S ribosomal protein L25;AltName:
    8::92      1e-17  48%  201 aa  RL25_BURM1 RecName: Full=50S ribosomal protein L25;AltName:
    4::92      1e-17  43%  207 aa  RL25_BORPD RecName: Full=50S ribosomal protein L25;AltName:
    8::92      2e-17  49%  235 aa  RL25_VEREI RecName: Full=50S ribosomal protein L25;AltName:
    1::94      2e-17  46%   97 aa  RL25_BUCBP RecName: Full=50S ribosomal protein L25;
    8::92      2e-17  48%  210 aa  RL25_ACIAC RecName: Full=50S ribosomal protein L25;AltName:
    8::92      2e-17  44%  208 aa  RL25_DIAST RecName: Full=50S ribosomal protein L25;AltName:
    4::96      2e-17  46%  215 aa  RL25_CHRSD RecName: Full=50S ribosomal protein L25;AltName:
    8::92      2e-17  44%  208 aa  RL25_ACISJ RecName: Full=50S ribosomal protein L25;AltName:
    8::92      4e-17  44%  223 aa  RL25_RHOFD RecName: Full=50S ribosomal protein L25;AltName:
    8::92      4e-17  44%  218 aa  RL25_POLNA RecName: Full=50S ribosomal protein L25;AltName:
    8::92      4e-17  47%  201 aa  RL25_BURS3 RecName: Full=50S ribosomal protein L25;AltName:
    8::92      4e-17  47%  202 aa  RL25_BURCM RecName: Full=50S ribosomal protein L25;AltName:
    8::92      4e-17  47%  202 aa  RL25_BURA4 RecName: Full=50S ribosomal protein L25;AltName:
    4::98      4e-17  46%   98 aa  RL25_ACIBT RecName: Full=50S ribosomal protein L25;
    6::99      5e-17  49%  224 aa  RL25_PSYA2 RecName: Full=50S ribosomal protein L25;AltName:
   12::96      5e-17  46%  208 aa  RL25_BURTA RecName: Full=50S ribosomal protein L25;AltName:
   12::96      5e-17  46%  208 aa  RL25_BURPS RecName: Full=50S ribosomal protein L25;AltName:
   12::96      5e-17  46%  208 aa  RL25_BURP1 RecName: Full=50S ribosomal protein L25;AltName:
    8::92      5e-17  46%  204 aa  RL25_BURMS RecName: Full=50S ribosomal protein L25;AltName:
    8::92      5e-17  46%  204 aa  RL25_BURMA RecName: Full=50S ribosomal protein L25;AltName:
    8::92      5e-17  46%  204 aa  RL25_BURM7 RecName: Full=50S ribosomal protein L25;AltName:
    4::98      5e-17  46%   98 aa  RL25_ACIB5 RecName: Full=50S ribosomal protein L25;
    4::98      5e-17  46%   98 aa  RL25_ACIB3 RecName: Full=50S ribosomal protein L25;
    8::91      6e-17  44%  214 aa  RL25_METPP RecName: Full=50S ribosomal protein L25;AltName:
    8::92      6e-17  46%  204 aa  RL25_BURP6 RecName: Full=50S ribosomal protein L25;AltName:
    5::94      8e-17  39%  203 aa  RL25_PSYIN RecName: Full=50S ribosomal protein L25;AltName:
    8::92      8e-17  46%  201 aa  RL25_BURCH RecName: Full=50S ribosomal protein L25;AltName:
    8::92      8e-17  46%  201 aa  RL25_BURCC RecName: Full=50S ribosomal protein L25;AltName:
    8::92      8e-17  46%  201 aa  RL25_BURCA RecName: Full=50S ribosomal protein L25;AltName:
    4::95      1e-16  41%  200 aa  RL25_PSEFS RecName: Full=50S ribosomal protein L25;AltName:
    5::92      1e-16  45%  210 aa  RL25_HERAR RecName: Full=50S ribosomal protein L25;AltName:
    4::95      1e-16  39%   96 aa  RL25_FRAP2 RecName: Full=50S ribosomal protein L25;
    6::99      2e-16  48%  224 aa  RL25_PSYCK RecName: Full=50S ribosomal protein L25;AltName:
    4::96      2e-16  47%  205 aa  RL25_PSEU5 RecName: Full=50S ribosomal protein L25;AltName:
    8::92      2e-16  44%  227 aa  RL25_POLSJ RecName: Full=50S ribosomal protein L25;AltName:
    8::92      2e-16  44%  214 aa  RL25_POLNS RecName: Full=50S ribosomal protein L25;AltName:
    8::92      2e-16  44%  201 aa  RL25_BURVG RecName: Full=50S ribosomal protein L25;AltName:
    5::94      3e-16  40%  198 aa  RL25_NITEU RecName: Full=50S ribosomal protein L25;AltName:
    8::92      3e-16  44%  209 aa  RL25_DELAS RecName: Full=50S ribosomal protein L25;AltName:
    5::99      4e-16  42%  224 aa  RL25_PSYWF RecName: Full=50S ribosomal protein L25;AltName:
    4::95      4e-16  40%  198 aa  RL25_PSEPW RecName: Full=50S ribosomal protein L25;AltName:
    4::93      5e-16  40%  204 aa  RL25_BORPA RecName: Full=50S ribosomal protein L25;AltName:
    4::93      5e-16  40%  204 aa  RL25_BORBR RecName: Full=50S ribosomal protein L25;AltName:
    8::92      7e-16  44%  224 aa  RL25_VARPS RecName: Full=50S ribosomal protein L25;AltName:
    8::92      7e-16  46%  206 aa  RL25_RALSO RecName: Full=50S ribosomal protein L25;AltName:
    4::95      7e-16  40%  197 aa  RL25_PSEPK RecName: Full=50S ribosomal protein L25;AltName:
    4::95      9e-16  40%  197 aa  RL25_PSEPG RecName: Full=50S ribosomal protein L25;AltName:
    8::97      1e-15  40%  208 aa  RL25_BORPE RecName: Full=50S ribosomal protein L25;AltName:
    8::92      2e-15  45%  208 aa  RL25_RALPJ RecName: Full=50S ribosomal protein L25;AltName:
    7::94      2e-15  42%  201 aa  RL25_AZOSE RecName: Full=50S ribosomal protein L25;AltName:
    3::92      3e-15  38%  190 aa  RL25_NEIMF RecName: Full=50S ribosomal protein L25;AltName:
    3::92      3e-15  38%  190 aa  RL25_NEIMB RecName: Full=50S ribosomal protein L25;AltName:
    3::92      3e-15  38%  190 aa  RL25_NEIMA RecName: Full=50S ribosomal protein L25;AltName:
    3::92      3e-15  38%  190 aa  RL25_NEIM0 RecName: Full=50S ribosomal protein L25;AltName:
    3::92      3e-15  38%  190 aa  RL25_NEIG2 RecName: Full=50S ribosomal protein L25;AltName:
    3::92      3e-15  38%  190 aa  RL25_NEIG1 RecName: Full=50S ribosomal protein L25;AltName:
    4::95      3e-15  38%  192 aa  RL25_MARMS RecName: Full=50S ribosomal protein L25;AltName:
    7::95      4e-15  38%  203 aa  RL25_RICFE RecName: Full=50S ribosomal protein L25;AltName:
    4::96      4e-15  41%  204 aa  RL25_PSEA7 RecName: Full=50S ribosomal protein L25;AltName:
    4::96      4e-15  42%  198 aa  RL25_AZOVD RecName: Full=50S ribosomal protein L25;AltName:
    6::96      6e-15  36%  212 aa  RL25_SPHAL RecName: Full=50S ribosomal protein L25;AltName:
    7::95      6e-15  37%  204 aa  RL25_RICCK RecName: Full=50S ribosomal protein L25;AltName:
    4::95      6e-15  38%  198 aa  RL25_PSEE4 RecName: Full=50S ribosomal protein L25;AltName:
    8::91      6e-15  45%  203 aa  RL25_BURP8 RecName: Full=50S ribosomal protein L25;AltName:
    5::97      6e-15  40%  214 aa  RL25_ALCBS RecName: Full=50S ribosomal protein L25;AltName:
    4::96      7e-15  40%  204 aa  RL25_PSEAE RecName: Full=50S ribosomal protein L25;AltName:
    4::96      7e-15  40%  204 aa  RL25_PSEAB RecName: Full=50S ribosomal protein L25;AltName:
    4::96      7e-15  40%  204 aa  RL25_PSEA8 RecName: Full=50S ribosomal protein L25;AltName:
    1::96      7e-15  42%   97 aa  RL25_BLOPB RecName: Full=50S ribosomal protein L25;
    7::95      1e-14  36%  202 aa  RL25_RICBR RecName: Full=50S ribosomal protein L25;AltName:
    7::95      1e-14  36%  202 aa  RL25_RICB8 RecName: Full=50S ribosomal protein L25;AltName:
    7::96      1e-14  38%  204 aa  RL25_NOVAD RecName: Full=50S ribosomal protein L25;AltName:
    5::94      1e-14  39%  202 aa  RL25_NITEC RecName: Full=50S ribosomal protein L25;AltName:
    7::95      1e-14  38%  203 aa  RL25_RICPR RecName: Full=50S ribosomal protein L25;AltName:
   10::98      1e-14  40%  203 aa  RL25_RHOSK RecName: Full=50S ribosomal protein L25;AltName:
   10::98      1e-14  40%  203 aa  RL25_RHOS5 RecName: Full=50S ribosomal protein L25;AltName:
   10::98      1e-14  40%  203 aa  RL25_RHOS4 RecName: Full=50S ribosomal protein L25;AltName:
   10::98      1e-14  40%  203 aa  RL25_RHOS1 RecName: Full=50S ribosomal protein L25;AltName:
    6::98      1e-14  41%  244 aa  RL25_COXBU RecName: Full=50S ribosomal protein L25;AltName:
    6::98      1e-14  41%  244 aa  RL25_COXBR RecName: Full=50S ribosomal protein L25;AltName:
    6::98      1e-14  41%  244 aa  RL25_COXBN RecName: Full=50S ribosomal protein L25;AltName:
    6::98      1e-14  41%  244 aa  RL25_COXB2 RecName: Full=50S ribosomal protein L25;AltName:
    6::98      1e-14  41%  244 aa  RL25_COXB1 RecName: Full=50S ribosomal protein L25;AltName:
    7::96      2e-14  46%  193 aa  RL25_THICR RecName: Full=50S ribosomal protein L25;AltName:
    7::95      2e-14  37%  203 aa  RL25_RICTY RecName: Full=50S ribosomal protein L25;AltName:
    4::95      2e-14  38%  197 aa  RL25_PSEP1 RecName: Full=50S ribosomal protein L25;AltName:
    7::95      2e-14  36%  199 aa  RL25_RICAH RecName: Full=50S ribosomal protein L25;AltName:
    4::96      2e-14  43%  201 aa  RL25_PSEMY RecName: Full=50S ribosomal protein L25;AltName:
    8::92      2e-14  41%  207 aa  RL25_BURXL RecName: Full=50S ribosomal protein L25;AltName:
    8::92      2e-14  41%  206 aa  RL25_BURPP RecName: Full=50S ribosomal protein L25;AltName:
    7::96      3e-14  36%  207 aa  RL25_SPHWW RecName: Full=50S ribosomal protein L25;AltName:
    6::97      8e-14  38%  202 aa  RL25_AGRT5 RecName: Full=50S ribosomal protein L25;AltName:
    4::94      1e-13  35%  207 aa  RL25_METFK RecName: Full=50S ribosomal protein L25;AltName:
    6::97      2e-13  37%  204 aa  RL25_RHIEC RecName: Full=50S ribosomal protein L25;AltName:
    6::96      5e-13  34%  229 aa  RL25_ERYLH RecName: Full=50S ribosomal protein L25;AltName:
    6::97      7e-13  34%  213 aa  RL25_RHILO RecName: Full=50S ribosomal protein L25;AltName:
    4::92      1e-12  39%  211 aa  RL25_KOCRD RecName: Full=50S ribosomal protein L25;AltName:
    8::97      1e-12  36%  214 aa  RL25_ALHEH RecName: Full=50S ribosomal protein L25;AltName:
    5::96      2e-12  33%  209 aa  RL25_OCHA4 RecName: Full=50S ribosomal protein L25;AltName:
    5::96      2e-12  33%  207 aa  RL25_BRUSU RecName: Full=50S ribosomal protein L25;AltName:
    5::96      2e-12  33%  207 aa  RL25_BRUSI RecName: Full=50S ribosomal protein L25;AltName:
    5::96      2e-12  33%  207 aa  RL25_BRUME RecName: Full=50S ribosomal protein L25;AltName:
    5::96      2e-12  33%  207 aa  RL25_BRUMB RecName: Full=50S ribosomal protein L25;AltName:
    5::96      2e-12  33%  207 aa  RL25_BRUC2 RecName: Full=50S ribosomal protein L25;AltName:
    5::96      2e-12  33%  207 aa  RL25_BRUAB RecName: Full=50S ribosomal protein L25;AltName:
    5::96      2e-12  33%  207 aa  RL25_BRUA2 RecName: Full=50S ribosomal protein L25;AltName:
    5::96      2e-12  33%  207 aa  RL25_BRUA1 RecName: Full=50S ribosomal protein L25;AltName:
    9::96      2e-12  32%  218 aa  RL25_ANAMM RecName: Full=50S ribosomal protein L25;AltName:
    9::96      2e-12  32%  218 aa  RL25_ANAMF RecName: Full=50S ribosomal protein L25;AltName:
    9::96      2e-12  35%  220 aa  RL25_ZYMMO RecName: Full=50S ribosomal protein L25;AltName:
    6::96      2e-12  35%  216 aa  RL25_PARL1 RecName: Full=50S ribosomal protein L25;AltName:
    5::96      3e-12  35%  207 aa  RL25_SINMW RecName: Full=50S ribosomal protein L25;AltName:
   10::98      3e-12  38%  208 aa  RL25_PARDP RecName: Full=50S ribosomal protein L25;AltName:
    5::96      3e-12  33%  206 aa  RL25_BARHE RecName: Full=50S ribosomal protein L25;AltName:
    6::98      5e-12  38%  210 aa  RL25_SACD2 RecName: Full=50S ribosomal protein L25;AltName:
    9::96      6e-12  33%  210 aa  RL25_EHRCR RecName: Full=50S ribosomal protein L25;AltName:
    4::98      6e-12  39%   98 aa  RL25_ACIAD RecName: Full=50S ribosomal protein L25;
   10::98      8e-12  36%  216 aa  RL25_JANSC RecName: Full=50S ribosomal protein L25;AltName:
