[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF65947.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1brfA.bssp"
#ERROR : Can't open dsspfile "1be7A.bssp"
#ERROR : Can't open dsspfile "1bq8A.bssp"
#ERROR : Can't open dsspfile "1b2jA.bssp"
#ERROR : Can't open dsspfile "1b2oA.bssp"
#ERROR : Can't open dsspfile "1b13A.bssp"
#ERROR : Can't open dsspfile "1bfyA.bssp"
#ERROR : Can't open dsspfile "1c09A.bssp"
#ERROR : Can't open dsspfile "2dsxA.bssp"
#ERROR : Can't open dsspfile "1dx8A.bssp"

## Summary of PDB Search
:353
    6e-15  40%  1brfA  [g.41.5] PROTEIN (RUBREDOXIN)
    1e-13  35%  1be7A  [x.x.x] RUBREDOXIN
    4e-13  41%  1bq8A  [g.41.5] PROTEIN (RUBREDOXIN)
    4e-13  37%  1b2jA  [g.41.5] PROTEIN (RUBREDOXIN)
    6e-13  37%  1b2oA  [g.41.5] PROTEIN (RUBREDOXIN)
    1e-12  37%  1b13A  [g.41.5] PROTEIN (RUBREDOXIN)
    1e-12  37%  1bfyA  [x.x.x] RUBREDOXIN
    1e-12  36%  1c09A  [g.41.5] RUBREDOXIN
    6e-12  50%  2dsxA  [g.41.5 (1e8jA)] RUBREDOXIN
    2e-10  41%  1dx8A  [g.41.5] RUBREDOXIN
:353

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1brfA           ----------------------------------------------------------------------
1be7A           ----------------------------------------------------------------------
1bq8A           ----------------------------------------------------------------------
1b2jA           ----------------------------------------------------------------------
1b2oA           ----------------------------------------------------------------------
1b13A           ----------------------------------------------------------------------
1bfyA           ----------------------------------------------------------------------
1c09A           ----------------------------------------------------------------------
2dsxA           ----------------------------------------------------------------------
1dx8A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1brfA           ----------------------------------------------------------------------
1be7A           ----------------------------------------------------------------------
1bq8A           ----------------------------------------------------------------------
1b2jA           ----------------------------------------------------------------------
1b2oA           ----------------------------------------------------------------------
1b13A           ----------------------------------------------------------------------
1bfyA           ----------------------------------------------------------------------
1c09A           ----------------------------------------------------------------------
2dsxA           ----------------------------------------------------------------------
1dx8A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1brfA           ----------------------------------------------------------------------
1be7A           ----------------------------------------------------------------------
1bq8A           ----------------------------------------------------------------------
1b2jA           ----------------------------------------------------------------------
1b2oA           ----------------------------------------------------------------------
1b13A           ----------------------------------------------------------------------
1bfyA           ----------------------------------------------------------------------
1c09A           ----------------------------------------------------------------------
2dsxA           ----------------------------------------------------------------------
1dx8A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1brfA           ----------------------------------------------------------------------
1be7A           ----------------------------------------------------------------------
1bq8A           ----------------------------------------------------------------------
1b2jA           ----------------------------------------------------------------------
1b2oA           ----------------------------------------------------------------------
1b13A           ----------------------------------------------------------------------
1bfyA           ----------------------------------------------------------------------
1c09A           ----------------------------------------------------------------------
2dsxA           ----------------------------------------------------------------------
1dx8A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDExxxx
1brfA           --------------KWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED----
1be7A           ---------------YTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLSGVGKDQFEEVEE----
1bq8A           ---------------WVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED----
1b2jA           ---------------YTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE----
1b2oA           ---------------YTCTVCVYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE----
1b13A           ---------------YTCTVCAYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE----
1bfyA           ---------------YTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE----
1c09A           ---------------YTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGAGKDQFEEVE-----
2dsxA           --------------IYVCTVCGYEYDPAKGDPDSGIKPGTKFEDLPDDWACPVCGASKDAFE--------
1dx8A           ---------------YECEACGYIYEPEKGDKFAGIPPGTPFVDLSDSFMCPACRSPKNQFKSIKK----


                         .         .         .         .         *         .         .:420
query           xxx
1brfA           ---
1be7A           ---
1bq8A           ---
1b2jA           ---
1b2oA           ---
1b13A           ---
1bfyA           ---
1c09A           ---
2dsxA           ---
1dx8A           ---