    6::96      8e-12  33%  221 aa  RL25_BEII9 RecName: Full=50S ribosomal protein L25;AltName:
    5::96      2e-11  43%  208 aa  RL25_MOOTA RecName: Full=50S ribosomal protein L25;AltName:
    5::96      2e-11  32%  209 aa  RL25_BART1 RecName: Full=50S ribosomal protein L25;AltName:
    5::96      2e-11  33%  205 aa  RL25_BARBK RecName: Full=50S ribosomal protein L25;AltName:
    5::96      3e-11  30%  210 aa  RL25_MESSB RecName: Full=50S ribosomal protein L25;AltName:
    6::94      3e-11  35%  200 aa  RL25_AZOSB RecName: Full=50S ribosomal protein L25;AltName:
    7::95      4e-11  33%  203 aa  RL25_RICRS RecName: Full=50S ribosomal protein L25;AltName:
    7::95      4e-11  33%  203 aa  RL25_RICRO RecName: Full=50S ribosomal protein L25;AltName:
    7::95      4e-11  33%  203 aa  RL25_RICPU RecName: Full=50S ribosomal protein L25;AltName:
    7::95      4e-11  33%  203 aa  RL25_RICCN RecName: Full=50S ribosomal protein L25;AltName:
    7::95      4e-11  33%  203 aa  RL25_RICAE RecName: Full=50S ribosomal protein L25;AltName:
    5::96      4e-11  32%  208 aa  RL25_BARQU RecName: Full=50S ribosomal protein L25;AltName:
   10::98      5e-11  35%  212 aa  RL25_ROSDO RecName: Full=50S ribosomal protein L25;AltName:
    5::96      5e-11  33%  204 aa  RL25_RHIME RecName: Full=50S ribosomal protein L25;AltName:
    4::96      5e-11  38%  200 aa  RL25_PSEPF RecName: Full=50S ribosomal protein L25;AltName:
    8::91      1e-10  40%  197 aa  RL25_STRAW RecName: Full=50S ribosomal protein L25;AltName:
   13::98      1e-10  35%  207 aa  RL25_SILPO RecName: Full=50S ribosomal protein L25;AltName:
    9::96      1e-10  30%  208 aa  RL25_EHRRW RecName: Full=50S ribosomal protein L25;AltName:
    9::96      1e-10  30%  208 aa  RL25_EHRRG RecName: Full=50S ribosomal protein L25;AltName:
    6::92      1e-10  33%  193 aa  RL25_DESDG RecName: Full=50S ribosomal protein L25;AltName:
    6::96      1e-10  31%  211 aa  RL25_ANAPZ RecName: Full=50S ribosomal protein L25;AltName:
    7::92      2e-10  36%  207 aa  RL25_BIFLI RecName: Full=50S ribosomal protein L25;AltName:
    6::94      2e-10  34%  235 aa  RL25_ANADF RecName: Full=50S ribosomal protein L25;AltName:
    4::95      2e-10  34%  207 aa  RL25_ORITI RecName: Full=50S ribosomal protein L25;AltName:
    4::95      2e-10  34%  207 aa  RL25_ORITB RecName: Full=50S ribosomal protein L25;AltName:
    7::92      2e-10  35%  206 aa  RL25_BIFLO RecName: Full=50S ribosomal protein L25;AltName:
    7::92      2e-10  35%  206 aa  RL25_BIFLD RecName: Full=50S ribosomal protein L25;AltName:
    4::96      3e-10  36%  199 aa  RL25_PSEF5 RecName: Full=50S ribosomal protein L25;AltName:
    1::93      3e-10  32%  228 aa  RL25_PELUB RecName: Full=50S ribosomal protein L25;AltName:
    6::94      4e-10  34%  240 aa  RL25_ANASK RecName: Full=50S ribosomal protein L25;AltName:
    6::94      4e-10  34%  240 aa  RL25_ANAD2 RecName: Full=50S ribosomal protein L25;AltName:
    4::96      6e-10  36%  204 aa  RL25_PSEU2 RecName: Full=50S ribosomal protein L25;AltName:
    4::96      9e-10  35%  203 aa  RL25_PSESM RecName: Full=50S ribosomal protein L25;AltName:
    6::94      1e-09  33%  240 aa  RL25_ANADE RecName: Full=50S ribosomal protein L25;AltName:
    6::96      1e-09  32%  217 aa  RL25_ACICJ RecName: Full=50S ribosomal protein L25;AltName:
    4::96      2e-09  35%  203 aa  RL25_PSE14 RecName: Full=50S ribosomal protein L25;AltName:
    6::94      2e-09  33%  183 aa  RL25_DESPS RecName: Full=50S ribosomal protein L25;AltName:
    4::92      3e-09  30%  212 aa  RL25_FINM2 RecName: Full=50S ribosomal protein L25;AltName:
    6::97      4e-09  31%  199 aa  RL25_PELPD RecName: Full=50S ribosomal protein L25;AltName:
    9::96      4e-09  35%  215 aa  RL25_MYCLE RecName: Full=50S ribosomal protein L25;AltName:
    7::94      4e-09  35%  214 aa  RL25_CORJK RecName: Full=50S ribosomal protein L25;AltName:
    6::94      5e-09  36%  219 aa  RL25_ELUMP RecName: Full=50S ribosomal protein L25;AltName:
    6::70      6e-09  38%  197 aa  RL25_GEOBB RecName: Full=50S ribosomal protein L25;AltName:
    6::95      6e-09  30%  199 aa  RL25_CAUSK RecName: Full=50S ribosomal protein L25;AltName:
    7::93      8e-09  35%  205 aa  RL25_PROAC RecName: Full=50S ribosomal protein L25;AltName:
    9::97      8e-09  37%  194 aa  RL25_GEOLS RecName: Full=50S ribosomal protein L25;AltName:
    6::93      8e-09  28%  192 aa  RL25_DESMR RecName: Full=50S ribosomal protein L25;AltName:
    6::96      1e-08  30%  229 aa  RL25_SORC5 RecName: Full=50S ribosomal protein L25;AltName:
    6::96      1e-08  30%  227 aa  RL25_METSB RecName: Full=50S ribosomal protein L25;AltName:
    9::96      1e-08  26%  209 aa  RL25_EHRCJ RecName: Full=50S ribosomal protein L25;AltName:
    6::95      1e-08  30%  200 aa  RL25_CORGL RecName: Full=50S ribosomal protein L25;AltName:
    6::96      1e-08  29%  203 aa  RL25_WOLPP RecName: Full=50S ribosomal protein L25;AltName:
   41::94      1e-08  43%  185 aa  RL25_LARHH RecName: Full=50S ribosomal protein L25;AltName:
    6::95      1e-08  30%  202 aa  RL25_CORGB RecName: Full=50S ribosomal protein L25;AltName:
    1::88      2e-08  31%  197 aa  RL25_CARHZ RecName: Full=50S ribosomal protein L25;AltName:
    6::92      4e-08  31%  211 aa  RL25_TREDE RecName: Full=50S ribosomal protein L25;AltName:
    4::93      4e-08  34%  214 aa  RL25_THEYD RecName: Full=50S ribosomal protein L25;AltName:
    9::94      4e-08  29%  201 aa  RL25_THEPX RecName: Full=50S ribosomal protein L25;AltName:
    9::94      4e-08  29%  201 aa  RL25_THEP3 RecName: Full=50S ribosomal protein L25;AltName:
    7::94      4e-08  30%  212 aa  RL25_CORU7 RecName: Full=50S ribosomal protein L25;AltName:
    6::96      5e-08  29%  204 aa  RL25_WOLTR RecName: Full=50S ribosomal protein L25;AltName:
    7::96      5e-08  28%  215 aa  RL25_MARMM RecName: Full=50S ribosomal protein L25;AltName:
    4::93      5e-08  33%  218 aa  RL25_HALOH RecName: Full=50S ribosomal protein L25;AltName:
   30::96      5e-08  28%  209 aa  RL25_HALHL RecName: Full=50S ribosomal protein L25;AltName:
    4::94      7e-08  29%  192 aa  RL25_PORGI RecName: Full=50S ribosomal protein L25;AltName:
    4::94      7e-08  29%  192 aa  RL25_PORG3 RecName: Full=50S ribosomal protein L25;AltName:
    6::70      7e-08  35%  197 aa  RL25_GEOSM RecName: Full=50S ribosomal protein L25;AltName:
    1::95      2e-07  32%  103 aa  RL25_BLOFL RecName: Full=50S ribosomal protein L25;
   30::97      3e-07  37%  210 aa  RL25_RHORT RecName: Full=50S ribosomal protein L25;AltName:
    5::97      3e-07  29%  194 aa  RL25_GEOSL RecName: Full=50S ribosomal protein L25;AltName:
    5::45      3e-07  44%  195 aa  RL25_GEOMG RecName: Full=50S ribosomal protein L25;AltName:
    6::95      3e-07  30%  205 aa  RL25_CORDI RecName: Full=50S ribosomal protein L25;AltName:
    1::96      4e-07  27%  215 aa  RL25_THESQ RecName: Full=50S ribosomal protein L25;AltName:
    7::96      6e-07  30%  199 aa  RL25_SYNFM RecName: Full=50S ribosomal protein L25;AltName:
    8::96      7e-07  27%  203 aa  RL25_WOLWR RecName: Full=50S ribosomal protein L25;AltName:
    8::96      7e-07  27%  203 aa  RL25_WOLPM RecName: Full=50S ribosomal protein L25;AltName:
    5::91      7e-07  26%  215 aa  RL25_OCEIH RecName: Full=50S ribosomal protein L25;AltName:
   28::98      1e-06  31%  209 aa  RL25_SILST RecName: Full=50S ribosomal protein L25;AltName:
   24::96      1e-06  30%  206 aa  RL25_GLUDA RecName: Full=50S ribosomal protein L25;AltName:
    5::91      1e-06  30%  203 aa  RL25_FLAPJ RecName: Full=50S ribosomal protein L25;AltName:
   14::95      1e-06  32%  196 aa  RL25_BACFR RecName: Full=50S ribosomal protein L25;AltName:
   14::95      1e-06  32%  196 aa  RL25_BACFN RecName: Full=50S ribosomal protein L25;AltName:
    1::96      1e-06  26%  214 aa  RL25_THEP1 RecName: Full=50S ribosomal protein L25;AltName:
    6::90      1e-06  35%  198 aa  RL25_STRCO RecName: Full=50S ribosomal protein L25;AltName:
   33::96      2e-06  33%  217 aa  RL25_METS4 RecName: Full=50S ribosomal protein L25;AltName:
    5::91      2e-06  31%  203 aa  RL25_FLAJ1 RecName: Full=50S ribosomal protein L25;AltName:
    7::96      2e-06  29%  202 aa  RL25_COREF RecName: Full=50S ribosomal protein L25;AltName:
    1::90      2e-06  29%  204 aa  CTC_BACSU RecName: Full=General stress protein CTC;AltName:
    6::97      2e-06  33%  191 aa  RL25_DESVM RecName: Full=50S ribosomal protein L25;AltName:
    1::90      2e-06  28%  202 aa  RL25_BACA2 RecName: Full=50S ribosomal protein L25;AltName:
    6::93      3e-06  30%  201 aa  RL25_AKKM8 RecName: Full=50S ribosomal protein L25;AltName:
   12::96      3e-06  30%  205 aa  RL251_SYMTH RecName: Full=50S ribosomal protein L25 1;AltName:
    6::92      4e-06  39%  194 aa  RL25_THEFY RecName: Full=50S ribosomal protein L25;AltName:
    6::65      4e-06  32%  196 aa  RL25_GEOSF RecName: Full=50S ribosomal protein L25;AltName:
    6::93      4e-06  22%  210 aa  RL25_DESRM RecName: Full=50S ribosomal protein L25;AltName:
    1::90      4e-06  27%  208 aa  RL25_BACP2 RecName: Full=50S ribosomal protein L25;AltName:
    6::95      5e-06  26%  209 aa  RL25_SYNWW RecName: Full=50S ribosomal protein L25;AltName:
    7::97      5e-06  31%  202 aa  RL25_MAGSA RecName: Full=50S ribosomal protein L25;AltName:
    5::91      5e-06  29%  210 aa  RL25_GEOTN RecName: Full=50S ribosomal protein L25;AltName:
    3::96      5e-06  31%  216 aa  RL25_DESAH RecName: Full=50S ribosomal protein L25;AltName:
    6::96      6e-06  26%  200 aa  RL25_SYNAS RecName: Full=50S ribosomal protein L25;AltName:
    1::92      6e-06  26%  217 aa  RL25_STAAR RecName: Full=50S ribosomal protein L25;AltName:
    5::93      6e-06  29%  218 aa  RL25_ROSS1 RecName: Full=50S ribosomal protein L25;AltName:
    5::92      6e-06  27%  220 aa  RL25_GRAFK RecName: Full=50S ribosomal protein L25;AltName:
    6::95      6e-06  25%  218 aa  RL25_DESAA RecName: Full=50S ribosomal protein L25;AltName:
   11::92      6e-06  31%  194 aa  RL252_SYMTH RecName: Full=50S ribosomal protein L25 2;AltName:
    1::96      8e-06  24%  215 aa  RL25_THENN RecName: Full=50S ribosomal protein L25;AltName:
    1::92      8e-06  26%  217 aa  RL25_STAAW RecName: Full=50S ribosomal protein L25;AltName:
    1::92      8e-06  26%  217 aa  RL25_STAAS RecName: Full=50S ribosomal protein L25;AltName:
    1::92      8e-06  26%  217 aa  RL25_STAAN RecName: Full=50S ribosomal protein L25;AltName:
    1::92      8e-06  26%  217 aa  RL25_STAAM RecName: Full=50S ribosomal protein L25;AltName:
    1::92      8e-06  26%  217 aa  RL25_STAAC RecName: Full=50S ribosomal protein L25;AltName:
    1::92      8e-06  26%  217 aa  RL25_STAAB RecName: Full=50S ribosomal protein L25;AltName:
    1::92      8e-06  26%  217 aa  RL25_STAA3 RecName: Full=50S ribosomal protein L25;AltName:
    9::94      8e-06  30%  208 aa  RL25_RHOOB RecName: Full=50S ribosomal protein L25;AltName:
   30::97      8e-06  36%  218 aa  RL25_GLUOX RecName: Full=50S ribosomal protein L25;AltName:
   10::98      1e-05  30%  211 aa  RL25_DINSH RecName: Full=50S ribosomal protein L25;AltName:
    6::97      1e-05  33%  190 aa  RL25_DESVV RecName: Full=50S ribosomal protein L25;AltName:
    6::97      1e-05  33%  190 aa  RL25_DESVH RecName: Full=50S ribosomal protein L25;AltName:
    8::93      1e-05  24%  185 aa  RL25_CHLMU RecName: Full=50S ribosomal protein L25;AltName:
    8::93      1e-05  25%  185 aa  RL25_CHLTR RecName: Full=50S ribosomal protein L25;AltName:
    8::93      1e-05  25%  185 aa  RL25_CHLTB RecName: Full=50S ribosomal protein L25;AltName:
    8::93      1e-05  25%  185 aa  RL25_CHLTA RecName: Full=50S ribosomal protein L25;AltName:
    8::93      1e-05  25%  185 aa  RL25_CHLT2 RecName: Full=50S ribosomal protein L25;AltName:
    1::92      2e-05  26%  221 aa  RL25_STAHJ RecName: Full=50S ribosomal protein L25;AltName:
    7::96      2e-05  23%  228 aa  RL25_NITWN RecName: Full=50S ribosomal protein L25;AltName:
   28::96      2e-05  29%  228 aa  RL25_METPB RecName: Full=50S ribosomal protein L25;AltName:
    1::92      2e-05  30%  198 aa  RL25_LYSSC RecName: Full=50S ribosomal protein L25;AltName:
    6::94      2e-05  29%  217 aa  RL25_DESOH RecName: Full=50S ribosomal protein L25;AltName:
    6::97      2e-05  29%  211 aa  RL25_DESAP RecName: Full=50S ribosomal protein L25;AltName:
   10::93      2e-05  31%  182 aa  RL25_BORHD RecName: Full=50S ribosomal protein L25;AltName:
    6::97      2e-05  31%  198 aa  RL25_BACV8 RecName: Full=50S ribosomal protein L25;AltName:
   14::95      2e-05  29%  196 aa  RL25_BACTN RecName: Full=50S ribosomal protein L25;AltName:
    1::92      2e-05  26%  219 aa  RL25_STAES RecName: Full=50S ribosomal protein L25;AltName:
    1::92      2e-05  26%  219 aa  RL25_STAEQ RecName: Full=50S ribosomal protein L25;AltName:
    6::97      2e-05  34%  199 aa  RL25_DESDA RecName: Full=50S ribosomal protein L25;AltName:
   33::96      3e-05  30%  211 aa  RL25_METNO RecName: Full=50S ribosomal protein L25;AltName:
   15::91      3e-05  32%  209 aa  RL25_CHLPB RecName: Full=50S ribosomal protein L25;AltName:
    1::92      4e-05  27%  220 aa  RL25_STAS1 RecName: Full=50S ribosomal protein L25;AltName:
   28::96      4e-05  29%  228 aa  RL25_METEP RecName: Full=50S ribosomal protein L25;AltName:
   28::96      4e-05  29%  228 aa  RL25_METC4 RecName: Full=50S ribosomal protein L25;AltName:
    6::95      4e-05  24%  197 aa  RL25_CAUCR RecName: Full=50S ribosomal protein L25;AltName:
    6::95      4e-05  24%  197 aa  RL25_CAUCN RecName: Full=50S ribosomal protein L25;AltName:
    1::92      5e-05  25%  214 aa  RL25_STACT RecName: Full=50S ribosomal protein L25;AltName:
    9::94      5e-05  28%  207 aa  RL25_RHOSR RecName: Full=50S ribosomal protein L25;AltName:
    8::93      5e-05  23%  185 aa  RL25_CHLAB RecName: Full=50S ribosomal protein L25;AltName:
    5::93      7e-05  27%  218 aa  RL25_ROSCS RecName: Full=50S ribosomal protein L25;AltName:
   30::96      7e-05  27%  240 aa  RL25_OLICO RecName: Full=50S ribosomal protein L25;AltName:
   11::91      7e-05  33%  192 aa  RL25_CYTH3 RecName: Full=50S ribosomal protein L25;AltName:
    9::95      9e-05  27%  231 aa  RL25_HELMI RecName: Full=50S ribosomal protein L25;AltName:
    6::44      1e-04  38%  194 aa  RL25_GEOUR RecName: Full=50S ribosomal protein L25;AltName:
   10::93      1e-04  30%  182 aa  RL25_BORT9 RecName: Full=50S ribosomal protein L25;AltName:
   10::93      1e-04  31%  182 aa  RL25_BORRA RecName: Full=50S ribosomal protein L25;AltName:
   10::93      1e-04  31%  182 aa  RL25_BORDL RecName: Full=50S ribosomal protein L25;AltName:
   33::96      1e-04  28%  207 aa  RL25_AZOC5 RecName: Full=50S ribosomal protein L25;AltName:
   10::94      2e-04  31%  194 aa  RL25_NEOSM RecName: Full=50S ribosomal protein L25;AltName:
    9::94      2e-04  32%  199 aa  RL25_THETN RecName: Full=50S ribosomal protein L25;AltName:
    5::99      2e-04  33%  217 aa  RL25_THEAB RecName: Full=50S ribosomal protein L25;AltName:
   15::91      2e-04  28%  203 aa  RL25_PROVI RecName: Full=50S ribosomal protein L25;AltName:
    5::95      2e-04  23%  209 aa  RL25_PELTS RecName: Full=50S ribosomal protein L25;AltName:
    6::95      3e-04  29%  208 aa  RL25_PELCD RecName: Full=50S ribosomal protein L25;AltName:
    5::99      3e-04  38%  219 aa  RL25_FERNB RecName: Full=50S ribosomal protein L25;AltName:
   11::91      3e-04  29%  199 aa  RL25_CHLTE RecName: Full=50S ribosomal protein L25;AltName:
   11::93      3e-04  29%  201 aa  RL25_CHLP8 RecName: Full=50S ribosomal protein L25;AltName:
   15::93      3e-04  23%  189 aa  RL25_AZOPC RecName: Full=50S ribosomal protein L25;AltName:
    9::94      3e-04  26%  202 aa  RL25_RHOE4 RecName: Full=50S ribosomal protein L25;AltName:
    1::96      5e-04  23%  215 aa  RL25_THEMA RecName: Full=50S ribosomal protein L25;AltName:
    6::90      5e-04  28%  178 aa  RL25_SULDN RecName: Full=50S ribosomal protein L25;AltName:
   32::96      5e-04  25%  230 aa  RL25_RHOPT RecName: Full=50S ribosomal protein L25;AltName:
   32::96      5e-04  26%  234 aa  RL25_RHOPS RecName: Full=50S ribosomal protein L25;AltName:
   32::96      5e-04  25%  230 aa  RL25_RHOPA RecName: Full=50S ribosomal protein L25;AltName:
    6::95      5e-04  22%  208 aa  RL25_PHEZH RecName: Full=50S ribosomal protein L25;AltName:
    9::96      5e-04  29%  219 aa  RL25_MYCPA RecName: Full=50S ribosomal protein L25;AltName:
    7::93      5e-04  26%  182 aa  RL25_BORGA RecName: Full=50S ribosomal protein L25;AltName:
    7::93      5e-04  28%  182 aa  RL25_BORBZ RecName: Full=50S ribosomal protein L25;AltName:
   11::93      6e-04  32%  196 aa  RL25_TREPS RecName: Full=50S ribosomal protein L25;AltName:
   11::93      6e-04  32%  196 aa  RL25_TREPA RecName: Full=50S ribosomal protein L25;AltName:
   28::96      6e-04  26%  227 aa  RL25_METRJ RecName: Full=50S ribosomal protein L25;AltName:
    9::98      6e-04  27%  212 aa  RL25_LEPBL RecName: Full=50S ribosomal protein L25;AltName:
    9::98      6e-04  27%  212 aa  RL25_LEPBJ RecName: Full=50S ribosomal protein L25;AltName:
    8::92      6e-04  31%  211 aa  RL25_GLOVI RecName: Full=50S ribosomal protein L25;AltName:
    8::93      6e-04  22%  185 aa  RL25_CHLCV RecName: Full=50S ribosomal protein L25;AltName:
    7::93      6e-04  27%  182 aa  RL25_BORAP RecName: Full=50S ribosomal protein L25;AltName:
   11::92      6e-04  36%  196 aa  RL25_AMOA5 RecName: Full=50S ribosomal protein L25;AltName:
    5::91      8e-04  26%  210 aa  RL25_GEOKA RecName: Full=50S ribosomal protein L25;AltName:
    1::94

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
RL25_SALTY      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
RL25_SALTI      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
RL25_SALSV      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
RL25_SALPK      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
RL25_SALPC      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
RL25_SALPB      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
RL25_SALPA      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
RL25_SALNS      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
RL25_SALHS      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
RL25_SALEP      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
RL25_SALDC      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
RL25_SALCH      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
RL25_SALA4      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
RL25_SALG2      MFTINAEVRKEQGKGASRRLRTANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
RL25_SALAR      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDKVMNMQAKAEFYSEVLTLVVDGKEV
RL25_CITK8      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGAEAPIAIELDHDQVMNMQAKAEFYSEVLTIVVDGKEV
RL25_SHISS      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLTIVVDGKEI
RL25_SHIFL      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLTIVVDGKEI
RL25_SHIDS      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLTIVVDGKEI
RL25_ECOSE      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLTIVVDGKEI
RL25_ECOLI      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLTIVVDGKEI
RL25_ECOLC      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLTIVVDGKEI
RL25_ECOHS      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLTIVVDGKEI
RL25_ECODH      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLTIVVDGKEI
RL25_ECOBW      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLTIVVDGKEI
RL25_ECO8A      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLTIVVDGKEI
RL25_ECO55      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLTIVVDGKEI
RL25_ECO24      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLTIVVDGKEI
RL25_SHIB3      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVINMQAKAEFYSEVLTIVVDGKEI
RL25_ECO5E      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNIQAKAEFYSEVLTIVVDGKEI
RL25_ECO57      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNIQAKAEFYSEVLTIVVDGKEI
RL25_SHIBS      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLAIVVDGKEI
RL25_ECOSM      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAVELDHDKVMNMQVKAEFYSEVLTIVVDGKEI
RL25_ECOLU      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAVELDHDKVMNMQVKAEFYSEVLTIVVDGKEI
RL25_ECOL6      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAVELDHDKVMNMQVKAEFYSEVLTIVVDGKEI
RL25_ECOL5      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAVELDHDKVMNMQVKAEFYSEVLTIVVDGKEI
RL25_ECO81      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAVELDHDKVMNMQVKAEFYSEVLTIVVDGKEI
RL25_ECO7I      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAVELDHDKVMNMQVKAEFYSEVLTIVVDGKEI
RL25_ECO45      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAVELDHDKVMNMQVKAEFYSEVLTIVVDGKEI
RL25_ECO27      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAVELDHDKVMNMQVKAEFYSEVLTIVVDGKEI
RL25_ENTS8      MFTINAEVRKEQGKGASRRLRHANKFPAIVYGGTEAPVAIELDHDKVMNMQAKPEFYSEVLTLAIDGKEV
RL25_ESCF3      MFTINAEVRNEQGKGASRRLRTANKFPAIIYGGNEAPLAVALDHDKVMNMQVKAEFYSEVLTIVVDGKEI
RL25_KLEP3      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGEAAPVAIELDHDKLWNMQDKAEFYGEVVTLVIDGKEE
RL25_PHOLL      MFTINAEVRKEQGKGASRRLRRANKFPAIVYGGNQELVSIELDHDQVINMEQKAEFYSDVLTLVIDGKET
RL25_ERWT9      MFTINVETRKEQGKGASRRLRTANKFPAIIYGGNEAAVAIELDHDSVMNLQSKPGFYDEVLTLVVDGKET
RL25_SERP5      MFTINVEVRKDQGKGASRRLRIANKFPAIVYGGEEAPVSIELDHDSVKNMESKPEFYSEAVTLVIDGKET
RL25_SODGM      MLTINAVIRKDQGKGASRRLRLANKFPAIVYGGTKAPVAIELDHDIVLNTQTKEGFYTDVLALVIDGKES
RL25_ENT38      MFTINAEVRAVQGKGASRRLRAANKFPAIIYGGEAAPVAIEMDQDKVWNQQTKEGFYTEVLTIVIDGKEE
RL25_EDWI9      MFTINAEVRNEQGKGASRRLRTAGKFPAIVYGGSEAALSVTLDHDSTMNLSEKDGFYTDVLTLSVDGKEI
RL25_KLEP7      MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGAAAPVAIELDHDKVWNMQDKAEFYSEVLTXXXXXXXX
RL25_YERPY      MTTINVEVRNDQGKGASRRLRAANKFPAIVYGGSEAAISIALDHDTTKNLELKPGFYDSVLTLVIDGKET
RL25_YERPS      MTTINVEVRNDQGKGASRRLRAANKFPAIVYGGSEAAISIALDHDTTKNLELKPGFYDSVLTLVIDGKET
RL25_YERPP      MTTINVEVRNDQGKGASRRLRAANKFPAIVYGGSEAAISIALDHDTTKNLELKPGFYDSVLTLVIDGKET
RL25_YERPN      MTTINVEVRNDQGKGASRRLRAANKFPAIVYGGSEAAISIALDHDTTKNLELKPGFYDSVLTLVIDGKET
RL25_YERPG      MTTINVEVRNDQGKGASRRLRAANKFPAIVYGGSEAAISIALDHDTTKNLELKPGFYDSVLTLVIDGKET
RL25_YERPE      MTTINVEVRNDQGKGASRRLRAANKFPAIVYGGSEAAISIALDHDTTKNLELKPGFYDSVLTLVIDGKET
RL25_YERPB      MTTINVEVRNDQGKGASRRLRAANKFPAIVYGGSEAAISIALDHDTTKNLELKPGFYDSVLTLVIDGKET
RL25_YERPA      MTTINVEVRNDQGKGASRRLRAANKFPAIVYGGSEAAISIALDHDTTKNLELKPGFYDSVLTLVIDGKET
RL25_YERP3      MTTINVEVRNDQGKGASRRLRAANKFPAIVYGGSEAAISIALDHDTTKNLELKPGFYDSVLTLVIDGKET
RL25_PECCP      MITIKAEVRKDQGKGASRRLRSAGKFPAIVYGGSEAPVSIELDHDSVKNQEAKEGFYGTALILSIDGKEV
RL25_PROMH      MLTINATVRKEQGKGASRRLRVANRFPAIVYGGNEEPIAIDLDHNEVINQEHKSEFYADFVNLVIDGKAT
RL25_ERWCT      MITIKAEARQGQGKGASRRLRSAGKFPAIVYGGSEAPVSIELDHDSVKNQEVKEGFYGETLILSIDGKEV
RL25_YERE8      MITIKAEVRNDQGKGASRRLRAANKFPAIIYGGSEAAIAIELDHDTTKNLELKPGFYDNTLTLVINGKET
RL25_ACTSZ      -FKFNAEVRTAQGKGASRRLRHNGQIPAIVYGGSEAPVSIVLNHDELNNAQVHDSFYSDVITLVIDGKEV
RL25_HAEIN      -FKFNAEVRTAQGKGASRRLRHNGQIPAIVYGGSEEPVSIILNHDELNNAQAHESFYSEVITLVVEGKEV
RL25_PASMU      MFKFNAEVRQSQGKGASRRLRHNGQIPAIVYGGSEAPVSIVLNHDDLNNAQVHDAFYTDVITLVIEGKEV
RL25_HAEIG      -FKFNAEVRTAQGKGASRRLRHNGQIPAIVYGGSEEPVSIILNHDELNNAQAHESFYSEVITLVIGGKEV
RL25_HAEIE      -FKFNAEVRTAQGKGASRRLRNNGQIPAIVYGGSEEPVSIILNHDELNNAQAHESFYSEVITLVIGGKEV
RL25_HAEI8      -FKFNAEVRTAQGKGASRRLRNNGQIPAIVYGGSEEPVSIILNHDELNNAQAHESFYSEVITLVIGGKEV
RL25_MANSM      -FKFNAEVRSAQGKGASRRLRHNGQIPAIVYGGNEDAVSIVLNHDELNNAQAHDSFYSEVITLVINGKEV
RL25_HAES2      -FKFNAEVRSKQGKGASRRLRHNGQIPAIVYGGSEAPVSIVLNHDELNNAQIHDSFYSDTIILVIEGKEI
RL25_HAES1      -FKFNAEVRSKQGKGASRRLRHNGQIPAIVYGGSEAPVSIVLNHDELNNAQIHDSFYSDTIILVIEGKEI
RL25_TOLAT      -FTFQTEVRADLGKGASRRLRRAEQVPAILYGAGQEAVSLVLDHNKVITAQQEAAFYSEVLTLVVDGKEV
RL25_PASPI      -----AVVRTDLGKGASRRLRHANQFPAIVYGGEEVPVAIVLDHDSVINQMDKPAFY-EVITLVIDGKEV
RL25_VIBF1      -----AVVRTEQGKGASRRLRHAGKFPAIVYGGTEAPVSIALDHDAVINQMDKPAFY-EAIELVIDGAAV
RL25_ACTPJ      -FKFEAEVRSAQGKGASRRLRHNGQVPAIIYGGNAEPVSIILDHDKVNNAQAHDAFYNEVLTIVVAGKEE
RL25_ACTP7      -FKFEAEVRSAQGKGASRRLRHNGQVPAIIYGGNAEPVSIILDHDKVNNAQAHDAFYNEVLTIVVAGKEE
RL25_VIBFM      -----AVVRTEQGKGASRRLRHAGQFPAIVYGGTEAPVSIALDHDAVINQMDKPAFY-EAIELVIDGAVV
RL25_ALISL      -----AVVRTEQGKGASRRLRHAGKFPAIVYGGTEAPVSIELIHFDVINQMDKPEFY-EAIELVIDGATV
RL25_SHEB9      -YTIQAQTRTEIGKGSSRRLRHAGKVPAVIYGQGKEPVSIVFDHKDIINIQANADFYTSTLTIVVDGKEV
RL25_SHEB8      -YTIQAQTRTEIGKGSSRRLRHAGKVPAVIYGQGKEPVSIVFDHKDIINIQANADFYTSTLTIVVDGKEV
RL25_SHEB5      -YTIQAQTRTEIGKGSSRRLRHAGKVPAVIYGQGKEPVSIVFDHKDIINIQANADFYTSTLTIVVDGKEV
RL25_SHEB2      -YTIQAQTRTEIGKGSSRRLRHAGKVPAVIYGQGKEPVSIVFDHKDIINIQANADFYTSTLTIVVDGKEV
RL25_ACTP2      -FKFEAEVRSAQGKGASRRLRHNGQVPAIIYGGNAEPVSIILDHDKVNNAQAHDAFYNEVLTIVVAGKEE
RL25_VIBVY      -----AVVRTELGKGASRRLRLAGQFPAVVYGGEAAPVAVALNHDDIVNQMDKPEFY-EAITLVIGGEEV
RL25_VIBVU      -----AVVRTELGKGASRRLRLAGQFPAVVYGGEAAPVAVALNHDDIVNQMDKPEFY-EAITLVIGGEEV
RL25_SHESH      -YTIAAEIRTEIGKGSSRRLRHANKVPAVIYGAGKEPISIKFDHKDIINIQENADFYSSDLTITVDGKDV
RL25_SHESR      -YTIQAQTRTEIGKGSSRRLRHAGKVPAVIYGAGKEPVSIVFDHKDIINIQTNEDFYTSVVTIVLDGKEV
RL25_SHESM      -YTIQAQTRTEIGKGSSRRLRHAGKVPAVIYGAGKEPVSIVFDHKDIINIQTNEDFYTSVVTIVLDGKEV
RL25_SHESA      -YTIQAQTRTEIGKGSSRRLRHAGKVPAVIYGAGKEPVSIVFDHKDIINIQTNEDFYTSVVTIVLDGKEV
RL25_VIBSL      -----AVVRTELGKGASRRLRHAGKFPAVIYGGEAAAVAIELVHADVINQMDKPEFY-ETITLVIDGAEV
RL25_VIBCM      -----AVLRTDLGKGASRRLRNTGYFPAIVYGGEAAPVSISLNHDDVMNQMDKPEFY-EAIVLVIDGQEV
RL25_VIBCH      -----AVLRTDLGKGASRRLRNTGYFPAIVYGGEAAPVSISLNHDDVMNQMDKPEFY-EAIVLVIDGQEV
RL25_VIBC3      -----AVLRTDLGKGASRRLRNTGYFPAIVYGGEAAPVSISLNHDDVMNQMDKPEFY-EAIVLVIDGQEV
RL25_SHEON      -YTITAQTRTEIGKGSSRRLRHAGKVPAVIYGAGKEPVSIVFDHKDIINAQANDDFYTSVVTIVLDGKEV
RL25_SHEAM      -YTIPAQTRTEIGKGSSRRLRREGKVPAVIYGVGKEPVSIVFDHKDIINIQANDDFYTSVLTIVLDGKEV
RL25_HAEPS      -FKFEAEVRSAQGKGASRRLRHNGQVPAIIYGGKAEAVSIILDHDKVNNAQAHDAFYNEVLTIVVAGKEE
RL25_HAEDU      -FKFEAEVRSAQGKGASRRLRHNGQVPAIIYGGNAEPVSIILDHDKVNNVQIHDAFYNEVLTIVLAEKEV
RL25_SHEDO      -YTIQAQIRTEIGKGSSRRLRHANKVPAVIYGPGKEPMVIVFDQKDIINIQANADFYTSDVTLVVDGKDV
RL25_SHESW      -YTIQAQTRTEIGKGSSRRLRHAGKVPAVIYGQGKEPVSIVFEHKDIINIQANEDFYTSVVTIVLDGKEV
RL25_SHEPC      -YTIQAQTRTEIGKGSSRRLRHAGKVPAVIYGQGKEPVSIVFEHKDIINIQANEDFYTSVVTIVLDGKEV
RL25_PHOPR      ----NAVVRTDLGKGASRRLRLTEKFPAIIYGGEAAPVAIELLHSDVINQMDKPEFY-EGIILVIDGQEV
RL25_SHELP      -YTITAQTRTEIGKGSSRRLRHAGKVPAVIYGAGKEAVSIEFEHRSIINIQTNDDFYNSDITIVLDGKEV
RL25_ALTMD      IFNLDASVRTDLGKGASRRLRREDKLPGIIYGGEEAPVSITLDHNKVNNSADFEAFYSHVLTLNLDGKPV
RL25_AERS4      -FVFQAEVRSDLGKGASRRLRHADQVPAIIYGAGKEAQSITVDHKKFIIAQEKPEFYESVLTLVINGEEV
RL25_SHEWM      -YTIAAQVRTEIGKGSSRRLRHADKVPAVIYGPGKEPVAIVFDHKDIINIQENEDFYTSTLTINLDGSDV
RL25_BUCAT      MLTLQAETRKEKGTGFSRRLRIHNKFPAVLYGVKKTEILLILDHNTTFNLQKKIEFYKENLLLCVQDKKY
RL25_BUCAI      MLTLQAETRKEKGTGFSRRLRIHNKFPAVLYGVKKTEILLILDHNTTFNLQKKIEFYKENLLLCVQDKKY
RL25_BUCA5      MLTLQAETRKEKGTGFSRRLRIHNKFPAVLYGVKKTEILLILDHNTTFNLQKKIEFYKENLLLCVQDKKY
RL25_SHEHH      -YTIAAQVRTEIGKGSSRRLRHANKVPAVIYGPGKEAISIVFDHKDIINIQENQDFYTSELTIALEGKDV
RL25_SHEPW      -YTIAAQIRTEIGKGSSRRLRHANKVPAVIYGPGKEAISIVFDHKDIINIQANEDFYTTDLTISLDGKDV
RL25_IDILO      -FNIQATVRTDKGKGASRRLRHEDKVPAILYGGQGEPIALALDHNKVNNMADYEAFYSHIVTLEFDGKKH
RL25_SHEFN      -YTINAVTRTEIGKGSSRRLRHAGKVPAVIYGPGKEPVSIKFEHKDIINIQLNDDFYTTDLTVSIEGKEV
RL25_SHEPA      -YTIAAQVRTEIGKGSSRRLRHAKKVPAVIYGPGKEAISIVFDHKDIINIQENQDFYTSELTIALEGKDV
RL25_BUCAP      MFIVKAEIRDKKGKSFSRKLRIEDKFPGVLYGFNNTPISITMDHNLVFNLQKKEDFYKETLCLLIKEKKY
RL25_FRATO      -FVLKAEKREDLGTGASRRLRRAGKIPAVIYGGEKEAVSVLLDHDKVLHSTEDKEFFSSEITLDIDGKQE
RL25_FRATH      -FVLKAEKREDLGTGASRRLRRAGKIPAVIYGGEKEAVSVLLDHDKVLHSTEDKEFFSSEITLDIDGKQE
RL25_FRATF      -FVLKAEKREDLGTGASRRLRRAGKIPAVIYGGEKEAVSVLLDHDKVLHSTEDKEFFSSEITLDIDGKQE
RL25_PSEA6      IFTLDAEVRTDLGKGASRRLRHEDKVPAVLYGLGKEAVSLTLSHNKVFQAQEFEAFYSHVLTLNVDGKKV
RL25_FRATW      -FVLKAEKREDLGTGASRRLRRAGKIPAVIYGGEKEAVSVLLDHDKVLHSTEDKAFFSSEITLDIDGKQE
RL25_FRATT      -FVLKAEKREDLGTGASRRLRRAGKIPAVIYGGEKEAVSVLLDHDKVLHSTEDKAFFSSEITLDIDGKQE
RL25_FRATN      -FVLKAEKREDLGTGASRRLRRAGKIPAVIYGGEKEAVSVLLDHDKVLHSTEDKAFFSSEITLDIDGKQE
RL25_FRATM      -FVLKAEKREDLGTGASRRLRRAGKIPAVIYGGEKEAVSVLLDHDKVLHSTEDKAFFSSEITLDIDGKQE
RL25_FRAT1      -FVLKAEKREDLGTGASRRLRRAGKIPAVIYGGEKEAVSVLLDHDKVLHSTEDKAFFSSEITLDIDGKQE
RL25_COLP3      LLTLEAEVRTDLGKGASRRLRHANKVPAILYGENEEPISLTLEHKNVFRAQQEEAFYSQVLTLNIAGKPV
RL25_DECAR      -FELNAQARTLQGTGASRRLRHAAKVPGIVYGGAAAPQSIEVDHNDLLLKLKKEAFHSSIINLIIDGKKE
RL25_VIBPA      -----AVVRTELGKGASRRLRHAGKFPXXXXXXXXXXXXXXLNHDDIVNQMDKPEFY-EGIVLVIDGKEV
RL25_PSEHT      -YVYNAELREQTGTGASRRLRREDKVPAIVYGANKEATSITLDHKDVIKAQESEGFYTQILTLNIGGESV
RL25_HAHCH      -FSLNAEKRDVQGKGASRRLRRVDKVPGIIYGGETAPVAISVSHNQLSHALQNEAFYSHILTLDVEGTNE
RL25_VIBHB      -----AVVRTELGKGASRRLRHAGKFPXXXXXXXXXXXXXXLNHDDIVNQMDKPEFY-EGIVLVIDGAEV
RL25_XYLFT      ---IKAQRRKDEGKGASRRLRHAGMIPAIIYGGEQRPVSIQLNHEQIWLAQQNEWFYSSILDLNVDGAGA
RL25_XYLF2      ---IKAQRRKDEGKGASRRLRHAGMIPAIIYGGEQRPVSIQLNHEQIWLAQQNEWFYSSILDLNVDGAGA
RL25_METCA      -FVFEAELRHQLGKGASRRLRHAGKVPAVLYGGGGEPVSLLLDHHKVVKNLENEATYSHVLTIRFDGREE
RL25_XYLFM      ---IKAQRRKDEGKGASRRLRHAGMIPAIIYGGDQRPVSIQLNHEQIWLAQQNEWFYSSILDLNVDGGGE
RL25_XYLFA      ---IKAQRRKDEGKGASRRLRHAGMIPAIIYGGEQRPVSIQLNHEQIWLAQQNEWFYSSILDLNVDGGGE
RL25_NITMU      ---ISAEKRELQGKGASRRLRGSGKVPGIIYGGENPAQPIELDHNNLYHQLKLEAFHASILTMSVEGQKE
RL25_CHRVO      -YELIAAKRVDLGTGASRRLRRAGKLPAVVYGAGKDAVSLELDHNTLYHAVKHADFHTSVLELVIDGQKE
RL25_XANOR      ---IKAERRADEGKGASRRLRHAGVIPAIVYGGELEPVSIQLNHEQIWLAQQNEWFYSSILDLNLNGDVQ
RL25_XANOM      ---IKAERRADEGKGASRRLRHAGVIPAIVYGGELEPVSIQLNHEQIWLAQQNEWFYSSILDLNLNGDVQ
RL25_THIDA      -----ASKRELQGTGASRRLRHAGKVPGIVYGGSTAPVQIELDHNALYHALRKEAFHASVLSLSVDGAKE
RL25_THISH      -FELQAEPRADQGKGASRRLRRAGKVPAILYGEGKDPQPITLDHNAVMLNLEHEAFYSHILSVKLGGKAE
RL25_DICNV      -YTLHAVVREEQGKGASRRLRRQGLVPAIIYGGNTEPQAIAIKQDELKKNAKNHSFFSQIINLKIDGQEQ
RL25_LEGPL      ---LEAQSRTDMGKGASRRLRRLNKVPAVIYGGSKKPMAIHFSHNKVIKALETESIYSSVFDITVDGKVE
RL25_LEGPH      ---LEAQSRTDMGKGASRRLRRLNKVPAVIYGGSKKPMAIHFSHNKVIKALETESIYSSVFDITVDGKVE
RL25_LEGPC      ---LEAQSRTDMGKGASRRLRRLNKVPAVIYGGSKKPMAIHFSHNKVIKALETESIYSSVFDITVDGKVE
RL25_LEGPA      ---LEAQSRTDMGKGASRRLRRLNKVPAVIYGGSKKPMAIHFSHNKVIKALETESIYSSVFDITVDGKVE
RL25_BORA1      ----NATLRSVQGTSASRRLRRAGRVPAIVYGGTAAPLNIELDHNEIFHALRKEQFHASILTMALEGANE
RL25_XANCP      ---IKVERRADEGKGASRRLRHAGVIPAIVYGGELEPVSIQLNHEQIWLAQQNEWFYSSILDLNLNGDVQ
RL25_XANCB      ---IKVERRADEGKGASRRLRHAGVIPAIVYGGELEPVSIQLNHEQIWLAQQNEWFYSSILDLNLNGDVQ
RL25_XANC8      ---IKVERRADEGKGASRRLRHAGVIPAIVYGGELEPVSIQLNHEQIWLAQQNEWFYSSILDLNLNGDVQ
RL25_XANC5      ---IKVERRADEGKGASRRLRHAGVIPAIVYGGELEPVSIQLNHEQIWLAQQNEWFYSSILDLNLNGDVQ
RL25_XANAC      ---IKVERRADEGKGASRRLRHAGVIPAIVYGGELEPVSIQLNHEQIWLAQQNEWFYSSILDLNLNGDVQ
RL25_NITOC      LFELHADVRVEQGKGASRRLRRAGKVPAVLYGAAKEPISLLFDHNLLFRHLSHDAFYSHILTIHANGKAE
RL25_RUTMC      --TINALTRDDQGKGASHRLRRNHKIPAIVYGTGKAPRNITLDVFEITRLLENEESYTSVLDLIVDKKKE
RL25_CELJU      -FKLDATARNDLGKGASRRLRRADQVPAIIYGGSKAPVNVSVSHNELLKHLQHEAFFSHVIDLNIDGTSE
RL25_VESOH      --TINALTRNYQGKGANRRLRRNNKIPAIVYGTGKPPSKITLDIFEITHLLKNEETYTSVLNLIVNKNKE
RL25_RALME      --------RSVQGTGASRRLRNSGKTPGIIYGGAAEPKMIELDHNALWHALKKEAFHSSILDLEVAGKSE
RL25_LEPCP      -----AFARELQGTGASRRLRHGGKVPGIVYGGSGKPTSIELDHNALYHALKKEAFHSSILEMELAGQSE
RL25_CUPTR      --------RSVQGTGASRRLRNSGKTPGIIYGGAAEPKMIELDHNALWHALKKEAFHSSILDLEVAGKSE
RL25_RALEJ      --------RSVQGTGASRRLRNSGKTPGIIYGGAADPKMIELDHNALWHALKKEAFHSSILDLEVAGKSE
RL25_POLSQ      --------RSVQGTGASRRLRNSGKTPGIVYGSKDPALVIELDHNALFHALRKEAFHSSILDLEIDGKAQ
RL25_MARAV      -FVIEAFPRDDQGKGASRRLRREEKIPAIIYGGGKDATPVAIWHNELKKAIENEAFFSHILTVDIQGKKE
RL25_RALEH      --------RSVQGTGASRRLRNSGKTPGIIYGGAAEPKMIELDHNALWHALKKEAFHSSILELEVAGKSE
RL25_JANMA      -----AFARKELGTGASRRQRIAGLTPGIVYGGTAAPVNISLDHNALYHALKKEAFHSSILDLEVDGKVE
RL25_BURM1      --------RKEQGTGASRRLRNAGKTTGIVYGGEAAPQMIELDHNALWHALKKEAFHSSILDLEVAGQSQ
RL25_BORPD      ----NATARSVQXXXXXXXXXXXXXVPAIVYGGSAAPLNIELDHNEIYHALRKEEFHASILQMQLDGKEE
RL25_VEREI      --------RAKQGTGASRRLRNSGKTPGIVYGGSAEPQMIELDHNALWHALKKEAFHSSVLDMEVAGKTD
RL25_BUCBP      MLTIYGISRTKCGKKASRRLRLQNKFPAIIHVSLISNISIELSQNDFINIEMKSDFYKSEVILIVDKVKY
RL25_ACIAC      --------RAKQGTGASRRLRNSGKTPGIVYGGSAEPQLIEVDHNALWHALKKEAFHSSVLDMELAGKTS
RL25_DIAST      --------RAKQGTGASRRLRISGKAPGIVYGGSAEPQLIEIDHNALWHALKKEAFHSSILDMELNGQVT
RL25_CHRSD      -FTLSAEVRHDLGKGASRRLRRENKVAAIIYGGSKTPQPITLEKSAFYKAIEDEAFFSSVINIDLEGQSE
RL25_ACISJ      --------RAKQGTGASRRLRISGKAPGIVYGGSAEPQLIEIDHNALWHALKKEAFHSSILDMELNGQVT
RL25_RHOFD      --------RAKQGTGASRRLRITGRTPGIVYGGGAEPQQIEIDHNALWHALKKEAFHAAVLDMELDGKDN
RL25_POLNA      --------RAKQGTGASRRLRITGRTPGIVYGGTAEPILIEIDHNALWHAIKKEAFHGSILEMELGGTEH
RL25_BURS3      --------RQEQGTGASRRLRNAGKTTGIVYGGEAAPQKIELDHNALWHALKKEAFHSSILDLEVAGQSQ
RL25_BURCM      --------RQEQGTGASRRLRNAGKTTGIVYGGEAAPQKIELDHNALWHALKKEAFHSSILDLEVAGQSQ
RL25_BURA4      --------RQEQGTGASRRLRNAGKTTGIVYGGEAAPQKIELDHNALWHALKKEAFHSSILDLEVAGQSQ
RL25_ACIBT      -FVLNAQARAEQGKGASRRLRRESLVPAIIYGGNAEPVAVTLELRELVKALESNAFFEEVVEIKVGDKVE
RL25_PSYA2      -FALNAVDRSAQGKGASRRLRKQNLVPAIIYGGGEQPIAISIKINELVKSLEFEAFFSHILTLNVDGEEH
RL25_BURTA      --------RQQQGTGASRRLRNAGKTTGIVYGGEAAPQMIELDHNALWHALKKEAFHSSILDLEVAGKSQ
RL25_BURPS      --------RQQQGTGASRRLRNAGKTTGIVYGGEAAPQMIELDHNALWHALKKEAFHSSILDLEVAGKSQ
RL25_BURP1      --------RQQQGTGASRRLRNAGKTTGIVYGGEAAPQMIELDHNALWHALKKEAFHSSILDLEVAGKSQ
RL25_BURMS      --------RQQQGTGASRRLRNAGKTTGIVYGGEAAPQMIELDHNALWHALKKEAFHSSILDLEVAGKSQ
RL25_BURMA      --------RQQQGTGASRRLRNAGKTTGIVYGGEAAPQMIELDHNALWHALKKEAFHSSILDLEVAGKSQ
RL25_BURM7      --------RQQQGTGASRRLRNAGKTTGIVYGGEAAPQMIELDHNALWHALKKEAFHSSILDLEVAGKSQ
RL25_ACIB5      -FVLNAQARAEQGKGASRRLRRESLVPAIIYGGNAEPVAVTLELRELVKALESNVFFEEVVEIKVGDKVE
RL25_ACIB3      -FVLNAQARAEQGKGASRRLRRESLVPAIIYGGNAEPVAVTLELRELVKALESNVFFEEVVEIKVGDKVE
RL25_METPP      --------RELQGTGASRRLRISGKVPGIVYGAGE-PLKIELDHNALFHALKKEAFHASLLDMEFNGKSQ
RL25_BURP6      --------RQQQGTGASRRLRNAGKTTGIVYGGEVAPQMIELDHNALWHALKKEAFHSSILDLEVAGKSQ
RL25_PSYIN      ---LTATTRTDLGKGASRRLRHADLVPAIVYGADKEAVSLTFTHKDIIKAEGIEAFYSSVLDLEIDGVSE
RL25_BURCH      --------RQQQGTGASRRLRNAGKTTGIVYGGEAAPQKIELDHNALWHALKKEAFHSSILDLEVAGQSQ
RL25_BURCC      --------RQQQGTGASRRLRNAGKTTGIVYGGEAAPQKIELDHNALWHALKKEAFHSSILDLEVAGQSQ
RL25_BURCA      --------RQQQGTGASRRLRNAGKTTGIVYGGEAAPQKIELDHNALWHALKKEAFHSSILDLEVAGQSQ
RL25_PSEFS      -FTLNAQARTDLGKGASRRLRHAANIPAVVYGGNKPAESVTILSKEIAKLFENEAAYSHVIELNVDGTKQ
RL25_HERAR      -----AFARNDLGTGASRRQRIAGLTPGIVYGGTAAPVNISLDHNALYHALKKEAFHSSILDLEVDGKVE
RL25_FRAP2      -FSLKAVKREDXXXXXXXXXXXXXKIPAVIYGGDKEAVSIVLDHDKVLHSTEDKAFFSSEITLEIDGQEE
RL25_PSYCK      -FALNAVDRSAQGKGASRRLRKQNLVPAIIYGGGEQPTAISIKINELVKSLEFEAFFSHILTLNVDGEEH
RL25_PSEU5      -FTLNAQVRSDLGKGASRRLRRAALVPAVIYGGNNAPQSISILAKDFAKLLENEASFSHVLNLNVDGQNE
RL25_POLSJ      --------RAKQGTGASRRLRITGRTPGIVYGGTGEPSLIELDHNALWHAIKKEAFHASVLEMEMGGKTE
RL25_POLNS      --------RSVQGTSASRRLRNSGKTPGIVYGSKDPALVIELDHNALFHALRKEAFHSSILDLEIGGKTQ
RL25_BURVG      --------RQQQGTGASRRLRNAGKTTGIVYGGEAAPQKIELDHNALWHALKKEAFHASILDLEIAGQSQ
RL25_NITEU      ---ISANSRKLHGTGANRRLRSQGRLPGVIYGGNGDAQSIELDHKDLYYKLKMEAFHASILSISIDGKKE
RL25_DELAS      --------RAKQGTGASRRLRNSGKAPGIVYGGAAEAQLIEIDHNALWHALKKEVFHSSILDMEVNGQTS
RL25_PSYWF      LYTVNGITRTQQGKGASRRLRKQNLVPAIIYGGNEEPTAIAIKKNELWKLLENEAFFSNILTINLEGEEH
RL25_PSEPW      -FTLNAQVRSDLGKGASRRLRHSLNIPAVVYGGDKEAQSLTIVAKEIAKLFENEAAFSHVIELNVDGAKQ
RL25_BORPA      ----NATARSVQXXXXXXXXXXXXXVPAIVYGGTAAPLNIELDHNEIYHALRKEEFHASILNMVIEGKTE
RL25_BORBR      ----NATARSVQXXXXXXXXXXXXXVPAIVYGGTAAPLNIELDHNEIYHALRKEEFHASILNMVIEGKTE
RL25_VARPS      --------RAKQGTGASRRLRISGKTPGIVYGGEGKPQLIELDHNALWHALKKEAFHSSILEMELGGATS
RL25_RALSO      --------RSVQGTGASRRLRNAGKTPAIIYGAGAEPKLIELDHNALYHALKKEAFHSSILDIEVAGKVE
RL25_PSEPK      -FTLNAQARTDLGKGASRRLRHSANIPAVVYGGNQDAQSLTILAKEITKLFENEAAFSHVLELNVDGAKQ
RL25_PSEPG      -FILNAQARTDLGKGASRRLRHAASIPAVVYGGDKEAQSLTIVAKEIAKLFENEAAYSHVIELNVDGAKQ
RL25_BORPE      ----NATARSVQXXXXXXXXXXXXXVPAIVYGGTAAPLNIELDHNEIYHALRKEEFHALILNMVIEGKTE
RL25_RALPJ      --------RSVQGTGASRRLRNSGKTPAIIYGAGAEPKLIELDHNALYHALKKEAFHSSILDIEVAGKVE
RL25_AZOSE      -----ATQRVEQGTGASRRLRRAGQIPGIIYGADTDAQAITVDHNELYHLLKKETFHASVLMIELEGAKH
RL25_NEIMF      -YEIQASVREAQGTGASRRLRREGQIPGILYGEGQEPVAIAVDHKTVFYALEKESFHTALIKLSLNGETK
RL25_NEIMB      -YEIQASVREAQGTGASRRLRREGQIPGILYGEGQEPVAIAVDHKTVFYALEKESFHTALIKLSLNGETK
RL25_NEIMA      -YEIQASVREAQGTGASRRLRREGQIPGILYGEGQEPVAIAVDHKTVFYALEKESFHTALIKLSLNGETK
RL25_NEIM0      -YEIQASVREAQGTGASRRLRREGQIPGILYGEGQEPVAIAVDHKTVFYALEKESFHTALIKLSLNGETK
RL25_NEIG2      -YEIQASVREAQGTGASRRLRREGQIPGILYGEGQEPVAIAVDHKTVFYALEKESFHTALIKLSLNGETK
RL25_NEIG1      -YEIQASVREAQGTGASRRLRREGQIPGILYGEGQEPVAIAVDHKTVFYALEKESFHTALIKLSLNGETK
RL25_MARMS      --SINAVARTQEGKGASRRLRNEGLVPAVIYGGETAPVSISFKDNELLKAVGTPGFLTGLVEVTVEGKTE
RL25_RICFE      ---LEAKSRTEFGTGASRALRREGRVPAIIYGAGKTPVSISLEEKEITKYYRKPAFISQLINLTIDKKKY
RL25_PSEA7      -FILNAQVRSDLGKGASRRLRRAAQVPAVIYGGDKEPQSVTLELREIAKLLENEAAFSHVIALNVGGAKE
RL25_AZOVD      -FALNAEVRSDLGKGASRRLRRAAQVPAVIYGGDKEPQSISILAKDITKLIEDEAAFSHVITLNIAGATE
RL25_SPHAL      --TLTAETRERGGKGASRELRRNGRVPAVVYGGKEEPLMIHVEEKLLMKQLMTGHFMNSVVMIEVGGKQI
RL25_RICCK      ---LEAQSRTEFGTGAARALRREGRVPAIIYGAGKTPVSISLEEKEITKYYRKPAFISQLINLTIDKKQY
RL25_PSEE4      -FILNAQARTDLGKGASRRLRHSANIPAVVYGGDKEAQSLTIVAKEIAKLFENEAAFSHVIELNVDGAKQ
RL25_BURP8      --------RNLQGTGASRRLRNSGKAPGIVYGAGE-PQLIELDHNALWHALKKEAFHSSILELEVAGKSQ
RL25_ALCBS      -FLLNAESRSDTGKGASRRLRRLQRVPGILYGGEAEPQMISVELRELKKALENEAFYSHILTLKLDGADV
RL25_PSEAE      -FILNAQVRSDLGKGASRRLRRAGLVPAVVYGGDKEPQSVTLELREIAKLLENEAAFSHVIALNVGGAKE
RL25_PSEAB      -FILNAQVRSDLGKGASRRLRRAGLVPAVVYGGDKEPQSVTLELREIAKLLENEAAFSHVIALNVGGAKE
RL25_PSEA8      -FILNAQVRSDLGKGASRRLRRAGLVPAVVYGGDKEPQSVTLELREIAKLLENEAAFSHVIALNVGGAKE
RL25_BLOPB      MLTIKANLRIYHKKGATRRLRKQNKCPAVIYNGQEPSIPIILNQNDILHPEAVIQLYKNILLFIENQQPI
RL25_RICBR      ---LEAKSRNEFGTGAARALRREGRVPAIIYGAKKTPVSISLEEKEITKYYRKPAFISQLINLTIEGTQY
RL25_RICB8      ---LEAKSRNEFGTGAARALRREGRVPAIIYGAKKTPVSISLEEKEITKYYRKPAFISQLINLTIEGTQY
RL25_NOVAD      ---LSAETRDRAGKGASRALRREGRTPAVIYGGNEEPVAIHLEEKALVKALGTGHFFNSVVELTVGGQTV
RL25_NITEC      ---ISANSRNLHGTGANRRLRIQGRLPGVIYGGGGTAQPIDLDHKDLYYKLKTDVFHASILSINVDGKKE
RL25_RICPR      ---LEAKSRTEFGTGAARALRREGRVPAIIYGAGKTPISISLKEKEITKYYRKPAFISQLINLTIDKKQY
RL25_RHOSK      -----AEVRTGTGKGAARQARREGYVPGIVYGGGQEPLSINVPYNDLLNRLKKGRFLQTLFNLKVEGQEV
RL25_RHOS5      -----AEVRTGTGKGAARQARREGYVPGIVYGGGQEPLSINVKYNDLLNRLKKGRFLQTLFNLKVEGQEV
RL25_RHOS4      -----AEVRTGTGKGAARQARREGYVPGIVYGGGQEPLSINVPYNDLLNRLKKGRFLQTLFNLKVEGQEV
RL25_RHOS1      -----AEVRTGTGKGAARQARREGYVPGIVYGGGQEPLSINVPYNDLLNRLKKGRFLQTLFNLKVEGQEV
RL25_COXBU      -FELIAELREFTGKSAARRMRREDKVPGTVYGAGKAPQSITLLQKDLLKALESESTFSSILTLKVGDKKQ
RL25_COXBR      -FELIAELREFTGKSAARRMRREDKVPGTVYGAGKAPQSITLLQKDLLKALESESTFSSILTLKVGDKKQ
RL25_COXBN      -FELIAELREFTGKSAARRMRREDKVPGTVYGAGKAPQSITLLQKDLLKALESESTFSSILTLKVGDKKQ
RL25_COXB2      -FELIAELREFTGKSAARRMRREDKVPGTVYGAGKAPQSITLLQKDLLKALESESTFSSILTLKVGDKKQ
RL25_COXB1      -FELIAELREFTGKSAARRMRREDKVPGTVYGAGKAPQSITLLQKDLLKALESESTFSSILTLKVGDKKQ
RL25_THICR      -----AELRTEEGKGASRRLRHAGKVPAIIYGGDVDAKSIALKSNQIERLKLDVDLYNSVLTLEGAGDAE
RL25_RICTY      ---LEAKSRTEFGTGAARALRREGRVPAIIYGAGKIPISISLEEKEITKYYRRPAFISQLINLTIDKKQY
RL25_PSEP1      -FILNAQARTDLGKGASRRLRHSLSIPAVVYGGDKEAQSLTILAKEITKLFENEAAFSHVIELNVDGVKQ
RL25_RICAH      ---LEAKPRTEFGTGAARALRREGRVPAIIYGAGKTPVSISLEEKAITKYYRKPAFISQLINVTIDQKQY
RL25_PSEMY      -FALNAEVRSDLGKGASRRLRRVSMVPAVIYGGDKAPQSISLLAKDLAKLLENEAAFSHVLAVNVAGATE
RL25_BURXL      --------RSLQGTGASRRLRNSGKTPGIVYGAGAETQLVELDHNALWHALKKEVFHSSILDLEVAGKSQ
RL25_BURPP      --------RSLQGTGASRRLRNSGKTPGIVYGAGAETQLVELDHNALWHALKKEVFHSSILDLEVAGKSQ
RL25_SPHWW      ---LSAEARERAGKGASRAIRREGRVPAVIYGEKQEPASIHVEEKVLMKLLHTGHFFNSVVMLDVGGKKV
RL25_AGRT5      -YELKAEARERVGKGSSRELRRNGLIPAVIYGDKQAPISIALSTNEVTKRIHAGGFMTTVGTIDVDGKKI
RL25_METFK      --TIKATKREGKGTSASRRLRRAGNVPGVVYGGDKEAVSLEFNHKELFLEFRHETFHASILNLEVDGQKE
RL25_RHIEC      -YELKAEARERVGKGSARELRRNGLIPAVIYGDKQAPIAIAINTNEVTKRIHAGGFMTTVATIEVDGKKH
RL25_ERYLH      --TLPAEARERAGKGASRALRREGRVPAVIYGGKEEPTMIHVEEKLLIKQLMTGHFMNSIVEIEIGGKTV
RL25_RHILO      -YELKAEAREQVGKGSARAVRRNGKVPAVIYGDKQPPLAIALTYKDIYYKIHGGGFLTTIATIDVDGKKI
RL25_KOCRD      VITIPATLRTEFGKGYARRVRANDKIPAVIYGHGAEPLHVILPGHEMMLASRNS---NAVLDINVDGEGH
RL25_ALHEH      ---LDAELRTETXXXXXXXXXXXXXVPAIMYGGHQEPQAITLNLLQLDRLMQEEAFYSQILTVNLDGKSE
RL25_OCHA4      -YVLKADLRTRVGKGSSRELRRNGQIPAVIYGDKQEPLAIAVSYKEIFYKIHGGGFKTTVATIEVDGKKI
RL25_BRUSU      -YVLKADLRTRVGKGSSRELRRNGQIPAVIYGDKQEPLAIAVSYKEIFYKIHGGGFKTTVATIEVDGKKI
RL25_BRUSI      -YVLKADLRTRVGKGSSRELRRNGQIPAVIYGDKQEPLAIAVSYKEIFYKIHGGGFKTTVATIEVDGKKI
RL25_BRUME      -YVLKADLRTRVGKGSSRELRRNGQIPAVIYGDKQEPLAIAVSYKEIFYKIHGGGFKTTVATIEVDGKKI
RL25_BRUMB      -YVLKADLRTRVGKGSSRELRRNGQIPAVIYGDKQEPLAIAVSYKEIFYKIHGGGFKTTVATIEVDGKKI
RL25_BRUC2      -YVLKADLRTRVGKGSSRELRRNGQIPAVIYGDKQEPLAIAVSYKEIFYKIHGGGFKTTVATIEVDGKKI
RL25_BRUAB      -YVLKADLRTRVGKGSSRELRRNGQIPAVIYGDKQEPLAIAVSYKEIFYKIHGGGFKTTVATIEVDGKKI
RL25_BRUA2      -YVLKADLRTRVGKGSSRELRRNGQIPAVIYGDKQEPLAIAVSYKEIFYKIHGGGFKTTVATIEVDGKKI
RL25_BRUA1      -YVLKADLRTRVGKGSSRELRRNGQIPAVIYGDKQEPLAIAVSYKEIFYKIHGGGFKTTVATIEVDGKKI
RL25_ANAMM      ---VDASVRAKCGTGSARALRAAGLIPAVVYGKNRDAVNISLSHADFLKKCRTLPIFSQLIKLCIDGKEE
RL25_ANAMF      ---VDASVRAKCGTGSARALRAAGLIPAVVYGKNRDAVNISLSHADFLKKCRTLPIFSQLIKLCIDGKEE
RL25_ZYMMO      -----AKKRDRAGKGASRAIRREGLVPAVIYGDKTPAMGITVDHIALFKMLNTGHFMNSVVTIDVDGQKL
RL25_PARL1      --TLKAEAREKGSKGAVRSLRRAGRVPAVIYGDKQSPELIAVSYKDVSALYQTGTFMSHVLDVEIGGKTE
RL25_SINMW      -YELKAETRERVGKGSSRELRRNGLIPAVIYGDKQPPLSIALSTKDVTMKIHAGGFMTTVATIDVDGKKI
RL25_PARDP      -----AEARAGTGKGAARQARREGKVPGIVYGDGKEPQPIQIEFNSLLTKLRAGRFMSTLWNLKVEGQDV
RL25_BARHE      -YTLKAEIRERVGKGSSRELRRNGLIPAVIYGDKQPPLAIAVSYKDIFYKIHAGGFRTTVATLAIDKQKI
RL25_SACD2      -FILNAEARDVSGKGASRRLRRAGLVPAIVYGGRKNPQNVTITLRELTKHLENEAFYSHIITLNIGDSSE
RL25_EHRCR      ---INASLRKNVGTGPSRALRLSGEIPAVIYGKGRDSLSISLSNREFVSKYRSAALSTHLIELEIDNKKE
RL25_ACIAD      -FVLNATARNEQGKGASRRLRREALVPAIIYGGEAEPVAVTIELRELVKALENNAFFXXXXXXXXXXXXX
RL25_JANSC      -----AEARTGTGKGAARQARREGNVPGIVYGGGIDPLAINIPFNVLLKRLKDGRFLSTLFNMKVEGQDV
RL25_BEII9      --TLAATVRGGTGKGAARSIRREGRIPGVIYGGGDAPEPITLDYRELNKLIYAGHFLTTIFDIEVEGAKQ
RL25_MOOTA      --TLEVTMRPEVGKQAARRLRRQGKLPGIIYGKKIANLAVIIPARQLEHILA-TEGENALLKLVVSGKEF
RL25_BART1      -YTLKAEKRERVGKGSSRELRRNGLIPAVIYGEKQPPLAITVPYKEIFYKIHAGGFRTTIATIVLDKQKI
RL25_BARBK      -YTLKAEVRERVGKGSSRELRRNGFIPAVIYGDKQPPLAISVPYKEVFYKIHGGGFRTTIATLEIGKEKI
RL25_MESSB      -YELTAEARERVGKGSARAIRRNGKIPAVIYGDKQPPLSITLPYKEVFLRIHAGGFRTTVATIDLNGEKI
RL25_AZOSB      ----NATKREGQGXXXXXXXXXXXQVPGIIYGAGKDAQPITLDHNELYHLLKKEAFHASVLSINVEGAKE
RL25_RICRS      ---LEAESRTEFGTXXXXXXXXXXXVPAIIYGAGKTPVSISLEEKEITKYYRKPAFISQLINLTIDKKKY
RL25_RICRO      ---LEAESRTEFGTXXXXXXXXXXXVPAIIYGAGKTPVSISLEEKEITKYYRKPAFISQLINLTIDKKKY
RL25_RICPU      ---LEAESRTEFGTXXXXXXXXXXXVPAIIYGAGKTPVSISLEEKEITKYYRKPAFISQLINLTIDKKKY
RL25_RICCN      ---LEAESRTEFGTXXXXXXXXXXXVPAIIYGAGKTPVSISLEEKEITKYYRKPAFISQLINLTIDKKKY
RL25_RICAE      ---LEAESRTEFGTXXXXXXXXXXXVPAIIYGAGKTPVSISLEEKEITKYYRKPAFISQLINLTIDKKKY
RL25_BARQU      -YTLKAELRERVGKGSSRELRRNGFIPAVIYGDKQPPLAIAVSYKEIFYKIYAGGFRTTVATIAVGQQKI
RL25_ROSDO      -----AQERTGTGKGAARQARRDGMVPGIVFGGDVDPLPINIPFNVLIKKLREGRFKSTLFNMKVEGDDV
RL25_RHIME      -YELKAETRDRVGKGSSRELRRNGLIPAVIYGDKQPPLSIALSTKDVTMKIHAGGFMTTVATIDVNGEKI
RL25_PSEPF      -FTLNAELRSDLGKGASXXXXXXXXXXXXXYGGDKAPESISMLAKEVAKLLENEAAYSHVIELNVGGTKQ
RL25_STRAW      -----AEPRTEFGKGAARRIRRESKVPAVVYGHGAEPVHITLGHELLLALRTP----NVLLSLDIEGKAQ
RL25_SILPO      --------RTGTGKGAARQARRDGMVPGIVFGGDNEPLPIQIPFNRLLKMLKAGRFKSTLFNLKVEGHEV
RL25_EHRRW      ---MNAELRNSVGTGPSRTLRRNGAIPAVVYGKHRSPLSIYLSDREFLSKYRSAALSTHLIELEIGEKKE
RL25_EHRRG      ---MNAELRNSVGTGPSRTLRRNGAIPAVVYGKHRSPLSIYLSDREFLSKYRSAALSTHLIELEIGEKKE
RL25_DESDG      --TLSVQKREGLGKGANRKLRTAKKVPGIFYNSEGKNIPVAIDGTQLEKLYETAG-KTTVFNLDIEGETA
RL25_ANAPZ      MIKVDASVRERCGTGSARALRARGLIPAVIYGKNRDPINISLSQVDFLKKCRTFPIFSKLIELCIGEKKE
RL25_BIFLI      ---LEGEARSEFGKGVARRLRVANKIPATIYAGGEEPAFVTL---PMRETTLALRHTNALFTIAFDGNTK
RL25_ANADF      ---INAQRREEKGKGPARRLRQKGLIPAVVYGRKQEPTHLSVDPASLLKAIETPHKFNTLLTLKLDGAEK
RL25_ORITI      MLTLVGQLRSDFGTSSARALRRQGKVPGVIYKKGITPIHVCTLEKEVAKLYRKPFFSSTVIQLQVDDQRF
RL25_ORITB      MLTLVGQLRSDFGTSSARALRRQGKVPGVIYKKGITPIHVCTLEKEVAKLYRKPFFSSTVIQLQVDDQRF
RL25_BIFLO      ---LEGEARSEFGKGVARRLRVANKIPATIYAGGEEPAFVTL---PMRETTLALRHTNALFTIAFDGNTK
RL25_BIFLD      ---LEGEARSEFGKGVARRLRVANKIPATIYAGGEEPAFVTL---PMRETTLALRHTNALFTIAFDGNTK
RL25_PSEF5      -FTLNAEVRSDLGKGXXXXXXXXXXXXXXXYGGDKAPESISMLAKEVAKLLENEAAYSHIIELNVGGTKQ
RL25_PELUB      MNSLDANTRNTKSKGDVRSLRSAGNIPGIIYGGPDQNQXXXXXXXXXXSLIDKGSFLSNIITLNLDGKPQ
RL25_ANASK      ---LSAQKRTEQGKGPARRLRQQGLIPAVVYGGKREPTHVALDPATLLKAIETPHKFNTLLELQVDGASK
RL25_ANAD2      ---LSAQKRTEQGKGPARRLRQQGLIPAVVYGGKREPTHVALDPATLLKAIETPHKFNTLLELQVDGASK
RL25_PSEU2      -FTLNAEQRSDLGKGXXXXXXXXXXXXXXXYGGDKAPESISMLAKEVAKLLENDAAYSHIIELNVGGKKQ
RL25_PSESM      -FTLNAELRSDLGKGXXXXXXXXXXXXXXXYGGDKAPESISMLAKEVAKLLENEASYSHIIELNVGGTKQ
RL25_ANADE      ---LSAQKRTEQGKGPARRLRQQGLIPAVVYGGKREPTHVALDPATLLKAIETPHKFNTLLELQVEGASK
RL25_ACICJ      --TIAAEDRARAGKGVARATRRAGKVPAVIYGAKQEPTLIALDPRIVLREMKRGGWRSRLYEIETASGKA
RL25_PSE14      -FTLNAEQRSDLGKGXXXXXXXXXXXXXXXYGGDKAPESISMLAKEVAKLLENDAAYSHIIELNVGGQKQ
RL25_DESPS      ---MTASVREAFGKGPMRRLRQQGITPAVVYGAGKAALPLQMDAKILMTQLLEFSRVNTVVSLSVDGQDA
RL25_FINM2      -YKLDMQKRDKVGSNAVRKLRVKELIPGVIYGKDFEPINVTVDEKELRKVHLMAG-TSSLIDVKVDGEEH
RL25_PELPD      ---MNIELRSKTGKGISRKLRSADMVPGVVYGKGMDPMAVSINYRELQAAMAGEGGQNNLITLVGGGSQS
RL25_MYCLE      ---LSVSVRTNTGKGASRRARRDGKVPAVLYGHGEEPQHLELP-AHAFSAVLRHVGTNAVLTLEVAGKEQ
RL25_CORJK      ---LKGELRTEFGKGASRRLRRDFRVPAVVYGNDLDPMHVHVD---ILEFQARNEGVNAVLELEIEGQDH
RL25_ELUMP      ---VNVELREKAGKGVLSAIRAEKKVPAVIYGGQKEPISVSIT-EKDLKAILKAGSNSVVTLSTPAGKET
RL25_GEOBB      ---LKAELREQTGKGICRRLRAAGRVPAVVYGKGIAPVSISLGQKELSEAIAGEGGRNHILTLECAGE--
RL25_CAUSK      ---LNVEIRDRAGTGGSRETRRQGKVPGVLYGGPLAPVNIAVKGNEFRKALHTGKLLGHLVTLQHGDEKQ
RL25_PROAC      ---LKAEQRTEFGKGAARRIRRDDKVPAVMYGHDHDPIHVTLDHATLLALRTE----NPLLSIEIEGKPM
RL25_GEOLS      ------ETRSSTGKGISRKLRAAGRIPGIVYGRGMEPVAISLEPKALNAAIAGEGGLNNLITLEGGGDKV
RL25_DESMR      --SLAVKTRAGLGKGACRKLRADDMVPGVYYDAKGVNVPVMVEHLPLQKLYSKIA-SSHVFDLQIEGETK
RL25_SORC5      ---LNATRREDSGKSASSRLRRAGQIPAIAYGRELAPQSVAISPKALLQVLGSDHGKNSVVELAIEGQTL
RL25_METSB      --TLAAAARHGTGKGAARSVRREGRIPGVIYGGGDPAEPITLDYRELNKLIYAGHFLTTLFEIDVAGTKQ
RL25_EHRCJ      ---INASLRENVGTGPARAVRRNGGIPAVVYGKNRDSLSVFLSDREFLSKHRSAALSTHLIELEIGDKKE
RL25_CORGL      --TIEAAVRSEFGKGSARRARVAGQIPAVVYGADESNLHVTIDH-RTFAALVRQEGVNAVLELDIEGQKQ
RL25_WOLPP      MVTINAELRDVKKKKAMQALREKGSIPAVIYGKGHDNVNLTLSAKEFTKQYKSGALSAHLIELDISGKKE
RL25_LARHH      ---------------------------------------ISFDHNTLYYALQKEGFHSSILNLVIDGATE
RL25_CORGB      --TIEAAVRSEFGKGSARRARVAGQIPAVVYGADESNLHVTVDH-RTFAALVRQEGVNAVLELDIEGQKH
RL25_CARHZ      MEKITASVRLKKTRGERNRLLKEGKVPGVMYGKNIEPVAVAVN---ARELESLVERGLKLFELSVEGKTQ
RL25_TREDE      ---LNANERSTYGKNAAVKMRKAGRIPAVMYDRHGKSVPIDVDEREFMKL-FKLVTESTIVTLNAAGKDY
RL25_THEYD      -FILNVEKRERTGKGIARQLRSKGIIPCVIYNGQSTPVQIPTELYTFMNIATREKLF---VTLKLDGQEK
RL25_THEPX      -------IKRDTGKNAARRLKNQGYIPAILYGGMAESIPLAVEYNKLQRLLQK-HGRNVLLNVIVDGSTH
RL25_THEP3      -------IKRDTGKNAARRLKNQGYIPAILYGGMAESIPLAVEYNKLQRLLQK-HGRNVLLNVIVDGSTH
RL25_CORU7      ---IEGVLRTEFGKGASRRLRRDGRIPLVVYGNELDPVHVHVD-TLDLHALVRNEGVNAVFELNIDGEDN
RL25_WOLTR      MITINAELRDVTKTKAIRSLRKKGNIPAVVYGKGHNNVNLTLSAKEFTKQYKLGFLSAHVIELDISGKKE
RL25_MARMM      ---LTVDVREGTGKGXXXXXXXEDLVPGIVYGGKLDPVSVTLRGNEIRKALLGGHFLSNMIEIDHKGKRQ
RL25_HALOH      -YNLKAEVRKDTGKGVARKLRRNGLIPGVIYGKTRKPQPLAVDAKDLNKVVGGNAILD--MTLVDGDKEE
RL25_HALHL      --------------------------PGVVYGAGKEPQPVALENDQLYRLLEEEAFFSTILKVQMGSETE
RL25_PORGI      -FQLTGTPRAEFGKKAAKAIRKEDQIPAVLYGGKGEGVNFIVSQDAVRNLIYSPEIFLVELTVEGSG-SY
RL25_PORG3      -FQLTGTPRAEFGKKAAKAIRKEDQIPAVLYGGKGEGVNFIVSQDAVRNLIYSPEIFLVELTVEGSG-SY
RL25_GEOSM      ---LKVELREKTGKGICRRLRAAGRVPAVVYGKGITPVSISLGQKELSEAIAGEGGRNHILTLECAGE--
RL25_BLOFL      MLIIKAILRTEIKKSITRKIRKNGGCPAVIYNKNKSPINVQLSNKDLSHPENVHYFLNKVQILINNEFTI
RL25_RHORT      --------------------------PAVIYGGRQDPVLLSLAPRLIHTEMRKAGFSSRLFDLTVEGGET
RL25_GEOSL      --TMSIELREKNGKGVARKLRAQDVVPGVVYGKGIEPVSVKVAAKDLAATIAGEGGLNSLITLSGGGSNI
RL25_GEOMG      --TISIEQREKAGKGVSRKLRAVGRVPGVVYGKGIEPVAVSVD---------------------------
RL25_CORDI      --TIAAQPRNEFGKGFARRLRVAGQVPGVIYGDVEAPIHFSINRLE-LHAVLRAHGVNAIIELDIEGEKH
RL25_THESQ      MVSLEARVREVKGKREARRLRRSGEVPAVVYGPATEPIPVKIKRSVLEKIFHTISEATPIQLIIKDDQEK
RL25_SYNFM      -----AQTRTKSGKGPARALRRNEMVPAVLYGPKAETVSLSVPRQRLERLLRDMGEESKLLRLTVEGAEM
RL25_WOLWR      --TINAELRDITKTKAMHSLRKKGNIPGIIYGKGHDNVNLTLSAKEFTKQYKSGSLSAHLIELNISGKKE
RL25_WOLPM      --TINAELRDITKTKAMHSLRKKGNIPGIIYGKGHDNVNLTLSAKEFTKQYKSGSLSAHLIELNISGKKE
RL25_OCEIH      ---LNATKREDLTKSATKQIRLSGRVPAVVYGKAKDPKNVSVDSVDLVK-TVRDEGRNAIISLQVENSSV
RL25_SILST      -----------------------NLVPGVVFGGDADPLAIQIPYNVLLKRLKAGRFKSTLFNLKVEGDDV
RL25_GLUDA      --------------------RRDGQVPAVIYGAKQEPTLVALDPRLVVREMQRGGWRSRVYDVTVDGASS
RL25_FLAPJ      --TIKGSERESVGKVATKALRNAGAVPCVLYGGDQ-PVHFSADERAFKSLVYTPNAHTVVIE-VEGGKSY
RL25_BACFR      -----AERSSEQAR-ALKEIRNNGGVPCVLYGGEEV-VHFTVTNEGLRNLVYTPHIY--VVDLVIDGKKV
RL25_BACFN      -----AERSSEQAR-ALKEIRNNGGVPCVLYGGEEV-VHFTVTNEGLRNLVYTPHIY--VVDLVIDGKKV
RL25_THEP1      MVSLEARVREVKGKREARRLRRNGEVPAVVYGPATEPIPVKIKRSVLEKVFHTISEATPIQLIIKDDQEK
RL25_STRCO      ---LTAETRTEFGKGAARRIRRDNKVPGVLYGGSDXXXXXXXXXXXXXXXRTS----NVLIALDIDGKTN
RL25_METS4      -----------------------------IYGGGQSPQSISLDANQTHHLIYGGGFLSTVFEIAVDGRTI
RL25_FLAJ1      --TIKGSERESVGKVSTKALRNAGAVPCVLYGGNQA-VHFSADAAAFKNLVYTPNAHTVVIEL-GKGKSF
RL25_COREF      --TIEAANRTEFGKGSARRARVAGLVPAVVYGADESNLHITLNHRDFAGL-VRRNGVNAVMELDVEGVKQ
CTC_BACSU       MATLTAKERTDFTRSSLRNIRTSGHVPGIIYGKDTGNKPVSLDSVELIK-TLRDEGKNAVITLEVSGEKH
RL25_DESVM      --TLSVRKRDGLGKGANRKLRAKTLVPGVFYNAEGLNVPIEMDTLPVEKL-FEAVGRTTVFNIEVDDNGT
RL25_BACA2      MATLKANERTDFKRSTLRKIRHSGHVPGIIYGKEITNTPVSLDSVELLK-TLRDEGKNTIITIDVNGNQQ
RL25_AKKM8      --SLKAETRA-CGSGNLKQLRSQGLVPGVVYGPGFDNVNIQVDAREFARMLASAVSEHILVALDINGKIV
RL251_SYMTH     ---------RETGSRASRRLRQAGFVPGIIYGPGVEPLAISIQLERLVDRHGRGHLINAHVEGEANPRQV
RL25_THEFY      ---IAAEPRTEFGKGXXXXXXXXGKVPAVLYGHGIAPRHINLGHDLMLALKTP----NVLLRLEVDEKES
RL25_GEOSF      ---LNVELRSKTGKGISRQLRRSESIPGVVYGKGIESVSVSLKTKELSNAIAGEGGRNHILTL-------
RL25_DESRM      ---LNANLRKTATKSIVKEIRNNGGIPGVVYGKHVGSMAISVDAKDLKNILGSVTGRNTLINMNINGSKQ
RL25_BACP2      MATLKANKRTDFKRSTLQKIRHSGHVPGVIYGKNTDNLAVSLDSIDLLKT-LRDEGKNTIITLDVNGETK
RL25_SYNWW      ---LNARKREIKNRGYLNQLKRSEQVPAVIYGKGEEAVPIILEKNRIFNVHGSRGLFS--LEIEGESKPM
RL25_MAGSA      ---IAAELRDXXXXXXXXXXXXXXKVPGVIYGDKKAAICIQMDPRVVWAQISKTGFFTQLVDLGKDGKHL
RL25_GEOTN      ---LGAKERKDKKHSTLRRIRSQGGIPAVLYGKKVDNKMISISAADLEKALREGGRHS-LVTLKVDGEDY
RL25_DESAH      LIDLKAEPRKGRGKSAARHLRNNDAVPAVLYGADSMPISVSLDLTTMVRVHGSSGLF---INLAINGDTV
RL25_SYNAS      ---LKANVRKESGKEQARRMRREGLIPAVLYGPGTDPVSLSVNASDLKTALKGAEENVLIKLIIDDSGRL
RL25_STAAR      MASLKSIIRQKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKV-IREVCRNGVIELGVGSKTI
RL25_ROSS1      -FTLSLEPRSVLGKKV-KRLRRSGILPATVYGKGIEPIAVQIDARSFQAIYRQAGRTSLIELHIAGHPPL
RL25_GRAFK      --TINGSKRESVGKKATKALRNAGQVPCVLYGVEGDPLHFAAEEISFKNLVYTPDVHTVKIKL-KSGESY
RL25_DESAA      ---LKASPRTTRGNGPARALRREGFIPAVLYGPDSEPITLSVSHKDLSDILQGVGSSQVMFNLNIEGADA
RL252_SYMTH     ------------GSRASRRLRQAGFVPGIIYGPGVEPLAVSVRSTQLERL-VERQGRGHLIHVQVEGEPR
RL25_THENN      MVSLEVRLRTPKGKREAKRLRRRGEVPAVVYGPATDPIPVKIKRSLLEKVFHTITETTPIRLVIKDDEER
RL25_STAAW      MASLKSIIRQKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKV-IREVGRNGVIELGVGSKTI
RL25_STAAS      MASLKSIIRQKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKV-IREVGRNGVIELGVGSKTI
RL25_STAAN      MASLKSIIRQKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKV-IREVGRNGVIELGVGSKTI
RL25_STAAM      MASLKSIIRQKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKV-IREVGRNGVIELGVGSKTI
RL25_STAAC      MASLKSIIRQKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKV-IREVGRNGVIELGVGSKTI
RL25_STAAB      MASLKSIIRQKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKV-IREVGRNGVIELGVGSKTI
RL25_STAA3      MASLKSIIRQKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKV-IREVGRNGVIELGVGSKTI
RL25_RHOOB      -----AAVRTEFGKGXXXXXXXDGQVPAVLYGHGEDPRHLNVPSREFAAI-LRAHGTNAVLTLDIDGKEQ
RL25_GLUOX      --------------------------PAVIYGGKQEPSIIALDPRVIMKELHRGGWSSRVYNLAAEGAEV
RL25_DINSH      -----AEPRAGTGKGAARQARRDXXXXXXXXXXXADPQPIQIKFNELLRRLKAGRFMATLFNLKVEGQEV
RL25_DESVV      --TLSVQKRDNLGKGANRRLRSEEVVPGVFYDTKGNNVAVQ------MPAKPLQKLFEEVGRTTVFQLEI
RL25_DESVH      --TLSVQKRDNLGKGANRRLRSEEVVPGVFYDTKGNNVAVQ------MPAKPLQKLFEEVGRTTVFQLEI
RL25_CHLMU      --------RETDKKSVIKKIRQQGGIPAVLYSGGKSLANVVIDFNKFLSTLESGALASTVFTLSYEGREI
RL25_CHLTR      --------RETDKKSVIKKIRQQGGIPAVLYSGGKSLANIVVDFSKFLSTLESGALASTVFTLSYEGREI
RL25_CHLTB      --------RETDKKSVIKKIRQQGGIPAVLYSGGKSLANIVVDFSKFLSTLESGALASTVFTLSYEGREI
RL25_CHLTA      --------RETDKKSVIKKIRQQGGIPAVLYSGGKSLANIVVDFSKFLSTLESGALASTVFTLSYEGREI
RL25_CHLT2      --------RETDKKSVIKKIRQQGGIPAVLYSGGKSLANIVVDFSKFLSTLESGALASTVFTLSYEGREI
RL25_STAHJ      MASLKSIIRQKQTRSDLKKLRNTGKVPAVVYGYGTKNTSVKVDEVEFIKVIREVG-RNGVIDLGVGSKSI
RL25_NITWN      ---LKATARPKSGKXXXXXXXXXXXVPAVIYGNKQPPQPISVEEPELRQRILAGRFLTTIFDINLDGKKH
RL25_METPB      ------------------------QIPAVIYGGNQAPEAIAVDLIRTRTLIYAGGFKTTLFDITVGGKKT
RL25_LYSSC      MSTVLSVTKRETGRSTLTQLRKGGAIPAVIYGYKSTPISISAKEFK-KSIQKNGQ--NSVFSLDLEGKKV
RL25_DESOH      ---LQVKTRQMAGGPTPKALRRQGFVPAIVYGHKNDPLPLAVD-DHTFRLLLKDAGQQALLSLVIDAASK
RL25_DESAP      ---LKARPRAGRGKGYRNRLKQNGLIPAVIYGKEVGSLLLEVETRAVQDILTKTG-RNALIQLRVEPEKG
RL25_BORHD      ------EGRLDFGSLRARRIRAESEIPAVVYGKESDVLHIKIKSSEFNNKFAK--FTDNTVLILSDGKEK
RL25_BACV8      ---IKGTVRTDVGKKATHELRKNNGVPCVLYGVQKLPVAFSVPTEGLRNLVYTPHIY--VVDLNIDGKIV
RL25_BACTN      -----AERSSEQAR-ALKEIRKNGGVPCVLYGAGEV-VHFTVTNEGLRNLVYTPHIY--VVDLDIDGKKV
RL25_STAES      MASLKSIIRQKQTRSDLKQLRNSGKVPAVVYGYGTKNTSVKVDEVEFIKVIREVG-RNGVIDLGVGSKTI
RL25_STAEQ      MASLKSIIRQKQTRSDLKQLRNSGKVPAVVYGYGTKNTSVKVDEVEFIKVIREVG-RNGVIDLGVGSKTI
RL25_DESDA      --TLSVQKREGYGKGPSGRLRAQKLIPGVFYTPKGENISVEMGHTTVFNLEIEENGQKTAYPVLI-----
RL25_METNO      -----------------------------IYGGGQSPQSISLDANQTHHLIYGGGFLTTVFEIEVGGRKI
RL25_CHLPB      -------------KNAAKKLRDQGKVPAVVYHKGEETIHICVDERSLKKLVHSSESHLIDLTF-PDGKEK
RL25_STAS1      MASLKSIIRQKQTRSDLKTLRNTGKVPAIVYGYGTKNTSVKVDEVEFIKVIREVG-RNGVIELGVGSKTI
RL25_METEP      ------------------------QIPAVIYGGNQAPQAIAIDLIRARTLIYAGGFKTTVFEIDAGGKKT
RL25_METC4      ------------------------QIPAVIYGGNQAPQAIAIDLIRARTLIYAGGFKTTVFEIDAGGKKT
RL25_CAUCR      ---LNVEVXXXXXXXXXXXXXXXXKVPGVLYGGGKAPVNIAVKANEFRKSLYTGKLLGHLVTLQYGEEKQ
RL25_CAUCN      ---LNVEVXXXXXXXXXXXXXXXXKVPGVLYGGGKAPVNIAVKANEFRKSLYTGKLLGHLVTLQYGEEKQ
RL25_STACT      MASLKSIIRQKQRRSDLTAIRNSGKVPAVMYGYGQKNVSVKVDEVEFIKVIREVG-RNGVIDLGVGSKTI
RL25_RHOSR      -----AAVRTEFGKGXXXXXXXDGQVPAVLYGHGEDPRHLNVPSRDFAAI-LRAHGTNAILTLDIEGKEQ
RL25_CHLAB      --------RETDKKSLLKKIRQTGGIPAVIYSGGKSLANIVVDFSKFLSSLESGALSSTIFSLSYEGRTI
RL25_ROSCS      -YTLSLEPRAVVGKKV-KRLRRSGILPATVYGKGIEPISVQVDARSFNAVYRRAGRTALVELHIAGRQPL
RL25_OLICO      --------------------------PAVIYGDNKPPVTISLDDKALRQSIFAGHFLTTLFNIDLDGQKY
RL25_CYTH3      --------RANLGKKGSKDLRLDSNVPCVLYGGESQL------HFHVPMFLFRDIIYTGVACTVLEGKQY
RL25_HELMI      -------IRREKGRGYIKELRKRGLLPAVVYGKDKPDMLISVNAKELSGLLKAMGSASAILDLQVEGSDH
RL25_GEOUR      ---LNVELRTKTGKGISRQLRRNNFIPGVVYGKGMESVPVSL----------------------------
RL25_BORT9      ------ESRLNFGSLCARRIRAKSEIPAVVYGKESDVLHIKIASNEFNKRFAK--FTDNTVLILSDGKER
RL25_BORRA      ------EGRSKFGSSCARILRAKSEIPAVVYGKESDVLHIKINSNEFDKKFAK--FTDNTVLLLNDGMVE
RL25_BORDL      ------EGRSKFGSSCARILRAKSEIPAVVYGKESDVLHIKINSNEFDKKFAK--FTDNTVLLLNDGMVE
RL25_AZOC5      -----------------------------IYGEKQEPVTISLGHKEITRIIYAGHFLTTLFEIDVDGVKH
RL25_NEOSM      --------RTSFGRNSANVLRRSGFVPAVIYGKERENINVAISVRDVSKHFAVLSG-SGVVELSCEGKVY
RL25_THETN      -------VKRETGKSAARRLKNQGYVPAIMYGTENIPLAVE-----YTKLQKLLQKYGRXXXXXXXGTTH
RL25_THEAB      --TLEALVRSVVGKKAVRRLRRQGFVPGVVYGPDVEPLSISIKRSNLIKLFHEVTEASIISLTVKDGKEV
RL25_PROVI      -------------KNDAEKIRKSGNVPAVVYHKGEETVAVSVNELELNKLVHTAE--SHIIDLFPDGKVK
RL25_PELTS      ---LEAQARTEKTRSFTHSLREKGMIPAVVYGKNVGSLSIAVDAGELQKILEGAGSNALIRMKIKENGKI
RL25_PELCD      ---LNVSQREGLGKGTARSLRREGLIPAVMYGKGVENCSLVVEPKQLAAIIGSEAGLNSLITLAFDGKVV
RL25_FERNB      ---VSAQLRSIVGKRAVRRLRATGAIPAVAYGGLEKPLSLVLNKTDFLKI-FKHITESTPLTLVVNDKEV
RL25_CHLTE      ---------REVKKNGAAKLRRLGQVPAVVYHKGEATVAISVEEISLNKLVHSSE--SHMIDLYPDGKSV
RL25_CHLP8      ---------REVKKNGAAKLRQQGMVPAVVYHKGEETVAISVDEIALDKLVHSAE--SHLIDLYPDGKSV
RL25_AZOPC      ------------GKKAVKAYRKESLIPCVLYGGNENVIHFNVFRENLRKLVYTPDVF--IVNLCIEEKLY
RL25_RHOE4      -----AVVRTEFGKGXXXXXXXDGQVPTVLYGHGEDPRHLNVPARDFARI-LRAQGTNAILTLDIEGTEQ
RL25_THEMA      MVSLEARVREVKGKXXXXXXXXXGEVPAVVYGPATEPIPVKIKRSVLEKIFHTISEATPIQLIIKDDQEK
RL25_SULDN      -------IRESIGKKGTKALRRDGYLIANIYGKGLQNLHAAFKENEYIRTVRNKETLS--FPIKVDSKEM
RL25_RHOPT      ----------------------------VIYGDNQSPLPISVEEKELRLRILAGRFLTTVFDVVLDGKKH
RL25_RHOPS      ----------------------------VIYGDNQPPLPISVEDKELRLRILAGRFLTTVFDVVLDGKKH
RL25_RHOPA      ----------------------------VIYGDNQSPLPISVEEKELRLRILAGRFLTTVFDVVLDGKKH
RL25_PHEZH      ---LNVEVXXXXXXXXXXXXXXSGMVPGVLYGGDKDPVAIAVRANEFRKALYTGKLLGHLVTLKYGNETQ
RL25_MYCPA      ---LTAAVRTETXXXXXXXXXXXXXIPAVLYGHGTDPQHLELPHDFAAVLRHAGT--NAVLTLDIDGKEQ
RL25_BORGA      ---LSCKYRTSFGSSNARRIRSKDEIPAVVYGQGNDVLHLKIKSNEFNKKFAK--FTDNTVLILDDGKER
RL25_BORBZ      ---LSCQYRSSFGSSNARRIRAKSEIPAVVYGQGK-----DVSHLRIKSSEFNAKFTDNTVLILDDGKER
RL25_TREPS      --------RVQLGKYAAVRGRKEGRLPAVMYDHRGVSVPLEL-AQQDFDRLFRALTRSTVLSLELDGGEV
RL25_TREPA      --------RVQLGKYAAVRGRKEGRLPAVMYDHRGVSVPLEL-AQQDFDRLFRALTRSTVLSLELDGGEV
RL25_METRJ      ------------------------QIPAVIYGGGQPPQSIAVDLIRTRTLIYAGGFKTTLFEINAGGKKV
RL25_LEPBL      ---IAVKKRTETGKNENNRLRSSGMIPVNIIGAGVATSG-AVNEKELAKMVHSGIRQSTLIELDVEGQQQ
RL25_LEPBJ      ---IAVKKRTETGKNENNRLRSSGMIPVNIIGAGVATSG-AVNEKELAKMVHSGIRQSTLIELDVEGQQQ
RL25_GLOVI      ---------KQRATGAQRAMRREGRIPAVLYGGTQS-LALELEQRTAEDLLKRVTINNTILPLKVEGWSG
RL25_CHLCV      --------RETDKKSLLKKIRQTGGIPAVIYSGGKSLANIVVDFGKFLSSLESGALSSTIFSLSYEGRTI
RL25_BORAP      ---LSCKYRSSFGSSNARRIRAKCEIPAVVYGQGNDVLHLKIKSSEFNKKFAK--FTDNTVLILDDGKER
RL25_AMOA5      --------RANLGKQASKQLRNDAQVPGVLYGGKETPMAIL--KDLVYTPQA------YFVTLNLEGAIY
RL25_GEOKA      ---LEAKERADKKRSTLHRIRSQGGIPAILYGKKVENKMIFVSTAE-LEKALREGGRTSLLTLKVGGEEH


                         .         .         *         .         .         .         .:140
query           KVKAQAVQRHAYKPKLTHIDFVRA
RL25_SALTY      KVKAQAVQRHAYKPKLTHIDFVRA
RL25_SALTI      KVKAQAVQRHAYKPKLTHIDFVRA
RL25_SALSV      KVKAQAVQRHAYKPKLTHIDFVRA
RL25_SALPK      KVKAQAVQRHAYKPKLTHIDFVRA
RL25_SALPC      KVKAQAVQRHAYKPKLTHIDFVRA
RL25_SALPB      KVKAQAVQRHAYKPKLTHIDFVRA
RL25_SALPA      KVKAQAVQRHAYKPKLTHIDFVRA
RL25_SALNS      KVKAQAVQRHAYKPKLTHIDFVRA
RL25_SALHS      KVKAQAVQRHAYKPKLTHIDFVRA
RL25_SALEP      KVKAQAVQRHAYKPKLTHIDFVRA
RL25_SALDC      KVKAQAVQRHAYKPKLTHIDFVRA
RL25_SALCH      KVKAQAVQRHAYKPKLTHIDFVRA
RL25_SALA4      KVKAQAVQRHAYKPKLTHIDFVRA
RL25_SALG2      KVKAQAVQRHAYKPKLTHIDFVRA
RL25_SALAR      KVKAQAVQRHAFKPKLTHIDFIRA
RL25_CITK8      KVKAQAVQRHAFKPKLTHIDFVRA
RL25_SHISS      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_SHIFL      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_SHIDS      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_ECOSE      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_ECOLI      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_ECOLC      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_ECOHS      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_ECODH      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_ECOBW      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_ECO8A      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_ECO55      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_ECO24      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_SHIB3      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_ECO5E      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_ECO57      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_SHIBS      KVKAQDVQRHPYKPKLQHIDFVRA
RL25_ECOSM      KVKAQDVQRHPYKPKLLHIDFVRA
RL25_ECOLU      KVKAQDVQRHPYKPKLLHIDFVRA
RL25_ECOL6      KVKAQDVQRHPYKPKLLHIDFVRA
RL25_ECOL5      KVKAQDVQRHPYKPKLLHIDFVRA
RL25_ECO81      KVKAQDVQRHPYKPKLLHIDFVRA
RL25_ECO7I      KVKAQDVQRHPYKPKLLHIDFVRA
RL25_ECO45      KVKAQDVQRHPYKPKLLHIDFVRA
RL25_ECO27      KVKAQDVQRHPYKPKLLHIDFVRA
RL25_ENTS8      KVKVQAVQRHPYKPKLHHIDFVRA
RL25_ESCF3      KVKAQDVQRHPYKPKLLHIDFVRA
RL25_KLEP3      KVKVQAVQRHAFKPKLTHIDFVRA
RL25_PHOLL      KVKVQAVQRHPFKPKLAHIDFLRA
RL25_ERWT9      KVKVQAVQRHPFKPKLHHIDFVRA
RL25_SERP5      KVKVQAVQRHPFKPKLAHIDFRR-
RL25_SODGM      KVKVQAVQRHSFKPKLTHIDFVRA
RL25_ENT38      KVKVQAVQRHPFKPKLSHVDFVRA
RL25_EDWI9      KVKIQAVQRHPYKPKITHIDFVRA
RL25_KLEP7      XXXXQAVQRHAFKPKLTHIDFVRA
RL25_YERPY      KVKVQAVQRHAFKPKLTHIDFVR-
RL25_YERPS      KVKVQAVQRHAFKPKLTHIDFVR-
RL25_YERPP      KVKVQAVQRHAFKPKLTHIDFVR-
RL25_YERPN      KVKVQAVQRHAFKPKLTHIDFVR-
RL25_YERPG      KVKVQAVQRHAFKPKLTHIDFVR-
RL25_YERPE      KVKVQAVQRHAFKPKLTHIDFVR-
RL25_YERPB      KVKVQAVQRHAFKPKLTHIDFVR-
RL25_YERPA      KVKVQAVQRHAFKPKLTHIDFVR-
RL25_YERP3      KVKVQAVQRHAFKPKLTHIDFVR-
RL25_PECCP      QVKVQAVQRHVYKPKLTHIDFVR-
RL25_PROMH      KVKVKAVQRHEYKPKITHIDFLRA
RL25_ERWCT      QVKVQAVQRHVYKPKLTHIDFVR-
RL25_YERE8      KVKVQAVQRHAFKPKLTHIDFVR-
RL25_ACTSZ      AVKVQAMQRHPFKPKLVHIDFKRA
RL25_HAEIN      AVKVQAMQRHPFKPKLVHIDFKRA
RL25_PASMU      AVKAQAMQRHPFKPKLVHIDFKR-
RL25_HAEIG      AVKVQAMQRHPFKPKLVHIDFKRA
RL25_HAEIE      AVKVQAMQRHPFKPKLVHIDFKRA
RL25_HAEI8      AVKVQAMQRHPFKPKLVHIDFKRA
RL25_MANSM      AVKVQAMQRHPFKPKLVHIDFKRA
RL25_HAES2      SVKVQAMQRHPFKPKLVHIDFKR-
RL25_HAES1      SVKVQAMQRHPFKPKLVHIDFKR-
RL25_TOLAT      KVKVAAVQRHPVKPKVVHLDFIRA
RL25_PASPI      QVKPQDIQRHPYKPKVNHMDFKR-
RL25_VIBF1      KVKPQDVQRHAFKPKVEHMDFIR-
RL25_ACTPJ      QVKVQAIQRHPTKPKLVHLDFKRA
RL25_ACTP7      QVKVQAIQRHPTKPKLVHLDFKRA
RL25_VIBFM      KVKPQDVQRHAFKPKVEHMDFIR-
RL25_ALISL      KVKPQDVQRHAFKPKVEHMDFIR-
RL25_SHEB9      GVRAQAMQRHVFKPLIEHVDFVYA
RL25_SHEB8      GVRAQAMQRHVFKPLIEHVDFVYA
RL25_SHEB5      GVRAQAMQRHVFKPLIEHVDFVYA
RL25_SHEB2      GVRAQAMQRHVFKPLIEHVDFVYA
RL25_ACTP2      QVKVQAIQRHPTKPKLVHLDFKR-
RL25_VIBVY      KVKPQDVQRHAFKPKVEHMDFIR-
RL25_VIBVU      KVKPQDVQRHAFKPKVEHMDFIR-
RL25_SHESH      KVRVQAMQRHAFKGLIEHIDF---
RL25_SHESR      GVRAQAMQRHAFKPMIEHVDFVYA
RL25_SHESM      GVRAQAMQRHAFKPMIEHVDFVYA
RL25_SHESA      GVRAQAMQRHAFKPMIEHVDFVYA
RL25_VIBSL      KVKPQDVQRHAFKPKVEHMDFIR-
RL25_VIBCM      KVKPQDVQRHAYKPKVEHMDFIR-
RL25_VIBCH      KVKPQDVQRHAYKPKVEHMDFIR-
RL25_VIBC3      KVKPQDVQRHAYKPKVEHMDFIR-
RL25_SHEON      GVRAQAMQRHAFKPIIEHVDFVYA
RL25_SHEAM      NVRAQAMQRHVFKPMIDHVDFVYA
RL25_HAEPS      QVKVQAIQRHPTKPKLVHLDFKR-
RL25_HAEDU      QVKVQAIQRHPTKPKLLHLDFKR-
RL25_SHEDO      KVRAKAMQRHAFKPLIEHADFM--
RL25_SHESW      GVRAQAMQRHVFKPIIEHVDFVYA
RL25_SHEPC      GVRAQAMQRHVFKPIIEHVDFVYA
RL25_PHOPR      AVKPQDIQRHVFKPKVEHMDFKR-
RL25_SHELP      KVRVQAMQRHAFKPMIEHVDF---
RL25_ALTMD      EVLVKDMQRHPYKPKIMHIDFQR-
RL25_AERS4      NVKVKAIQRHPVKPKLVHLDFVR-
RL25_SHEWM      KVSVKAMQRHAFKPLIEHVDFTYA
RL25_BUCAT      KVKVQAIQRHSFKSKLLHIDFL--
RL25_BUCAI      KVKVQAIQRHSFKSKLLHIDFL--
RL25_BUCA5      KVKVQAIQRHSFKSKLLHIDFL--
RL25_SHEHH      KVRVQDMQRHAFKPMIEHVDF---
RL25_SHEPW      AVRVQDMQRHAFKPLIEHIDF---
RL25_IDILO      QAILKDMQRHPYKPKLTHLDFQR-
RL25_SHEFN      KVRVKAIQRHAFKQLVEHIDFMFA
RL25_SHEPA      KVRVQDMQRHAFKPMIEHVDF---
RL25_BUCAP      TVKVHAIQRHAFKMKILHIDFIYA
RL25_FRATO      KVIIKALQRHPYKVKLIHADFMR-
RL25_FRATH      KVIIKALQRHPYKVKLIHADFMR-
RL25_FRATF      KVIIKALQRHPYKVKLIHADFMR-
RL25_PSEA6      EAVIKDMQRHPFKPRVTHLDFLR-
RL25_FRATW      KVIIKALQRHPYKVKLIHADFMR-
RL25_FRATT      KVIIKALQRHPYKVKLIHADFMR-
RL25_FRATN      KVIIKALQRHPYKVKLIHADFMR-
RL25_FRATM      KVIIKALQRHPYKVKLIHADFMR-
RL25_FRAT1      KVIIKALQRHPYKVKLIHADFMR-
RL25_COLP3      ECLIKDMQRHPFKQVVMHLDFLR-
RL25_DECAR      QVLLRDTQVHAYKPLVLHVDFQR-
RL25_VIBPA      KVKPQDVQRHAFKPKVEHMDFIR-
RL25_PSEHT      ETILKDIQRHPFKPKVTHLDFQR-
RL25_HAHCH      SVILKDLQRHPYKPIIMHADFLR-
RL25_VIBHB      KVKPQDVQRHAFKPKVEHMDFIR-
RL25_XYLFT      KVLLRDLQRHPYRQLVMHVDFQR-
RL25_XYLF2      KVLLRDLQRHPYRQLVMHVDFQR-
RL25_METCA      NAILKAVQRHPAKPVVMHLDFQR-
RL25_XYLFM      KVLLRDLQRHPYRQLVMHVDFQR-
RL25_XYLFA      KVLLRDLQRHPYRQLVMHVDFQR-
RL25_NITMU      KVLLRDIQMHPFKPQVLHIDFQR-
RL25_CHRVO      QVKVAAFQMHPYKQQVLHIDFAR-
RL25_XANOR      QVLLRDIQRHPFKQLIMHIDFQR-
RL25_XANOM      QVLLRDIQRHPFKQLIMHIDFQR-
RL25_THIDA      SVLLRDAQWHPYKQQVLHVDFQR-
RL25_THISH      KAILRDVQRHPCKPIILHLDLLR-
RL25_DICNV      EILVRDVQHHIYKPLFQHFDFQR-
RL25_LEGPL      HVILKALQRHPYKPIVLHMDLQR-
RL25_LEGPH      HVILKALQRHPYKPIVLHMDLQR-
RL25_LEGPC      HVILKALQRHPYKPIVLHMDLQR-
RL25_LEGPA      HVILKALQRHPYKPIVLHMDLQR-
RL25_BORA1      QVLLRSVQWHPFKQQVLHVDFQR-
RL25_XANCP      QVLLRDMQRHPFKQLIMHIDFQR-
RL25_XANCB      QVLLRDMQRHPFKQLIMHIDFQR-
RL25_XANC8      QVLLRDMQRHPFKQLIMHIDFQR-
RL25_XANC5      QVLLRDMQRHPFKQLIMHIDFQR-
RL25_XANAC      QVLLRDMQRHPFKQLIMHIDFQR-
RL25_NITOC      RVVLKALQRDPVNPKVLHLDLQR-
RL25_RUTMC      AVIIKDLQRHPAKNIVTHVDFLR-
RL25_CELJU      SVILKDVQRHPSKAQVLHLDFLR-
RL25_VESOH      AVIIKNLQRHPAKNSITHIDFLR-
RL25_RALME      KALLRAFQMHPFKPLVLHVDFQR-
RL25_LEPCP      KVVLRALQMHAFKQLVLHVDFQR-
RL25_CUPTR      KALLRAFQMHPFKPLVLHVDFQR-
RL25_RALEJ      KALLRAFQMHPFKPLVLHVDFQR-
RL25_POLSQ      KVLLRDYQMHPFKPLVLHIDFQR-
RL25_MARAV      SVILKDLQRHPYKPILTHADFLR-
RL25_RALEH      QALLRAFQMHPFKPLVLHVDFQR-
RL25_JANMA      QVLLRDFQVHAYKQLVLHADFQR-
RL25_BURM1      QVLLRDVQYHPFKQLVLHVDFQR-
RL25_BORPD      AVLLRSVQWHAYKPQVLHVDFQR-
RL25_VEREI      KVLLRDVQYHPFKQCVLHIDFQR-
RL25_BUCBP      IVKIQEIQRHAFKSKILHIDFLK-
RL25_ACIAC      KVLLRDVQYHPYKQLVLHIDFQR-
RL25_DIAST      KVLLRDVQYHPFKQQVLHVDFQR-
RL25_CHRSD      QVIIRDIQRHPYKALVTHADFMR-
RL25_ACISJ      KVLLRDVQYHPFKQQVLHVDFQR-
RL25_RHOFD      KVLLRDVQMHPFKQLILHVDFQR-
RL25_POLNA      KVLLRDLQMHPYKQQVQHIDFQR-
RL25_BURS3      QVLLRDVQYHPFKQLVLHVDFQR-
RL25_BURCM      QVLLRDVQYHPFKQLVLHVDFQR-
RL25_BURA4      QVLLRDVQYHPFKQLVLHVDFQR-
RL25_ACIBT      NVKIQALQRHPAKNTPMHADFKRA
RL25_PSYA2      QVVIKDLQRHPAKGFPMHADFQR-
RL25_BURTA      RVLLRDVQYHPFRQLVLHVDFQR-
RL25_BURPS      RVLLRDVQYHPFRQLVLHVDFQR-
RL25_BURP1      RVLLRDVQYHPFRQLVLHVDFQR-
RL25_BURMS      RVLLRDVQYHPFRQLVLHVDFQR-
RL25_BURMA      RVLLRDVQYHPFRQLVLHVDFQR-
RL25_BURM7      RVLLRDVQYHPFRQLVLHVDFQR-
RL25_ACIB5      NVKIQALQRHPAKNTPMHADFKRA
RL25_ACIB3      NVKIQALQRHPAKNTPMHADFKRA
RL25_METPP      QVLLRDVQMHAFRPQVLHVDFQR-
RL25_BURP6      RVLLRDVQYHPFRQLVLHVDFQR-
RL25_PSYIN      QVVLKDLQRHAFKARIQHLDLLR-
RL25_BURCH      QVLLRDVQYHPFKQLVLHVDFQR-
RL25_BURCC      QVLLRDVQYHPFKQLVLHVDFQR-
RL25_BURCA      QVLLRDVQYHPFKQLVLHVDFQR-
RL25_PSEFS      NVIVKAMQRHPSKQFIMHADFVR-
RL25_HERAR      QVLLRDFQVHAYKQLVLHADFQR-
RL25_FRAP2      RVIIKALQRHPYKVKLVHADFMR-
RL25_PSYCK      QVVIKDLQRHPAKGFPMHADFQR-
RL25_PSEU5      SVLIKALQRHPAKGFVLHADFVR-
RL25_POLSJ      KVLLRDLQMHPFKQQVLHIDFQR-
RL25_POLNS      KVLLRDYQMHPFKPLVLHIDFQR-
RL25_BURVG      QVLLRDVQYHPFKQLVLHVDFQR-
RL25_NITEU      QVLLRDVQMHPFKQQVLHIDFQR-
RL25_DELAS      KVVLRDVQFHPYKQLILHVDFQR-
RL25_PSYWF      LAVIKDLQRHPSKGFAMHADFQR-
RL25_PSEPW      NVVVKAMQRHPAKGFIMHADFVR-
RL25_BORPA      EVLLRSVQWHAYKPQVMHVDFQR-
RL25_BORBR      EVLLRSVQWHAYKPQVMHVDFQR-
RL25_VARPS      KVLLRDVQYHPFRQLVQHIDFQR-
RL25_RALSO      KALLRDFQLHPFKQLVLHVDFQR-
RL25_PSEPK      NVVVKALQRHPAKGFIMHADFVR-
RL25_PSEPG      NVVVKAMQRHPAKGFIMHADFVR-
RL25_BORPE      EVLLRSVQWHAYKPQVMHVDFQR-
RL25_RALPJ      KALLRDFQLHPFKQLVLHVDFQR-
RL25_AZOSE      TVVLRDVQWHPYKQQVLHLDFQR-
RL25_NEIMF      DVIVRDFQMHPFRREVQHIDF---
RL25_NEIMB      DVIVRDFQMHPFRREVQHIDF---
RL25_NEIMA      DVIVRDFQMHPFRREVQHIDF---
RL25_NEIM0      DVIVRDFQMHPFRREVQHIDF---
RL25_NEIG2      DVIVRDFQMHPFRREVQHIDF---
RL25_NEIG1      DVIVRDFQMHPFRREVQHIDF---
RL25_MARMS      QVLVKALQRHPSTGAVMHMDLQRA
RL25_RICFE      KVLPKAVELHPVTDIVRHVDFV--
RL25_PSEA7      TVLIKALQRHPAKGFVMHADFLR-
RL25_AZOVD      TVLIKALQRHPSKAAVMHADFLR-
RL25_SPHAL      RTLPKDVAFHPVKDRPIHADFLR-
RL25_RICCK      KVLPKAVELHPVTDIVRHVDFV--
RL25_PSEE4      NVVVKAMQRHPAKGFIMHADFVR-
RL25_BURP8      QVLLRDVQYHPFRQLVLHVDFQR-
RL25_ALCBS      QAVLRDMQRHPAKGHPLHVDLLR-
RL25_PSEAE      TVLIKALQRHPAKGFVMHADFLR-
RL25_PSEAB      TVLIKALQRHPAKGFVMHADFLR-
RL25_PSEA8      TVLIKALQRHPAKGFVMHADFLR-
RL25_BLOPB      TVKVQELQYHPFKSKLIHIDFTR-
RL25_RICBR      KVLPKAVELHPVTDIVRHVDFV--
RL25_RICB8      KVLPKAVELHPVTDIVRHVDFV--
RL25_NOVAD      RTLPKDVAFHPVTDRPEHADFLR-
RL25_NITEC      QVLLRDVQMHPFKQQVLHIDFQR-
RL25_RICPR      KVLPKAVELHPVTDIVRHVDFV--
RL25_RHOSK      RVICRGVQRDVVKDLPTHVDFMR-
RL25_RHOS5      RVICRGVQRDVVKDLPTHVDFMR-
RL25_RHOS4      RVICRGVQRDVVKDLPTHVDFMR-
RL25_RHOS1      RVICRGVQRDVVKDLPTHVDFMR-
RL25_COXBU      KVILKALQRHHTKPKIVHIDFQR-
RL25_COXBR      KVILKALQRHHTKPKIVHIDFQR-
RL25_COXBN      KVILKALQRHHTKPKIVHIDFQR-
RL25_COXB2      KVILKALQRHHTKPKIVHIDFQR-
RL25_COXB1      KVILKALQRHHTKPKIVHIDFQR-
RL25_THICR      NCIIKDLQRHPATGFITHIDFQRA
RL25_RICTY      KVLPKAVELHPVTDIVRHVDFV--
RL25_PSEP1      NVIIKAMQRHPAKQFIMHADFVR-
RL25_RICAH      KVLPKAVELHPVTDMVRHVDFV--
RL25_PSEMY      NVVIKALQRHPAKGFVLHADFQR-
RL25_BURXL      QVLLRDVQYHPFRQLVLHVDFQR-
RL25_BURPP      QVLLRDVQYHPFRQLVLHVDFQR-
RL25_SPHWW      RTLPKDVQFHPVTDRPLHVDFLR-
RL25_AGRT5      KVLPKDYQLDPVRDFTMHVDFLR-
RL25_METFK      QVVLRDYQLHPVRNTIQHIDFQR-
RL25_RHIEC      KVLPKDYQLDPVRDFTLHVDFLR-
RL25_ERYLH      RTLPKDVALHPVSDRPEHADFFR-
RL25_RHILO      QVLPKDFQLDPVKDFPVHVDFLR-
RL25_KOCRD      LAMIKEVQRHAVRPEILHIDLL--
RL25_ALHEH      QVIVKDLQRHPFKPLVEHVDLQR-
RL25_OCHA4      QVLPKDYQLDPVRDFPQHVDFLR-
RL25_BRUSU      QVLPKDYQLDPVRDFPQHVDFLR-
RL25_BRUSI      QVLPKDYQLDPVRDFPQHVDFLR-
RL25_BRUME      QVLPKDYQLDPVRDFPQHVDFLR-
RL25_BRUMB      QVLPKDYQLDPVRDFPQHVDFLR-
RL25_BRUC2      QVLPKDYQLDPVRDFPQHVDFLR-
RL25_BRUAB      QVLPKDYQLDPVRDFPQHVDFLR-
RL25_BRUA2      QVLPKDYQLDPVRDFPQHVDFLR-
RL25_BRUA1      QVLPKDYQLDPVRDFPQHVDFLR-
RL25_ANAMM      FALTKEIQKHPVSGAVSHVDF---
RL25_ANAMF      FALTKEIQKHPVSGAVSHVDF---
RL25_ZYMMO      PTIPKDVQFHPVTDRVLHVDFLR-
RL25_PARL1      RVIPRDVQFEPVRDFIIHVDFLR-
RL25_SINMW      RVLPKDYQLDPVRDFTMHVDFLR-
RL25_PARDP      RVVCRGVQRDVVKDLPTHIDFMR-
RL25_BARHE      MVLPKDYQLDPVRDFPLHVDFLR-
RL25_SACD2      QVILKDLQRHPATNFAMHADFLR-
RL25_EHRCR      YVLMRDVQKHPVTDRIQHVDF---
RL25_ACIAD      XXXIQALQRHPAKNTPMHADFKRA
RL25_JANSC      RVICRNVQRDVVKDLPTHVDFMR-
RL25_BEII9      RVVPRDYQLDPVKGQPLHVDFLR-
RL25_MOOTA      TAVIREVQRHPLKGNLTHVDF---
RL25_BART1      MVLPKDYQLDPVRDFPLHVDFLR-
RL25_BARBK      QVLPKDYQLDPVRDFPMHVDFLR-
RL25_MESSB      QVLPKDYQLDPVRGFAMHVDFLR-
RL25_AZOSB      TVVLRDTQWHAYKQQVLHIDFQR-
RL25_RICRS      KVLPKAVELHPVTDIVRHVDFV--
RL25_RICRO      KVLPKAVELHPVTDIVRHVDFV--
RL25_RICPU      KVLPKAVELHPVTDIVRHVDFV--
RL25_RICCN      KVLPKAVELHPVTDIVRHVDFV--
RL25_RICAE      KVLPKAVELHPVTDIVRHVDFV--
RL25_BARQU      MVLPKDYQLDPVRDFPIHVDFLR-
RL25_ROSDO      RVICRDVQRHVVKDLPTHIDFMR-
RL25_RHIME      RVLPKDYQLDPVRDFTMHVDFLR-
RL25_PSEPF      NVIIKALQRHPAKGHVMHADFVR-
RL25_STRAW      LAIPKAVQRDAIKGFLEHVDLL--
RL25_SILPO      RVICRDVQRDVVKDLPTHLDLMR-
RL25_EHRRW      YVLMRDIQKHPVTDRIQHVDF---
RL25_EHRRG      YVLMRDIQKHPVTDRIQHVDF---
RL25_DESDG      PCLIWQIERHPYKPFFTHVD----
RL25_ANAPZ      YVITKDIQKHPVSGAIAHVDF---
RL25_BIFLI      MAVVKDVQKNPVKRIIEHIDFL--
RL25_ANADF      HVLFKDWAVDPVSRKLEHADFL--
RL25_ORITI      KVLPKAVQLHPVTEFINHIDFI--
RL25_ORITB      KVLPKAVQLHPVTEFMNHIDFI--
RL25_BIFLO      MAVVKDVQKNPVKRIIEHVDFL--
RL25_BIFLD      MAVVKDVQKNPVKRIIEHVDFL--
RL25_PSEF5      NVVIKALQRHPAKGHVMHADFVR-
RL25_PELUB      NVLPREITYNVISDEPTHIDFLR-
RL25_ANASK      HVLFKDYTVDPVTRKLLHADFL--
RL25_ANAD2      HVLFKDYTVDPVTRKLLHADFL--
RL25_PSEU2      NVIIKALQRHPAKGHVMHADFVR-
RL25_PSESM      NVIIKALQRHPAKGHVLHADFVR-
RL25_ANADE      HVLFKDYTVDPVTRKLLHADFL--
RL25_ACICJ      RALMRDIQLHPVTDQPEHVDFQR-
RL25_PSE14      NVIIKALQRHPAKGHVMHADFVR-
RL25_DESPS      KVVIAEIQSDPVTDALVHVDF---
RL25_FINM2      TVIIKDVQKHPFKNHYVHVDF---
RL25_PELPD      MAIVADLQRDAVKGTYKHVDLHR-
RL25_MYCLE      LALTKAIDVHPIRHTIMHADLL--
RL25_CORJK      LVMIKAVDQNVLTLDVDHADLL--
RL25_ELUMP      AI-IKEVQYHVVKDTPNHVDFQR-
RL25_GEOBB      ------------------------
RL25_CAUSK      SVIAKAVQFHPVTDEPLHFDLYR-
RL25_PROAC      LALPKDVQRDVLKGFVRHVDLL--
RL25_GEOLS      VVIVAEIQRDALKRTPEHVDLHR-
RL25_DESMR      PALVWKVEHHPTKPRITHVDF---
RL25_SORC5      TVMVRDYDYHPISRELVHADFIQ-
RL25_METSB      RVIPRDYQLDPIKDLPLHVDFLR-
RL25_EHRCJ      YVLMRDVQKHPVTDRIQHVDF---
RL25_CORGL      LTMIKHIDQNVLTFHIDHLDLL--
RL25_WOLPP      YALVRDIQWHVVKDTVQHVDF---
RL25_LARHH      QVFVRDVQMHAFKPQVQHIDFQR-
RL25_CORGB      LTMIKHIDQNVLTFNIDHLDLL--
RL25_CARHZ      RVLVKELQHHPVTGKLIHVDF---
RL25_TREDE      EVFIKDFQHDIVSDKIKHIDF---
RL25_THEYD      QAILQDYQVDPVTGKLLHVDFM--
RL25_THEPX      NAVIKEIQEDTLKGKIIHVDFQR-
RL25_THEP3      NAVIKEIQEDTLKGKIIHVDFQR-
RL25_CORU7      LVMVKAIDQNVLTLDIDHADLL--
RL25_WOLTR      YALVRDIQWHVVKDTIQHVDF---
RL25_MARMM      TVIARDIQFHPVSDKAMHIDLYR-
RL25_HALOH      KETAKDLQRDPVQGNILHVDF---
RL25_HALHL      QAIVKDLQRHPFKPLVQHIDLQR-
RL25_PORGI      KAILKEIQFHPVTDRIIHIDFLQ-
RL25_PORG3      KAILKEIQFHPVTDRIIHIDFLQ-
RL25_GEOSM      ------------------------
RL25_BLOFL      TAKIQDVQYHPYKSNIIHIDFI--
RL25_RHORT      RVMVQDVQFHPVTDMPIHVDFLR-
RL25_GEOSL      VIVAD-MQRNPLKGDILHVDFHR-
RL25_GEOMG      ------------------------
RL25_CORDI      LTMIKHVDQNVLTLNADHVDLL--
RL25_THESQ      TVFLKMVQRDKVSETVVHLDF---
RL25_SYNFM      KVLIREVQVHPVRRRFLHVDF---
RL25_WOLWR      YALVRDIQLHVVKDTVQHVDF---
RL25_WOLPM      YALVRDIQLHVVKDTVQHVDF---
RL25_OCEIH      DVMLHDYQIDPIKDELLHADF---
RL25_SILST      RVICRDVQRDVVKDLPTHFDLMR-
RL25_GLUDA      PALMREIQLHPVSDKPIHVDFQR-
RL25_FLAPJ      NAVMQDIQVHPVTDKILHLDF---
RL25_BACFR      NAILKDIQFHPVKDTILHVDF---
RL25_BACFN      NAILKDIQFHPVKDTILHVDF---
RL25_THEP1      TVFLKMIQRDKVSETVVHLDF---
RL25_STRCO      ELAPKSVQRDPIKGFLEHVD----
RL25_METS4      RAIPRDYQLDPVKDTPLHVDFLR-
RL25_FLAJ1      NAILQDIQVHPVTDKILHIDF---
RL25_COREF      LAMIKHIDQNVLTFNIDHVDLL--
CTC_BACSU       SVMVTDLQTDPLKNEITHADF---
RL25_DESVM      KSTHPAIQYHPVKNRFSHIDF---
RL25_BACA2      SVMVTDLQTDPLKNELTHADF---
RL25_AKKM8      KVLLKEVQHNPITNACLHVDF---
RL251_SYMTH     VIK--QLQRDVLTAQVTHVDFLQ-
RL25_THEFY      LVLPKSVQRDPIKGFLEHVDLL--
RL25_GEOSF      ------------------------
RL25_DESRM      TVMVKSLQMDPMHQNIRHVDF---
RL25_BACP2      SVMVTELQTDPLKNELVHADF---
RL25_SYNWW      MTLIREIQRNPVSGQLIHLDFL--
RL25_MAGSA      CL-ARDVQMHPVTDQPIHVDFMR-
RL25_GEOTN      SVLLREVQRDPLRGELLHADF---
RL25_DESAH      TVMLKEIQMDTFDLKYLHVDF---
RL25_SYNAS      MEKNSLIRELQIEPNFFHADF---
RL25_STAAR      KVMVADYQFDPLKNQITHIDFL--
RL25_ROSS1      AAFIHALQRHPVTRDIIHADF---
RL25_GRAFK      DAILQDIQFHPLTDAILHIDF---
RL25_DESAA      PRKAKELQTNVVSQRYLHADF---
RL252_SYMTH     QVVIKQLQRDILTQQVTHVDFLQ-
RL25_THENN      TVSEKTVQRDKVSEAIVHVDF---
RL25_STAAW      KVMVADYQFDPLKNQITHIDFL--
RL25_STAAS      KVMVADYQFDPLKNQITHIDFL--
RL25_STAAN      KVMVADYQFDPLKNQITHIDFL--
RL25_STAAM      KVMVADYQFDPLKNQITHIDFL--
RL25_STAAC      KVMVADYQFDPLKNQITHIDFL--
RL25_STAAB      KVMVADYQFDPLKNQITHIDFL--
RL25_STAA3      KVMVADYQFDPLKNQITHIDFL--
RL25_RHOOB      VALTKSVVVHPIRNYIEHADLL--
RL25_GLUOX      AALIRDVQLHPVTDAPIHVDFQR-
RL25_DINSH      RVICRNVQRDVVKDLPTHLDLMR-
RL25_DESVV      EEEGKKSTHHPYKKKFTHIDF---
RL25_DESVH      EEEGKKSTHHPYKKKFTHIDF---
RL25_CHLMU      KALVKDIQYHVTTYDVIHLDF---
RL25_CHLTR      KALVKDIQYHVTTYDVIHLDF---
RL25_CHLTB      KALVKDIQYHVTTYDVIHLDF---
RL25_CHLTA      KALVKDIQYHVTTYDVIHLDF---
RL25_CHLT2      KALVKDIQYHVTTYDVIHLDF---
RL25_STAHJ      KVMVSDYQFDPLKNQITHIDFL--
RL25_NITWN      RVIPRDFHLDPVKDFPIHVDFMR-
RL25_METPB      RAIPRDYQLDPVSGVPLHVDFLR-
RL25_LYSSC      NVVVSEVQQCSLKDEVNHVDFL--
RL25_DESOH      TVMLKELQQHPVSLKLIHADF---
RL25_DESAP      RAKIKDVHMHPYKNEFFHVDF---
RL25_BORHD      CVFIKDVSENLTKRLIYHVDF---
RL25_BACV8      NAILKDIQFHPVTDAILHVDF---
RL25_BACTN      NAILKDIQFHPVKDNILHVDF---
RL25_STAES      KVMVSDYQFDPLKNQITHIDFL--
RL25_STAEQ      KVMVSDYQFDPLKNQITHIDFL--
RL25_DESDA      ----WQVQFHPYKRAFTHIDF---
RL25_METNO      RAIPRDYQLDPVKDLPLHVDFLR-
RL25_CHLPB      RSFLKEVQFDPVTDKIIHADF---
RL25_STAS1      KVMVSDYQFDPLKNQITHIDFL--
RL25_METEP      RAIPRDYQLDPVSGVPLHVDFLR-
RL25_METC4      RAIPRDYQLDPVSGVPLHVDFLR-
RL25_CAUCR      SVIAKAVQFHPVTDEPVHFDLYR-
RL25_CAUCN      SVIAKAVQFHPVTDEPVHFDLYR-
RL25_STACT      KVMVADYQFDPLKNQITHIDFL--
RL25_RHOSR      VALTKSVVVHPIRNYIEHADLL--
RL25_CHLAB      KALVKDIQYHVTSYRVIHLDF---
RL25_ROSCS      AAFIHALQRHPVTRDIIHADF---
RL25_OLICO      RVIPRDYALDPVKDFPLHVDFLR-
RL25_CYTH3      KCVVQEVQFHPINEMLLHVDFL--
RL25_HELMI      KVMLKEMQRDPVGRMPNHVDF---
RL25_GEOUR      ------------------------
RL25_BORT9      CVFIKDVSENITKGLIYHVDF---
RL25_BORRA      KVFIKDVSENLTKKFIYHIDF---
RL25_BORDL      KVFIKDVSENLTKKFIYHIDF---
RL25_AZOC5      RVIPRDYQLDPVKDLPLHVDFLR-
RL25_NEOSM      KVVPKAYELHPVSSVVLHLDFVFA
RL25_THETN      TALIKEIQEDTLKGKIIHVDFQR-
RL25_THEAB      DVFIKNVQYDKLTDEVKHVDF---
RL25_PROVI      RSFIKAVQFHPVTDRIIHTDF---
RL25_PELTS      RVLVKEVQRDPVRRELIHADF---
RL25_PELCD      ILKDMQVDPIRQTP--LHVDF---
RL25_FERNB      LAFIKMVQYDKVTDEVKHVDF---
RL25_CHLTE      RSFIKDVQFDPVTDRVIHADF---
RL25_CHLP8      RAFIKDLQFDPVTDRVIHADFKR-
RL25_AZOPC      LSILKEIQFHPVNDEILHVDFLR-
RL25_RHOE4      VALTKSVVVHPIRSYIEHADLL--
RL25_THEMA      TVFLKMVQRDKVSETVVHLDF---
RL25_SULDN      NVVVQAYEAHPVTGKLLHVDLMVA
RL25_RHOPT      RVIPRDYHLDPVRDFPIHVDFLR-
RL25_RHOPS      RVIPRDYHLDPVKDFPIHVDFLR-
RL25_RHOPA      RVIPRDYHLDPVRDFPIHVDFLR-
RL25_PHEZH      PVIAKAVDMHPVTDEPQHFDLYR-
RL25_MYCPA      LALTKALDIHPIRRTIQHADLL--
RL25_BORGA      CVFIKDVSENIASKLIYHIDF---
RL25_BORBZ      CVFVKDVAENIASKLIYHIDF---
RL25_TREPS      CVFVKDYQHNMVSDRVEHVDF---
RL25_TREPA      CVFVKDYQHNMVSDRVEHVDF---
RL25_METRJ      RAIPRDFQLDPVTGVPLHVDFLR-
RL25_LEPBL      KVFVKEIQRFPEIDRIRHVDFYK-
RL25_LEPBJ      KVFVKEIQRFPEIDRIRHVDFYK-
RL25_GLOVI      DVLLREVQHDAVGGKLLHLSF---
RL25_CHLCV      KALVKDIQYQVTSYRVIHLDF---
RL25_BORAP      CVFVKDVAENIASKLIYHIDF---
RL25_AMOA5      NCILQDIQFHPVNEVILHIDLLQ-
RL25_GEOKA      SVLLRELQRDPLRGHLLHADF---